F384817
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 154 | 269 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100000895|Ga0068855_10000089524 |
| Length | 309 |
| Sequence | MQNLAPVALFVYNRPEHTRRTLAYLQKNLLADESRLFIFSDAAKTGEDKAKVEQVRQLINEATGFKSVKIIARENNLGLANSIISGVTQLVNEYGKVIVFEDDLLSSPYTLQYFNEALTRYANVEKVMHIGAYMYKLANKALPQTFFFRAATSWGWATWARAWNNFEPDVNVLLKQFDKKKIDQFSIEGTMNFWKQLEGFKAGKNDSWAIRWYASIFLKGGLTLNPSVSLIHNIGNDGSGVHSNKENMYHVKTAQAPVKQFPETIKEDLQAYEAIKNFLKRRKGNLLQRGLRFVKQLQLKYAAKKEIKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 3 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 4 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 5 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 6 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 7 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 8 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 9 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 10 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 11 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 12 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 13 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 14 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 15 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 20 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 71 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 105 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 106 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 107 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 108 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 112 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 113 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 122 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 141 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 142 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 143 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 147 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 148 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 149 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 150 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 151 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 152 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 153 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 154 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.04 |
| Metatranscriptomes | 0 |
| Isolates | 4.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.93 |
| Nodule | 0 |
| Rhizoplane | 0.35 |
| Rhizosphere | 80.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_877448 | 2162886007 | Bacteria | 6830 |
| 2 | JGI24740J21852_10011059 | 3300001979 | Bacteria | 3450 |
| 3 | JGI24740J21852_10040954 | 3300001979 | Bacteria | 1400 |
| 4 | JGI24737J22298_10000997 | 3300001990 | Bacteria | 10036 |
| 5 | JGI24735J21928_10000033 | 3300002067 | Bacteria | 70674 |
| 6 | JGI25162J39368_1000016 | 3300002737 | Bacteria | 288734 |
| 7 | JGI25162J39368_1002453 | 3300002737 | Bacteria | 7176 |
| 8 | JGI25164J39214_1001487 | 3300002772 | Bacteria | 5339 |
| 9 | JGI25165J46597_1001447 | 3300003214 | Bacteria | 12545 |
| 10 | rootH1_10008126 | 3300003316 | Bacteria | 20133 |
| 11 | rootH1_10024265 | 3300003316 | Bacteria | 8597 |
| 12 | rootH2_10010159 | 3300003320 | Bacteria | 33853 |
| 13 | rootH2_10025215 | 3300003320 | Bacteria | 11469 |
| 14 | rootL2_10137200 | 3300003322 | Bacteria | 6428 |
| 15 | rootL2_10183275 | 3300003322 | Bacteria | 4001 |
| 16 | rootH1_10003399 | 3300003323 | Bacteria | 54122 |
| 17 | rootH1_10068310 | 3300003316 | Bacteria | 1452 |
| 18 | rootH1_10068310 | 3300003323 | Bacteria | 8470 |
| 19 | Ga0055530_10001274 | 3300003791 | Bacteria | 19038 |
| 20 | Ga0070658_10000008 | 3300005327 | Bacteria | 319912 |
| 21 | Ga0070683_100141063 | 3300005329 | Bacteria | 2283 |
| 22 | Ga0070680_100016876 | 3300005336 | Bacteria | 5748 |
| 23 | Ga0070671_100039221 | 3300005355 | Bacteria | 3932 |
| 24 | Ga0070674_100086481 | 3300005356 | Bacteria | 2252 |
| 25 | Ga0070673_100002151 | 3300005364 | Bacteria | 11942 |
| 26 | Ga0070659_100001709 | 3300005366 | Bacteria | 15786 |
| 27 | Ga0070663_100034324 | 3300005455 | Bacteria | 3513 |
| 28 | Ga0070678_100023841 | 3300005456 | Bacteria | 4086 |
| 29 | Ga0070662_100000090 | 3300005457 | Bacteria | 49884 |
| 30 | Ga0070681_10015313 | 3300005458 | Bacteria | 7629 |
| 31 | Ga0068867_100009824 | 3300005459 | Bacteria | 6743 |
| 32 | Ga0070679_100098021 | 3300005530 | Bacteria | 2919 |
| 33 | Ga0068853_100033574 | 3300005539 | Bacteria | 4355 |
| 34 | Ga0068853_100175864 | 3300005539 | Bacteria | 1939 |
| 35 | Ga0070665_100000061 | 3300005548 | Bacteria | 222138 |
| 36 | Ga0068855_100000130 | 3300005563 | Bacteria | 95659 |
| 37 | Ga0068855_100000895 | 3300005563 | Bacteria | 36960 |
| 38 | Ga0068855_100027047 | 3300005563 | Bacteria | 6863 |
| 39 | Ga0068855_100029063 | 3300005563 | Bacteria | 6611 |
| 40 | Ga0068855_100213530 | 3300005563 | Bacteria | 2167 |
| 41 | Ga0068855_100559003 | 3300005563 | Bacteria | 1238 |
| 42 | Ga0068857_100381727 | 3300005577 | Bacteria | 1308 |
| 43 | Ga0068854_100013127 | 3300005578 | Bacteria | 5431 |
| 44 | Ga0068856_100000385 | 3300005614 | Bacteria | 48447 |
| 45 | Ga0068856_100100143 | 3300005614 | Bacteria | 2890 |
| 46 | Ga0068856_100376169 | 3300005614 | Bacteria | 1439 |
| 47 | Ga0068852_100002609 | 3300005616 | Bacteria | 12453 |
| 48 | Ga0068852_100085564 | 3300005616 | Bacteria | 2809 |
| 49 | Ga0075366_10000261 | 3300006195 | Bacteria | 23266 |
| 50 | Ga0075366_10015325 | 3300006195 | Bacteria | 4390 |
| 51 | Ga0097621_100000016 | 3300006237 | Bacteria | 91785 |
| 52 | Ga0068871_100002222 | 3300006358 | Bacteria | 13185 |
| 53 | Ga0068865_100047451 | 3300006881 | Bacteria | 2951 |
| 54 | Ga0105240_10000082 | 3300009093 | Bacteria | 195184 |
| 55 | Ga0105240_10019701 | 3300009093 | Bacteria | 9010 |
| 56 | Ga0105240_10115538 | 3300009093 | Bacteria | 3240 |
| 57 | Ga0105240_10183317 | 3300009093 | Bacteria | 2469 |
| 58 | Ga0105240_10279786 | 3300009093 | Bacteria | 1917 |
| 59 | Ga0105240_10651159 | 3300009093 | Bacteria | 1155 |
| 60 | Ga0105245_10395244 | 3300009098 | Bacteria | 1380 |
| 61 | Ga0105241_10002288 | 3300009174 | Bacteria | 14388 |
| 62 | Ga0105241_10007786 | 3300009174 | Bacteria | 7877 |
| 63 | Ga0105241_10253947 | 3300009174 | Bacteria | 1492 |
| 64 | Ga0105237_10000310 | 3300009545 | Bacteria | 67887 |
| 65 | Ga0105237_10002729 | 3300009545 | Bacteria | 21530 |
| 66 | Ga0105237_10003308 | 3300009545 | Bacteria | 19208 |
| 67 | Ga0105237_10003434 | 3300009545 | Bacteria | 18811 |
| 68 | Ga0105237_10003503 | 3300009545 | Bacteria | 18627 |
| 69 | Ga0105237_10020731 | 3300009545 | Bacteria | 6770 |
| 70 | Ga0105237_10076903 | 3300009545 | Bacteria | 3328 |
| 71 | Ga0105237_10079469 | 3300009545 | Bacteria | 3270 |
| 72 | Ga0105237_10086407 | 3300009545 | Bacteria | 3126 |
| 73 | Ga0105238_10005960 | 3300009551 | Bacteria | 12081 |
| 74 | Ga0105239_10000009 | 3300010375 | Bacteria | 361182 |
| 75 | Ga0105239_10000049 | 3300010375 | Bacteria | 177578 |
| 76 | Ga0105239_10001336 | 3300010375 | Bacteria | 33227 |
| 77 | Ga0105239_10001982 | 3300010375 | Bacteria | 26624 |
| 78 | Ga0105239_10002604 | 3300010375 | Bacteria | 22834 |
| 79 | Ga0105239_10032689 | 3300010375 | Bacteria | 5717 |
| 80 | Ga0105239_10034116 | 3300010375 | Bacteria | 5587 |
| 81 | Ga0105239_10041094 | 3300010375 | Bacteria | 5067 |
| 82 | Ga0105239_10074408 | 3300010375 | Bacteria | 3735 |
| 83 | Ga0105239_10547558 | 3300010375 | Bacteria | 1318 |
| 84 | Ga0105246_10030545 | 3300011119 | Bacteria | 3560 |
| 85 | Ga0157373_10000057 | 3300013100 | Bacteria | 99697 |
| 86 | Ga0157373_10004893 | 3300013100 | Bacteria | 10082 |
| 87 | Ga0157373_10018955 | 3300013100 | Bacteria | 5009 |
| 88 | Ga0157373_10022660 | 3300013100 | Bacteria | 4556 |
| 89 | Ga0157371_10000107 | 3300013102 | Bacteria | 126477 |
| 90 | Ga0157371_10003959 | 3300013102 | Bacteria | 13144 |
| 91 | Ga0157371_10005161 | 3300013102 | Bacteria | 11121 |
| 92 | Ga0157371_10005219 | 3300013102 | Bacteria | 11043 |
| 93 | Ga0157371_10010298 | 3300013102 | Bacteria | 7295 |
| 94 | Ga0157371_10096713 | 3300013102 | Bacteria | 2093 |
| 95 | Ga0157370_10004723 | 3300013104 | Bacteria | 15530 |
| 96 | Ga0157370_10006417 | 3300013104 | Bacteria | 12974 |
| 97 | Ga0157370_10008980 | 3300013104 | Bacteria | 10728 |
| 98 | Ga0157370_10020883 | 3300013104 | Bacteria | 6533 |
| 99 | Ga0157370_10035046 | 3300013104 | Bacteria | 4882 |
| 100 | Ga0157370_10047204 | 3300013104 | Bacteria | 4128 |
| 101 | Ga0157370_10061762 | 3300013104 | Bacteria | 3555 |
| 102 | Ga0157370_10633068 | 3300013104 | Bacteria | 978 |
| 103 | Ga0157369_10004189 | 3300013105 | Bacteria | 17086 |
| 104 | Ga0157369_10103704 | 3300013105 | Bacteria | 3030 |
| 105 | Ga0157369_10229921 | 3300013105 | Bacteria | 1939 |
| 106 | Ga0157374_10002405 | 3300013296 | Bacteria | 15782 |
| 107 | Ga0157378_10004071 | 3300013297 | Bacteria | 12914 |
| 108 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 109 | Ga0163162_10001113 | 3300013306 | Bacteria | 24963 |
| 110 | Ga0157372_10000039 | 3300013307 | Bacteria | 165839 |
| 111 | Ga0157372_10001628 | 3300013307 | Bacteria | 24362 |
| 112 | Ga0157372_10002721 | 3300013307 | Bacteria | 19136 |
| 113 | Ga0157372_10028617 | 3300013307 | Bacteria | 6084 |
| 114 | Ga0182008_10000020 | 3300014497 | Bacteria | 228333 |
| 115 | Ga0182008_10000053 | 3300014497 | Bacteria | 102934 |
| 116 | Ga0182008_10030898 | 3300014497 | Bacteria | 2697 |
| 117 | Ga0182006_1000270 | 3300015261 | Bacteria | 46578 |
| 118 | Ga0182006_1003557 | 3300015261 | Bacteria | 7945 |
| 119 | Ga0182006_1004281 | 3300015261 | Bacteria | 7062 |
| 120 | Ga0182007_10006500 | 3300015262 | Bacteria | 5014 |
| 121 | Ga0182007_10033585 | 3300015262 | Unclassified | 1737 |
| 122 | Ga0182007_10070310 | 3300015262 | Unclassified | 1147 |
| 123 | Ga0163161_10001764 | 3300017792 | Bacteria | 15793 |
| 124 | Ga0163161_10002223 | 3300017792 | Bacteria | 13977 |
| 125 | Ga0213872_10005042 | 3300021361 | Bacteria | 6853 |
| 126 | Ga0209563_107195 | 3300025230 | Bacteria | 1847 |
| 127 | Ga0207427_100122 | 3300025231 | Bacteria | 99064 |
| 128 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 129 | Ga0209437_100119 | 3300025233 | Bacteria | 206549 |
| 130 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 131 | Ga0209233_1001171 | 3300025261 | Bacteria | 10589 |
| 132 | Ga0209455_1011097 | 3300025272 | Bacteria | 2239 |
| 133 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 134 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 135 | Ga0207647_10000018 | 3300025904 | Bacteria | 124816 |
| 136 | Ga0207647_10000256 | 3300025904 | Bacteria | 43702 |
| 137 | Ga0207647_10057295 | 3300025904 | Bacteria | 2389 |
| 138 | Ga0207645_10000172 | 3300025907 | Bacteria | 51794 |
| 139 | Ga0207705_10000026 | 3300025909 | Bacteria | 256051 |
| 140 | Ga0207654_10001545 | 3300025911 | Bacteria | 12089 |
| 141 | Ga0207654_10009630 | 3300025911 | Bacteria | 4912 |
| 142 | Ga0207654_10152367 | 3300025911 | Bacteria | 1485 |
| 143 | Ga0207707_10113335 | 3300025912 | Bacteria | 2370 |
| 144 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 145 | Ga0207695_10008492 | 3300025913 | Bacteria | 12841 |
| 146 | Ga0207695_10014708 | 3300025913 | Bacteria | 9253 |
| 147 | Ga0207695_10053168 | 3300025913 | Bacteria | 4237 |
| 148 | Ga0207695_10096670 | 3300025913 | Bacteria | 2955 |
| 149 | Ga0207671_10000366 | 3300025914 | Bacteria | 64454 |
| 150 | Ga0207671_10000925 | 3300025914 | Bacteria | 36841 |
| 151 | Ga0207671_10001165 | 3300025914 | Bacteria | 31349 |
| 152 | Ga0207671_10001993 | 3300025914 | Bacteria | 22502 |
| 153 | Ga0207671_10002661 | 3300025914 | Bacteria | 18743 |
| 154 | Ga0207671_10024174 | 3300025914 | Bacteria | 4572 |
| 155 | Ga0207671_10050184 | 3300025914 | Bacteria | 3090 |
| 156 | Ga0207671_10054447 | 3300025914 | Bacteria | 2964 |
| 157 | Ga0207671_10109835 | 3300025914 | Bacteria | 2097 |
| 158 | Ga0207660_10012815 | 3300025917 | Bacteria | 5489 |
| 159 | Ga0207657_10065270 | 3300025919 | Bacteria | 3104 |
| 160 | Ga0207657_10117474 | 3300025919 | Bacteria | 2191 |
| 161 | Ga0207652_10013929 | 3300025921 | Bacteria | 6510 |
| 162 | Ga0207652_10087166 | 3300025921 | Bacteria | 2738 |
| 163 | Ga0207644_10024160 | 3300025931 | Bacteria | 4170 |
| 164 | Ga0207690_10030096 | 3300025932 | Bacteria | 3459 |
| 165 | Ga0207690_10114193 | 3300025932 | Bacteria | 1950 |
| 166 | Ga0207706_10000718 | 3300025933 | Bacteria | 34581 |
| 167 | Ga0207704_10001706 | 3300025938 | Bacteria | 9825 |
| 168 | Ga0207667_10000274 | 3300025949 | Bacteria | 71328 |
| 169 | Ga0207667_10000394 | 3300025949 | Bacteria | 58926 |
| 170 | Ga0207667_10013681 | 3300025949 | Bacteria | 9274 |
| 171 | Ga0207667_10053760 | 3300025949 | Bacteria | 4236 |
| 172 | Ga0207667_10235241 | 3300025949 | Bacteria | 1875 |
| 173 | Ga0207677_10023555 | 3300026023 | Bacteria | 3807 |
| 174 | Ga0207639_10025101 | 3300026041 | Bacteria | 4320 |
| 175 | Ga0207639_10059773 | 3300026041 | Bacteria | 2938 |
| 176 | Ga0207639_10080034 | 3300026041 | Bacteria | 2584 |
| 177 | Ga0207678_10047800 | 3300026067 | Bacteria | 3699 |
| 178 | Ga0207702_10000586 | 3300026078 | Bacteria | 40370 |
| 179 | Ga0207702_10020425 | 3300026078 | Bacteria | 5486 |
| 180 | Ga0207702_10156640 | 3300026078 | Bacteria | 2077 |
| 181 | Ga0207648_10000658 | 3300026089 | Bacteria | 38677 |
| 182 | Ga0207674_10132812 | 3300026116 | Bacteria | 2452 |
| 183 | Ga0207683_10002693 | 3300026121 | Bacteria | 15527 |
| 184 | Ga0268266_10000053 | 3300028379 | Bacteria | 295181 |
| 185 | Ga0307517_10000198 | 3300028786 | Bacteria | 102181 |
| 186 | Ga0307515_10001710 | 3300028794 | Bacteria | 48899 |
| 187 | Ga0307515_10218574 | 3300028794 | Unclassified | 1730 |
| 188 | Ga0265338_10061134 | 3300028800 | Bacteria | 3303 |
| 189 | Ga0316177_1119485 | 3300030731 | Bacteria | 20673 |
| 190 | Ga0316183_1025240 | 3300030742 | Bacteria | 70534 |
| 191 | Ga0316181_1127411 | 3300030744 | Bacteria | 10048 |
| 192 | Ga0316182_1213793 | 3300030745 | Bacteria | 1572 |
| 193 | Ga0307509_10044847 | 3300031507 | Bacteria | 4774 |
| 194 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 195 | Ga0307414_10002147 | 3300032004 | Bacteria | 10297 |
| 196 | Ga0307414_10057673 | 3300032004 | Unclassified | 2731 |
| 197 | Ga0307507_10000309 | 3300033179 | Bacteria | 98028 |
| 198 | Ga0307510_10000417 | 3300033180 | Bacteria | 40763 |
| 199 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 200 | Ga0395899_0002947 | 3300037312 | Bacteria | 13640 |
| 201 | Ga0395899_0036029 | 3300037312 | Bacteria | 3713 |
| 202 | Ga0395900_0000195 | 3300037418 | Bacteria | 97204 |
| 203 | Ga0395900_0000275 | 3300037418 | Bacteria | 78207 |
| 204 | Ga0395900_0063790 | 3300037418 | Bacteria | 3787 |
| 205 | Ga0395900_0262340 | 3300037418 | Bacteria | 1725 |
| 206 | Ga0395898_0036026 | 3300037466 | Bacteria | 4917 |
| 207 | Ga0395898_0083030 | 3300037466 | Bacteria | 3088 |
| 208 | Ga0395905_0005229 | 3300037471 | Bacteria | 13283 |
| 209 | Ga0395905_0023064 | 3300037471 | Bacteria | 5883 |
| 210 | Ga0395901_0000644 | 3300038443 | Bacteria | 40364 |
| 211 | Ga0395901_0007512 | 3300038443 | Bacteria | 11008 |
| 212 | Ga0395901_0028065 | 3300038443 | Bacteria | 5789 |
| 213 | Ga0436361_0290112 | 3300039447 | Bacteria | 12409 |
| 214 | Ga0466969_0060982 | 3300044656 | Bacteria | 1833 |
| 215 | Ga0466959_0074163 | 3300045049 | Bacteria | 2461 |
| 216 | Ga0466959_0290865 | 3300045049 | Unclassified | 1120 |
| 217 | Ga0466958_0296838 | 3300045836 | Bacteria | 1037 |
| 218 | Ga0495638_0288291 | 3300046460 | Bacteria | 889 |
| 219 | Ga0495650_0001198 | 3300046471 | Bacteria | 27382 |
| 220 | Ga0495650_0058068 | 3300046471 | Bacteria | 1564 |
| 221 | Ga0495585_0000074 | 3300046492 | Bacteria | 102651 |
| 222 | Ga0495585_0000241 | 3300046492 | Bacteria | 56727 |
| 223 | Ga0495583_0035372 | 3300046506 | Bacteria | 2384 |
| 224 | Ga0495606_0000425 | 3300046507 | Bacteria | 70202 |
| 225 | Ga0495606_0009721 | 3300046507 | Bacteria | 8092 |
| 226 | Ga0495606_0010375 | 3300046507 | Bacteria | 7741 |
| 227 | Ga0495606_0023089 | 3300046507 | Bacteria | 4518 |
| 228 | Ga0495610_0005131 | 3300046512 | Bacteria | 9404 |
| 229 | Ga0495610_0106154 | 3300046512 | Bacteria | 1251 |
| 230 | Ga0495616_0002470 | 3300046513 | Bacteria | 12255 |
| 231 | Ga0495616_0023673 | 3300046513 | Bacteria | 3301 |
| 232 | Ga0495631_0021300 | 3300046518 | Bacteria | 3019 |
| 233 | Ga0495644_0049680 | 3300046523 | Unclassified | 1574 |
| 234 | Ga0495648_0002824 | 3300046524 | Bacteria | 15618 |
| 235 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 236 | Ga0495633_0002853 | 3300046558 | Bacteria | 11870 |
| 237 | Ga0495668_0000054 | 3300046616 | Bacteria | 203960 |
| 238 | Ga0495625_0000067 | 3300046660 | Bacteria | 171483 |
| 239 | Ga0495625_0000355 | 3300046660 | Bacteria | 69806 |
| 240 | Ga0495625_0000548 | 3300046660 | Bacteria | 55064 |
| 241 | Ga0495625_0004553 | 3300046660 | Bacteria | 13050 |
| 242 | Ga0495625_0015165 | 3300046660 | Bacteria | 6116 |
| 243 | Ga0495625_0144911 | 3300046660 | Bacteria | 1600 |
| 244 | Ga0495661_0000946 | 3300046665 | Bacteria | 26340 |
| 245 | Ga0495661_0006900 | 3300046665 | Bacteria | 7939 |
| 246 | Ga0495649_0000135 | 3300046694 | Bacteria | 64533 |
| 247 | Ga0495687_035445 | 3300047443 | Bacteria | 2244 |
| 248 | Ga0495677_0072916 | 3300047445 | Unclassified | 1281 |
| 249 | Ga0495686_0000533 | 3300047472 | Bacteria | 54324 |
| 250 | Ga0495686_0002591 | 3300047472 | Bacteria | 16802 |
| 251 | Ga0495686_0186022 | 3300047472 | Bacteria | 1200 |
| 252 | Ga0496122_0000876 | 3300048925 | Bacteria | 56653 |
| 253 | Ga0496123_0000777 | 3300048926 | Bacteria | 51679 |
| 254 | Ga0496125_0158600 | 3300048928 | Bacteria | 1541 |
| 255 | Ga0495678_003201 | 3300049459 | Bacteria | 10305 |
| 256 | Ga0495682_0025753 | 3300049460 | Bacteria | 2188 |
| 257 | Ga0501223_004610 | 3300049663 | Unclassified | 2936 |
| 258 | nmdc:mga0k408_245_c1 | 3300050493 | Bacteria | 29347 |
| 259 | nmdc:mga0k408_7448_c1 | 3300050493 | Bacteria | 5844 |
| 260 | Ga0500635_0000479 | 3300053080 | Bacteria | 11303 |
| 261 | Ga0500635_0006586 | 3300053080 | Bacteria | 3108 |
| 262 | Ga0500651_0000058 | 3300053093 | Bacteria | 72493 |
| 263 | Ga0500608_000674 | 3300053122 | Bacteria | 12492 |
| 264 | Ga0500608_018720 | 3300053122 | Bacteria | 3165 |
| 265 | Ga0500618_000018 | 3300053125 | Bacteria | 163272 |
| 266 | Ga0500559_0081134 | 3300053136 | Bacteria | 1474 |
| 267 | Ga0500622_0005326 | 3300053156 | Bacteria | 7755 |
| 268 | Ga0500624_001084 | 3300053157 | Bacteria | 5180 |
| 269 | Ga0500636_0037808 | 3300053177 | Bacteria | 2855 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2884933994 | 2884935720 | 271 |
| 2 | 3300046660 | Ga0495625_0144911 | Ga0495625_0144911_129_947 | 272 |
| 3 | 3300046460 | Ga0495638_0288291 | Ga0495638_0288291_45_872 | 275 |
| 4 | 3300005329 | Ga0070683_100141063 | Ga0070683_1001410633 | 290 |
| 5 | 3300005614 | Ga0068856_100376169 | Ga0068856_1003761692 | 290 |
| 6 | 3300013100 | Ga0157373_10000057 | Ga0157373_1000005778 | 290 |
| 7 | 3300013307 | Ga0157372_10028617 | Ga0157372_100286173 | 290 |
| 8 | 3300026078 | Ga0207702_10156640 | Ga0207702_101566402 | 290 |
| 9 | 3300032004 | Ga0307414_10057673 | Ga0307414_100576733 | 292 |
| 10 | iso_pu_bacteria | 2599185184 | 2599481844 | 295 |
| 11 | iso_pu_bacteria | 2738541283 | 2738756073 | 295 |
| 12 | iso_pu_bacteria | 2738541284 | 2738763302 | 295 |
| 13 | iso_pu_bacteria | 2739367656 | 2739615245 | 295 |
| 14 | iso_pu_bacteria | 2775506987 | 2776616091 | 295 |
| 15 | iso_pu_bacteria | 2842903701 | 2842904761 | 295 |
| 16 | iso_pu_bacteria | 2852623160 | 2852625755 | 295 |
| 17 | iso_pu_bacteria | 2902048731 | 2902050758 | 295 |
| 18 | iso_pu_bacteria | 2919437846 | 2919440514 | 295 |
| 19 | iso_pu_bacteria | 2928078545 | 2928083995 | 295 |
| 20 | iso_pu_bacteria | 2928147474 | 2928152920 | 295 |
| 21 | iso_pu_bacteria | 2932082852 | 2932086010 | 295 |
| 22 | iso_pu_bacteria | 2977232053 | 2977235670 | 295 |
| 23 | 2162886007 | SwRhRL2b_contig_877448 | SwRhRL2b_0275.00002230 | 299 |
| 24 | 3300001979 | JGI24740J21852_10011059 | JGI24740J21852_100110593 | 299 |
| 25 | 3300001979 | JGI24740J21852_10040954 | JGI24740J21852_100409542 | 299 |
| 26 | 3300001990 | JGI24737J22298_10000997 | JGI24737J22298_100009975 | 299 |
| 27 | 3300002067 | JGI24735J21928_10000033 | JGI24735J21928_1000003367 | 299 |
| 28 | 3300002737 | JGI25162J39368_1000016 | JGI25162J39368_1000016171 | 299 |
| 29 | 3300002737 | JGI25162J39368_1002453 | JGI25162J39368_10024534 | 299 |
| 30 | 3300002772 | JGI25164J39214_1001487 | JGI25164J39214_10014874 | 299 |
| 31 | 3300003214 | JGI25165J46597_1001447 | JGI25165J46597_10014474 | 299 |
| 32 | 3300003316 | rootH1_10008126 | rootH1_1000812615 | 299 |
| 33 | 3300003316 | rootH1_10024265 | rootH1_100242653 | 299 |
| 34 | 3300003320 | rootH2_10010159 | rootH2_1001015926 | 299 |
| 35 | 3300003320 | rootH2_10025215 | rootH2_100252154 | 299 |
| 36 | 3300003322 | rootL2_10137200 | rootL2_101372005 | 299 |
| 37 | 3300003322 | rootL2_10183275 | rootL2_101832753 | 299 |
| 38 | 3300003323 | rootH1_10003399 | rootH1_100033992 | 299 |
| 39 | 3300003323 | rootH1_10068310 | rootH1_100683107 | 299 |
| 40 | 3300003791 | Ga0055530_10001274 | Ga0055530_1000127415 | 299 |
| 41 | 3300005327 | Ga0070658_10000008 | Ga0070658_10000008236 | 299 |
| 42 | 3300005336 | Ga0070680_100016876 | Ga0070680_1000168762 | 299 |
| 43 | 3300005355 | Ga0070671_100039221 | Ga0070671_1000392212 | 299 |
| 44 | 3300005356 | Ga0070674_100086481 | Ga0070674_1000864812 | 299 |
| 45 | 3300005364 | Ga0070673_100002151 | Ga0070673_1000021511 | 299 |
| 46 | 3300005366 | Ga0070659_100001709 | Ga0070659_1000017095 | 299 |
| 47 | 3300005455 | Ga0070663_100034324 | Ga0070663_1000343243 | 299 |
| 48 | 3300005456 | Ga0070678_100023841 | Ga0070678_1000238412 | 299 |
| 49 | 3300005457 | Ga0070662_100000090 | Ga0070662_1000000906 | 299 |
| 50 | 3300005458 | Ga0070681_10015313 | Ga0070681_100153133 | 299 |
| 51 | 3300005459 | Ga0068867_100009824 | Ga0068867_1000098245 | 299 |
| 52 | 3300005530 | Ga0070679_100098021 | Ga0070679_1000980212 | 299 |
| 53 | 3300005539 | Ga0068853_100033574 | Ga0068853_1000335742 | 299 |
| 54 | 3300005539 | Ga0068853_100175864 | Ga0068853_1001758642 | 299 |
| 55 | 3300005548 | Ga0070665_100000061 | Ga0070665_100000061168 | 299 |
| 56 | 3300005563 | Ga0068855_100000130 | Ga0068855_1000001307 | 299 |
| 57 | 3300005563 | Ga0068855_100000895 | Ga0068855_10000089524 | 299 |
| 58 | 3300005563 | Ga0068855_100027047 | Ga0068855_1000270473 | 299 |
| 59 | 3300005563 | Ga0068855_100029063 | Ga0068855_1000290633 | 299 |
| 60 | 3300005563 | Ga0068855_100213530 | Ga0068855_1002135302 | 299 |
| 61 | 3300005563 | Ga0068855_100559003 | Ga0068855_1005590032 | 299 |
| 62 | 3300005577 | Ga0068857_100381727 | Ga0068857_1003817271 | 299 |
| 63 | 3300005578 | Ga0068854_100013127 | Ga0068854_1000131272 | 299 |
| 64 | 3300005614 | Ga0068856_100000385 | Ga0068856_10000038517 | 299 |
| 65 | 3300005614 | Ga0068856_100100143 | Ga0068856_1001001432 | 299 |
| 66 | 3300005616 | Ga0068852_100002609 | Ga0068852_1000026092 | 299 |
| 67 | 3300005616 | Ga0068852_100085564 | Ga0068852_1000855642 | 299 |
| 68 | 3300006195 | Ga0075366_10000261 | Ga0075366_1000026112 | 299 |
| 69 | 3300006195 | Ga0075366_10015325 | Ga0075366_100153253 | 299 |
| 70 | 3300006237 | Ga0097621_100000016 | Ga0097621_10000001682 | 299 |
| 71 | 3300006358 | Ga0068871_100002222 | Ga0068871_1000022227 | 299 |
| 72 | 3300006881 | Ga0068865_100047451 | Ga0068865_1000474512 | 299 |
| 73 | 3300009093 | Ga0105240_10000082 | Ga0105240_1000008246 | 299 |
| 74 | 3300009093 | Ga0105240_10019701 | Ga0105240_100197015 | 299 |
| 75 | 3300009093 | Ga0105240_10115538 | Ga0105240_101155383 | 299 |
| 76 | 3300009093 | Ga0105240_10183317 | Ga0105240_101833172 | 299 |
| 77 | 3300009093 | Ga0105240_10279786 | Ga0105240_102797862 | 299 |
| 78 | 3300009093 | Ga0105240_10651159 | Ga0105240_106511592 | 299 |
| 79 | 3300009098 | Ga0105245_10395244 | Ga0105245_103952442 | 299 |
| 80 | 3300009174 | Ga0105241_10002288 | Ga0105241_1000228810 | 299 |
| 81 | 3300009174 | Ga0105241_10007786 | Ga0105241_100077864 | 299 |
| 82 | 3300009174 | Ga0105241_10253947 | Ga0105241_102539472 | 299 |
| 83 | 3300009545 | Ga0105237_10000310 | Ga0105237_1000031035 | 299 |
| 84 | 3300009545 | Ga0105237_10002729 | Ga0105237_100027299 | 299 |
| 85 | 3300009545 | Ga0105237_10003308 | Ga0105237_1000330812 | 299 |
| 86 | 3300009545 | Ga0105237_10003434 | Ga0105237_100034347 | 299 |
| 87 | 3300009545 | Ga0105237_10003503 | Ga0105237_100035035 | 299 |
| 88 | 3300009545 | Ga0105237_10020731 | Ga0105237_100207315 | 299 |
| 89 | 3300009545 | Ga0105237_10076903 | Ga0105237_100769033 | 299 |
| 90 | 3300009545 | Ga0105237_10079469 | Ga0105237_100794692 | 299 |
| 91 | 3300009545 | Ga0105237_10086407 | Ga0105237_100864072 | 299 |
| 92 | 3300009551 | Ga0105238_10005960 | Ga0105238_100059603 | 299 |
| 93 | 3300010375 | Ga0105239_10000009 | Ga0105239_1000000993 | 299 |
| 94 | 3300010375 | Ga0105239_10000049 | Ga0105239_10000049120 | 299 |
| 95 | 3300010375 | Ga0105239_10001336 | Ga0105239_1000133624 | 299 |
| 96 | 3300010375 | Ga0105239_10001982 | Ga0105239_100019826 | 299 |
| 97 | 3300010375 | Ga0105239_10002604 | Ga0105239_1000260416 | 299 |
| 98 | 3300010375 | Ga0105239_10032689 | Ga0105239_100326894 | 299 |
| 99 | 3300010375 | Ga0105239_10034116 | Ga0105239_100341166 | 299 |
| 100 | 3300010375 | Ga0105239_10041094 | Ga0105239_100410941 | 299 |
| 101 | 3300010375 | Ga0105239_10074408 | Ga0105239_100744082 | 299 |
| 102 | 3300010375 | Ga0105239_10547558 | Ga0105239_105475582 | 299 |
| 103 | 3300011119 | Ga0105246_10030545 | Ga0105246_100305453 | 299 |
| 104 | 3300013100 | Ga0157373_10004893 | Ga0157373_100048933 | 299 |
| 105 | 3300013100 | Ga0157373_10018955 | Ga0157373_100189553 | 299 |
| 106 | 3300013100 | Ga0157373_10022660 | Ga0157373_100226602 | 299 |
| 107 | 3300013102 | Ga0157371_10000107 | Ga0157371_100001075 | 299 |
| 108 | 3300013102 | Ga0157371_10003959 | Ga0157371_100039599 | 299 |
| 109 | 3300013102 | Ga0157371_10005161 | Ga0157371_100051613 | 299 |
| 110 | 3300013102 | Ga0157371_10005219 | Ga0157371_100052195 | 299 |
| 111 | 3300013102 | Ga0157371_10010298 | Ga0157371_100102988 | 299 |
| 112 | 3300013102 | Ga0157371_10096713 | Ga0157371_100967132 | 299 |
| 113 | 3300013104 | Ga0157370_10004723 | Ga0157370_1000472311 | 299 |
| 114 | 3300013104 | Ga0157370_10006417 | Ga0157370_100064176 | 299 |
| 115 | 3300013104 | Ga0157370_10008980 | Ga0157370_100089808 | 299 |
| 116 | 3300013104 | Ga0157370_10020883 | Ga0157370_100208835 | 299 |
| 117 | 3300013104 | Ga0157370_10035046 | Ga0157370_100350463 | 299 |
| 118 | 3300013104 | Ga0157370_10047204 | Ga0157370_100472043 | 299 |
| 119 | 3300013104 | Ga0157370_10061762 | Ga0157370_100617624 | 299 |
| 120 | 3300013104 | Ga0157370_10633068 | Ga0157370_106330681 | 299 |
| 121 | 3300013105 | Ga0157369_10004189 | Ga0157369_1000418911 | 299 |
| 122 | 3300013105 | Ga0157369_10103704 | Ga0157369_101037042 | 299 |
| 123 | 3300013105 | Ga0157369_10229921 | Ga0157369_102299213 | 299 |
| 124 | 3300013296 | Ga0157374_10002405 | Ga0157374_100024056 | 299 |
| 125 | 3300013297 | Ga0157378_10004071 | Ga0157378_100040713 | 299 |
| 126 | 3300013306 | Ga0163162_10000012 | Ga0163162_10000012198 | 299 |
| 127 | 3300013306 | Ga0163162_10001113 | Ga0163162_1000111317 | 299 |
| 128 | 3300013307 | Ga0157372_10000039 | Ga0157372_1000003961 | 299 |
| 129 | 3300013307 | Ga0157372_10001628 | Ga0157372_100016288 | 299 |
| 130 | 3300013307 | Ga0157372_10002721 | Ga0157372_100027213 | 299 |
| 131 | 3300014497 | Ga0182008_10000020 | Ga0182008_10000020138 | 299 |
| 132 | 3300014497 | Ga0182008_10000053 | Ga0182008_1000005383 | 299 |
| 133 | 3300014497 | Ga0182008_10030898 | Ga0182008_100308982 | 299 |
| 134 | 3300015261 | Ga0182006_1000270 | Ga0182006_100027032 | 299 |
| 135 | 3300015261 | Ga0182006_1003557 | Ga0182006_10035575 | 299 |
| 136 | 3300015261 | Ga0182006_1004281 | Ga0182006_10042817 | 299 |
| 137 | 3300015262 | Ga0182007_10006500 | Ga0182007_100065003 | 299 |
| 138 | 3300015262 | Ga0182007_10033585 | Ga0182007_100335852 | 299 |
| 139 | 3300015262 | Ga0182007_10070310 | Ga0182007_100703101 | 299 |
| 140 | 3300017792 | Ga0163161_10001764 | Ga0163161_1000176412 | 299 |
| 141 | 3300017792 | Ga0163161_10002223 | Ga0163161_1000222312 | 299 |
| 142 | 3300021361 | Ga0213872_10005042 | Ga0213872_100050425 | 299 |
| 143 | 3300025230 | Ga0209563_107195 | Ga0209563_1071953 | 299 |
| 144 | 3300025231 | Ga0207427_100122 | Ga0207427_10012268 | 299 |
| 145 | 3300025233 | Ga0209437_100048 | Ga0209437_100048228 | 299 |
| 146 | 3300025233 | Ga0209437_100119 | Ga0209437_10011987 | 299 |
| 147 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029148 | 299 |
| 148 | 3300025261 | Ga0209233_1001171 | Ga0209233_10011713 | 299 |
| 149 | 3300025272 | Ga0209455_1011097 | Ga0209455_10110972 | 299 |
| 150 | 3300025292 | Ga0209676_1000022 | Ga0209676_100002268 | 299 |
| 151 | 3300025298 | Ga0209050_1000020 | Ga0209050_1000020472 | 299 |
| 152 | 3300025904 | Ga0207647_10000018 | Ga0207647_1000001862 | 299 |
| 153 | 3300025904 | Ga0207647_10000256 | Ga0207647_1000025639 | 299 |
| 154 | 3300025904 | Ga0207647_10057295 | Ga0207647_100572952 | 299 |
| 155 | 3300025907 | Ga0207645_10000172 | Ga0207645_1000017211 | 299 |
| 156 | 3300025909 | Ga0207705_10000026 | Ga0207705_10000026237 | 299 |
| 157 | 3300025911 | Ga0207654_10001545 | Ga0207654_100015453 | 299 |
| 158 | 3300025911 | Ga0207654_10009630 | Ga0207654_100096303 | 299 |
| 159 | 3300025911 | Ga0207654_10152367 | Ga0207654_101523672 | 299 |
| 160 | 3300025912 | Ga0207707_10113335 | Ga0207707_101133352 | 299 |
| 161 | 3300025913 | Ga0207695_10000053 | Ga0207695_10000053305 | 299 |
| 162 | 3300025913 | Ga0207695_10008492 | Ga0207695_100084925 | 299 |
| 163 | 3300025913 | Ga0207695_10014708 | Ga0207695_100147082 | 299 |
| 164 | 3300025913 | Ga0207695_10053168 | Ga0207695_100531686 | 299 |
| 165 | 3300025913 | Ga0207695_10096670 | Ga0207695_100966703 | 299 |
| 166 | 3300025914 | Ga0207671_10000366 | Ga0207671_1000036630 | 299 |
| 167 | 3300025914 | Ga0207671_10000925 | Ga0207671_1000092514 | 299 |
| 168 | 3300025914 | Ga0207671_10001165 | Ga0207671_1000116514 | 299 |
| 169 | 3300025914 | Ga0207671_10001993 | Ga0207671_1000199315 | 299 |
| 170 | 3300025914 | Ga0207671_10002661 | Ga0207671_100026618 | 299 |
| 171 | 3300025914 | Ga0207671_10024174 | Ga0207671_100241742 | 299 |
| 172 | 3300025914 | Ga0207671_10050184 | Ga0207671_100501842 | 299 |
| 173 | 3300025914 | Ga0207671_10054447 | Ga0207671_100544474 | 299 |
| 174 | 3300025914 | Ga0207671_10109835 | Ga0207671_101098352 | 299 |
| 175 | 3300025917 | Ga0207660_10012815 | Ga0207660_100128152 | 299 |
| 176 | 3300025919 | Ga0207657_10065270 | Ga0207657_100652702 | 299 |
| 177 | 3300025919 | Ga0207657_10117474 | Ga0207657_101174741 | 299 |
| 178 | 3300025921 | Ga0207652_10013929 | Ga0207652_100139293 | 299 |
| 179 | 3300025921 | Ga0207652_10087166 | Ga0207652_100871662 | 299 |
| 180 | 3300025931 | Ga0207644_10024160 | Ga0207644_100241602 | 299 |
| 181 | 3300025932 | Ga0207690_10030096 | Ga0207690_100300961 | 299 |
| 182 | 3300025932 | Ga0207690_10114193 | Ga0207690_101141932 | 299 |
| 183 | 3300025933 | Ga0207706_10000718 | Ga0207706_1000071810 | 299 |
| 184 | 3300025938 | Ga0207704_10001706 | Ga0207704_100017066 | 299 |
| 185 | 3300025949 | Ga0207667_10000274 | Ga0207667_1000027416 | 299 |
| 186 | 3300025949 | Ga0207667_10000394 | Ga0207667_1000039429 | 299 |
| 187 | 3300025949 | Ga0207667_10013681 | Ga0207667_100136817 | 299 |
| 188 | 3300025949 | Ga0207667_10053760 | Ga0207667_100537602 | 299 |
| 189 | 3300025949 | Ga0207667_10235241 | Ga0207667_102352412 | 299 |
| 190 | 3300026023 | Ga0207677_10023555 | Ga0207677_100235552 | 299 |
| 191 | 3300026041 | Ga0207639_10025101 | Ga0207639_100251013 | 299 |
| 192 | 3300026041 | Ga0207639_10059773 | Ga0207639_100597732 | 299 |
| 193 | 3300026041 | Ga0207639_10080034 | Ga0207639_100800343 | 299 |
| 194 | 3300026067 | Ga0207678_10047800 | Ga0207678_100478005 | 299 |
| 195 | 3300026078 | Ga0207702_10000586 | Ga0207702_1000058634 | 299 |
| 196 | 3300026078 | Ga0207702_10020425 | Ga0207702_100204254 | 299 |
| 197 | 3300026089 | Ga0207648_10000658 | Ga0207648_1000065813 | 299 |
| 198 | 3300026116 | Ga0207674_10132812 | Ga0207674_101328122 | 299 |
| 199 | 3300026121 | Ga0207683_10002693 | Ga0207683_100026933 | 299 |
| 200 | 3300028379 | Ga0268266_10000053 | Ga0268266_1000005336 | 299 |
| 201 | 3300028786 | Ga0307517_10000198 | Ga0307517_100001985 | 299 |
| 202 | 3300028794 | Ga0307515_10001710 | Ga0307515_1000171040 | 299 |
| 203 | 3300028794 | Ga0307515_10218574 | Ga0307515_102185741 | 299 |
| 204 | 3300028800 | Ga0265338_10061134 | Ga0265338_100611341 | 299 |
| 205 | 3300030731 | Ga0316177_1119485 | Ga0316177_11194855 | 299 |
| 206 | 3300030742 | Ga0316183_1025240 | Ga0316183_102524011 | 299 |
| 207 | 3300030744 | Ga0316181_1127411 | Ga0316181_11274114 | 299 |
| 208 | 3300030745 | Ga0316182_1213793 | Ga0316182_12137932 | 299 |
| 209 | 3300031507 | Ga0307509_10044847 | Ga0307509_100448473 | 299 |
| 210 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001258 | 299 |
| 211 | 3300032004 | Ga0307414_10002147 | Ga0307414_100021478 | 299 |
| 212 | 3300033179 | Ga0307507_10000309 | Ga0307507_1000030958 | 299 |
| 213 | 3300033180 | Ga0307510_10000417 | Ga0307510_1000041735 | 299 |
| 214 | 3300037312 | Ga0395899_0000024 | Ga0395899_0000024_354870_355781 | 299 |
| 215 | 3300037312 | Ga0395899_0002947 | Ga0395899_0002947_11685_12602 | 299 |
| 216 | 3300037312 | Ga0395899_0036029 | Ga0395899_0036029_114_1040 | 299 |
| 217 | 3300037418 | Ga0395900_0000195 | Ga0395900_0000195_24605_25522 | 299 |
| 218 | 3300037418 | Ga0395900_0000275 | Ga0395900_0000275_67716_68633 | 299 |
| 219 | 3300037418 | Ga0395900_0063790 | Ga0395900_0063790_1280_2206 | 299 |
| 220 | 3300037418 | Ga0395900_0262340 | Ga0395900_0262340_582_1493 | 299 |
| 221 | 3300037466 | Ga0395898_0036026 | Ga0395898_0036026_3721_4638 | 299 |
| 222 | 3300037466 | Ga0395898_0083030 | Ga0395898_0083030_810_1736 | 299 |
| 223 | 3300037471 | Ga0395905_0005229 | Ga0395905_0005229_4578_5504 | 299 |
| 224 | 3300037471 | Ga0395905_0023064 | Ga0395905_0023064_1121_2038 | 299 |
| 225 | 3300038443 | Ga0395901_0000644 | Ga0395901_0000644_34172_35089 | 299 |
| 226 | 3300038443 | Ga0395901_0007512 | Ga0395901_0007512_5522_6448 | 299 |
| 227 | 3300038443 | Ga0395901_0028065 | Ga0395901_0028065_2719_3639 | 299 |
| 228 | 3300039447 | Ga0436361_0290112 | Ga0436361_0290112_2510_3430 | 299 |
| 229 | 3300044656 | Ga0466969_0060982 | Ga0466969_0060982_400_1311 | 299 |
| 230 | 3300045049 | Ga0466959_0074163 | Ga0466959_0074163_1205_2116 | 299 |
| 231 | 3300045049 | Ga0466959_0290865 | Ga0466959_0290865_119_1036 | 299 |
| 232 | 3300045836 | Ga0466958_0296838 | Ga0466958_0296838_12_923 | 299 |
| 233 | 3300046471 | Ga0495650_0001198 | Ga0495650_0001198_14350_15252 | 299 |
| 234 | 3300046471 | Ga0495650_0058068 | Ga0495650_0058068_593_1492 | 299 |
| 235 | 3300046492 | Ga0495585_0000074 | Ga0495585_0000074_66150_67052 | 299 |
| 236 | 3300046492 | Ga0495585_0000241 | Ga0495585_0000241_37512_38411 | 299 |
| 237 | 3300046506 | Ga0495583_0035372 | Ga0495583_0035372_606_1508 | 299 |
| 238 | 3300046507 | Ga0495606_0000425 | Ga0495606_0000425_2388_3290 | 299 |
| 239 | 3300046507 | Ga0495606_0009721 | Ga0495606_0009721_5472_6371 | 299 |
| 240 | 3300046507 | Ga0495606_0010375 | Ga0495606_0010375_6542_7441 | 299 |
| 241 | 3300046507 | Ga0495606_0023089 | Ga0495606_0023089_25_924 | 299 |
| 242 | 3300046512 | Ga0495610_0005131 | Ga0495610_0005131_7206_8108 | 299 |
| 243 | 3300046512 | Ga0495610_0106154 | Ga0495610_0106154_13_912 | 299 |
| 244 | 3300046513 | Ga0495616_0002470 | Ga0495616_0002470_6152_7054 | 299 |
| 245 | 3300046513 | Ga0495616_0023673 | Ga0495616_0023673_269_1168 | 299 |
| 246 | 3300046518 | Ga0495631_0021300 | Ga0495631_0021300_1728_2645 | 299 |
| 247 | 3300046523 | Ga0495644_0049680 | Ga0495644_0049680_571_1488 | 299 |
| 248 | 3300046524 | Ga0495648_0002824 | Ga0495648_0002824_6362_7261 | 299 |
| 249 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_15266_16165 | 299 |
| 250 | 3300046558 | Ga0495633_0002853 | Ga0495633_0002853_6008_6910 | 299 |
| 251 | 3300046616 | Ga0495668_0000054 | Ga0495668_0000054_184729_185658 | 299 |
| 252 | 3300046660 | Ga0495625_0000067 | Ga0495625_0000067_108354_109256 | 299 |
| 253 | 3300046660 | Ga0495625_0000355 | Ga0495625_0000355_18317_19216 | 299 |
| 254 | 3300046660 | Ga0495625_0000548 | Ga0495625_0000548_41314_42231 | 299 |
| 255 | 3300046660 | Ga0495625_0004553 | Ga0495625_0004553_5747_6646 | 299 |
| 256 | 3300046660 | Ga0495625_0015165 | Ga0495625_0015165_3730_4629 | 299 |
| 257 | 3300046665 | Ga0495661_0000946 | Ga0495661_0000946_8052_8963 | 299 |
| 258 | 3300046665 | Ga0495661_0006900 | Ga0495661_0006900_3743_4645 | 299 |
| 259 | 3300046694 | Ga0495649_0000135 | Ga0495649_0000135_62188_63090 | 299 |
| 260 | 3300047443 | Ga0495687_035445 | Ga0495687_035445_1267_2166 | 299 |
| 261 | 3300047445 | Ga0495677_0072916 | Ga0495677_0072916_317_1234 | 299 |
| 262 | 3300047472 | Ga0495686_0000533 | Ga0495686_0000533_51633_52550 | 299 |
| 263 | 3300047472 | Ga0495686_0002591 | Ga0495686_0002591_1359_2258 | 299 |
| 264 | 3300047472 | Ga0495686_0186022 | Ga0495686_0186022_31_948 | 299 |
| 265 | 3300048925 | Ga0496122_0000876 | Ga0496122_0000876_32526_33425 | 299 |
| 266 | 3300048926 | Ga0496123_0000777 | Ga0496123_0000777_42062_42961 | 299 |
| 267 | 3300048928 | Ga0496125_0158600 | Ga0496125_0158600_169_1068 | 299 |
| 268 | 3300049459 | Ga0495678_003201 | Ga0495678_003201_9297_10196 | 299 |
| 269 | 3300049460 | Ga0495682_0025753 | Ga0495682_0025753_399_1298 | 299 |
| 270 | 3300049663 | Ga0501223_004610 | Ga0501223_004610_511_1425 | 299 |
| 271 | 3300050493 | nmdc:mga0k408_245_c1 | nmdc:mga0k408_245_c1_11171_12088 | 299 |
| 272 | 3300050493 | nmdc:mga0k408_7448_c1 | nmdc:mga0k408_7448_c1_4169_5071 | 299 |
| 273 | 3300053080 | Ga0500635_0000479 | Ga0500635_0000479_1438_2355 | 299 |
| 274 | 3300053080 | Ga0500635_0006586 | Ga0500635_0006586_1544_2461 | 299 |
| 275 | 3300053093 | Ga0500651_0000058 | Ga0500651_0000058_68173_69072 | 299 |
| 276 | 3300053122 | Ga0500608_000674 | Ga0500608_000674_8346_9263 | 299 |
| 277 | 3300053122 | Ga0500608_018720 | Ga0500608_018720_69_968 | 299 |
| 278 | 3300053125 | Ga0500618_000018 | Ga0500618_000018_85451_86350 | 299 |
| 279 | 3300053136 | Ga0500559_0081134 | Ga0500559_0081134_485_1414 | 299 |
| 280 | 3300053156 | Ga0500622_0005326 | Ga0500622_0005326_217_1116 | 299 |
| 281 | 3300053157 | Ga0500624_001084 | Ga0500624_001084_2314_3213 | 299 |
| 282 | 3300053177 | Ga0500636_0037808 | Ga0500636_0037808_1293_2222 | 299 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z86-assembly2.cif.gz_C | crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp | 0.7327 | 4 | 130 |
| 2z86-assembly1.cif.gz_A | crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp | 0.7303 | 1 | 130 |
| 2z86-assembly2.cif.gz_D | crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp | 0.7284 | 3 | 130 |
| 2z87-assembly2.cif.gz_A | crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp | 0.7166 | 3 | 131 |
| 2z87-assembly3.cif.gz_B | crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp | 0.7082 | 1 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6MR53_58_299_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7538 | 9 | 233 | 3.90.550.10 |
| af_A0A368UI76_104_327_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7469 | 3 | 239 | 3.90.550.10 |
| af_Q4D3G6_70_312_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7314 | 8 | 227 | 3.90.550.10 |
| 2z86A02 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7303 | 1 | 130 | 3.90.550.10 |
| af_G5EBG7_70_294_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7254 | 3 | 250 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520D6I9-F1-model_v4 | Glycosyltransferase | 0.998 | 1 | 235 |
GO:0016740
|
| AF-A0A5J4QI32-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9948 | 4 | 132 |
GO:0000139
GO:0006486 GO:0008375 GO:0046872 |
| AF-A0A520D6I9-F1-model_v4 | Glycosyltransferase | 0.9938 | 1 | 235 |
GO:0016740
|
| AF-A0A4V1T1Z3-F1-model_v4 | Sugar transferase | 0.9922 | 1 | 162 |
GO:0016740
|
| AF-A0A359AZQ9-F1-model_v4 | Glycosyl transferase | 0.99 | 3 | 174 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar