F384817

General Info

Members Datasets Scaffolds Average Seq Length
282 154 269 303

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000895|Ga0068855_10000089524
Length 309
Sequence MQNLAPVALFVYNRPEHTRRTLAYLQKNLLADESRLFIFSDAAKTGEDKAKVEQVRQLINEATGFKSVKIIARENNLGLANSIISGVTQLVNEYGKVIVFEDDLLSSPYTLQYFNEALTRYANVEKVMHIGAYMYKLANKALPQTFFFRAATSWGWATWARAWNNFEPDVNVLLKQFDKKKIDQFSIEGTMNFWKQLEGFKAGKNDSWAIRWYASIFLKGGLTLNPSVSLIHNIGNDGSGVHSNKENMYHVKTAQAPVKQFPETIKEDLQAYEAIKNFLKRRKGNLLQRGLRFVKQLQLKYAAKKEIKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2739367656 Pedobacter sp. CF523 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
8 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
9 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
10 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
11 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
12 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
13 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
14 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
15 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
105 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
106 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
107 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
150 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
154 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.04
Metatranscriptomes 0
Isolates 4.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.93
Nodule 0
Rhizoplane 0.35
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 8.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_877448 2162886007 Bacteria 6830
2 JGI24740J21852_10011059 3300001979 Bacteria 3450
3 JGI24740J21852_10040954 3300001979 Bacteria 1400
4 JGI24737J22298_10000997 3300001990 Bacteria 10036
5 JGI24735J21928_10000033 3300002067 Bacteria 70674
6 JGI25162J39368_1000016 3300002737 Bacteria 288734
7 JGI25162J39368_1002453 3300002737 Bacteria 7176
8 JGI25164J39214_1001487 3300002772 Bacteria 5339
9 JGI25165J46597_1001447 3300003214 Bacteria 12545
10 rootH1_10008126 3300003316 Bacteria 20133
11 rootH1_10024265 3300003316 Bacteria 8597
12 rootH2_10010159 3300003320 Bacteria 33853
13 rootH2_10025215 3300003320 Bacteria 11469
14 rootL2_10137200 3300003322 Bacteria 6428
15 rootL2_10183275 3300003322 Bacteria 4001
16 rootH1_10003399 3300003323 Bacteria 54122
17 rootH1_10068310 3300003316 Bacteria 1452
18 rootH1_10068310 3300003323 Bacteria 8470
19 Ga0055530_10001274 3300003791 Bacteria 19038
20 Ga0070658_10000008 3300005327 Bacteria 319912
21 Ga0070683_100141063 3300005329 Bacteria 2283
22 Ga0070680_100016876 3300005336 Bacteria 5748
23 Ga0070671_100039221 3300005355 Bacteria 3932
24 Ga0070674_100086481 3300005356 Bacteria 2252
25 Ga0070673_100002151 3300005364 Bacteria 11942
26 Ga0070659_100001709 3300005366 Bacteria 15786
27 Ga0070663_100034324 3300005455 Bacteria 3513
28 Ga0070678_100023841 3300005456 Bacteria 4086
29 Ga0070662_100000090 3300005457 Bacteria 49884
30 Ga0070681_10015313 3300005458 Bacteria 7629
31 Ga0068867_100009824 3300005459 Bacteria 6743
32 Ga0070679_100098021 3300005530 Bacteria 2919
33 Ga0068853_100033574 3300005539 Bacteria 4355
34 Ga0068853_100175864 3300005539 Bacteria 1939
35 Ga0070665_100000061 3300005548 Bacteria 222138
36 Ga0068855_100000130 3300005563 Bacteria 95659
37 Ga0068855_100000895 3300005563 Bacteria 36960
38 Ga0068855_100027047 3300005563 Bacteria 6863
39 Ga0068855_100029063 3300005563 Bacteria 6611
40 Ga0068855_100213530 3300005563 Bacteria 2167
41 Ga0068855_100559003 3300005563 Bacteria 1238
42 Ga0068857_100381727 3300005577 Bacteria 1308
43 Ga0068854_100013127 3300005578 Bacteria 5431
44 Ga0068856_100000385 3300005614 Bacteria 48447
45 Ga0068856_100100143 3300005614 Bacteria 2890
46 Ga0068856_100376169 3300005614 Bacteria 1439
47 Ga0068852_100002609 3300005616 Bacteria 12453
48 Ga0068852_100085564 3300005616 Bacteria 2809
49 Ga0075366_10000261 3300006195 Bacteria 23266
50 Ga0075366_10015325 3300006195 Bacteria 4390
51 Ga0097621_100000016 3300006237 Bacteria 91785
52 Ga0068871_100002222 3300006358 Bacteria 13185
53 Ga0068865_100047451 3300006881 Bacteria 2951
54 Ga0105240_10000082 3300009093 Bacteria 195184
55 Ga0105240_10019701 3300009093 Bacteria 9010
56 Ga0105240_10115538 3300009093 Bacteria 3240
57 Ga0105240_10183317 3300009093 Bacteria 2469
58 Ga0105240_10279786 3300009093 Bacteria 1917
59 Ga0105240_10651159 3300009093 Bacteria 1155
60 Ga0105245_10395244 3300009098 Bacteria 1380
61 Ga0105241_10002288 3300009174 Bacteria 14388
62 Ga0105241_10007786 3300009174 Bacteria 7877
63 Ga0105241_10253947 3300009174 Bacteria 1492
64 Ga0105237_10000310 3300009545 Bacteria 67887
65 Ga0105237_10002729 3300009545 Bacteria 21530
66 Ga0105237_10003308 3300009545 Bacteria 19208
67 Ga0105237_10003434 3300009545 Bacteria 18811
68 Ga0105237_10003503 3300009545 Bacteria 18627
69 Ga0105237_10020731 3300009545 Bacteria 6770
70 Ga0105237_10076903 3300009545 Bacteria 3328
71 Ga0105237_10079469 3300009545 Bacteria 3270
72 Ga0105237_10086407 3300009545 Bacteria 3126
73 Ga0105238_10005960 3300009551 Bacteria 12081
74 Ga0105239_10000009 3300010375 Bacteria 361182
75 Ga0105239_10000049 3300010375 Bacteria 177578
76 Ga0105239_10001336 3300010375 Bacteria 33227
77 Ga0105239_10001982 3300010375 Bacteria 26624
78 Ga0105239_10002604 3300010375 Bacteria 22834
79 Ga0105239_10032689 3300010375 Bacteria 5717
80 Ga0105239_10034116 3300010375 Bacteria 5587
81 Ga0105239_10041094 3300010375 Bacteria 5067
82 Ga0105239_10074408 3300010375 Bacteria 3735
83 Ga0105239_10547558 3300010375 Bacteria 1318
84 Ga0105246_10030545 3300011119 Bacteria 3560
85 Ga0157373_10000057 3300013100 Bacteria 99697
86 Ga0157373_10004893 3300013100 Bacteria 10082
87 Ga0157373_10018955 3300013100 Bacteria 5009
88 Ga0157373_10022660 3300013100 Bacteria 4556
89 Ga0157371_10000107 3300013102 Bacteria 126477
90 Ga0157371_10003959 3300013102 Bacteria 13144
91 Ga0157371_10005161 3300013102 Bacteria 11121
92 Ga0157371_10005219 3300013102 Bacteria 11043
93 Ga0157371_10010298 3300013102 Bacteria 7295
94 Ga0157371_10096713 3300013102 Bacteria 2093
95 Ga0157370_10004723 3300013104 Bacteria 15530
96 Ga0157370_10006417 3300013104 Bacteria 12974
97 Ga0157370_10008980 3300013104 Bacteria 10728
98 Ga0157370_10020883 3300013104 Bacteria 6533
99 Ga0157370_10035046 3300013104 Bacteria 4882
100 Ga0157370_10047204 3300013104 Bacteria 4128
101 Ga0157370_10061762 3300013104 Bacteria 3555
102 Ga0157370_10633068 3300013104 Bacteria 978
103 Ga0157369_10004189 3300013105 Bacteria 17086
104 Ga0157369_10103704 3300013105 Bacteria 3030
105 Ga0157369_10229921 3300013105 Bacteria 1939
106 Ga0157374_10002405 3300013296 Bacteria 15782
107 Ga0157378_10004071 3300013297 Bacteria 12914
108 Ga0163162_10000012 3300013306 Bacteria 292674
109 Ga0163162_10001113 3300013306 Bacteria 24963
110 Ga0157372_10000039 3300013307 Bacteria 165839
111 Ga0157372_10001628 3300013307 Bacteria 24362
112 Ga0157372_10002721 3300013307 Bacteria 19136
113 Ga0157372_10028617 3300013307 Bacteria 6084
114 Ga0182008_10000020 3300014497 Bacteria 228333
115 Ga0182008_10000053 3300014497 Bacteria 102934
116 Ga0182008_10030898 3300014497 Bacteria 2697
117 Ga0182006_1000270 3300015261 Bacteria 46578
118 Ga0182006_1003557 3300015261 Bacteria 7945
119 Ga0182006_1004281 3300015261 Bacteria 7062
120 Ga0182007_10006500 3300015262 Bacteria 5014
121 Ga0182007_10033585 3300015262 Unclassified 1737
122 Ga0182007_10070310 3300015262 Unclassified 1147
123 Ga0163161_10001764 3300017792 Bacteria 15793
124 Ga0163161_10002223 3300017792 Bacteria 13977
125 Ga0213872_10005042 3300021361 Bacteria 6853
126 Ga0209563_107195 3300025230 Bacteria 1847
127 Ga0207427_100122 3300025231 Bacteria 99064
128 Ga0209437_100048 3300025233 Bacteria 405107
129 Ga0209437_100119 3300025233 Bacteria 206549
130 Ga0209233_1000029 3300025261 Bacteria 641642
131 Ga0209233_1001171 3300025261 Bacteria 10589
132 Ga0209455_1011097 3300025272 Bacteria 2239
133 Ga0209676_1000022 3300025292 Bacteria 605659
134 Ga0209050_1000020 3300025298 Bacteria 605671
135 Ga0207647_10000018 3300025904 Bacteria 124816
136 Ga0207647_10000256 3300025904 Bacteria 43702
137 Ga0207647_10057295 3300025904 Bacteria 2389
138 Ga0207645_10000172 3300025907 Bacteria 51794
139 Ga0207705_10000026 3300025909 Bacteria 256051
140 Ga0207654_10001545 3300025911 Bacteria 12089
141 Ga0207654_10009630 3300025911 Bacteria 4912
142 Ga0207654_10152367 3300025911 Bacteria 1485
143 Ga0207707_10113335 3300025912 Bacteria 2370
144 Ga0207695_10000053 3300025913 Bacteria 396740
145 Ga0207695_10008492 3300025913 Bacteria 12841
146 Ga0207695_10014708 3300025913 Bacteria 9253
147 Ga0207695_10053168 3300025913 Bacteria 4237
148 Ga0207695_10096670 3300025913 Bacteria 2955
149 Ga0207671_10000366 3300025914 Bacteria 64454
150 Ga0207671_10000925 3300025914 Bacteria 36841
151 Ga0207671_10001165 3300025914 Bacteria 31349
152 Ga0207671_10001993 3300025914 Bacteria 22502
153 Ga0207671_10002661 3300025914 Bacteria 18743
154 Ga0207671_10024174 3300025914 Bacteria 4572
155 Ga0207671_10050184 3300025914 Bacteria 3090
156 Ga0207671_10054447 3300025914 Bacteria 2964
157 Ga0207671_10109835 3300025914 Bacteria 2097
158 Ga0207660_10012815 3300025917 Bacteria 5489
159 Ga0207657_10065270 3300025919 Bacteria 3104
160 Ga0207657_10117474 3300025919 Bacteria 2191
161 Ga0207652_10013929 3300025921 Bacteria 6510
162 Ga0207652_10087166 3300025921 Bacteria 2738
163 Ga0207644_10024160 3300025931 Bacteria 4170
164 Ga0207690_10030096 3300025932 Bacteria 3459
165 Ga0207690_10114193 3300025932 Bacteria 1950
166 Ga0207706_10000718 3300025933 Bacteria 34581
167 Ga0207704_10001706 3300025938 Bacteria 9825
168 Ga0207667_10000274 3300025949 Bacteria 71328
169 Ga0207667_10000394 3300025949 Bacteria 58926
170 Ga0207667_10013681 3300025949 Bacteria 9274
171 Ga0207667_10053760 3300025949 Bacteria 4236
172 Ga0207667_10235241 3300025949 Bacteria 1875
173 Ga0207677_10023555 3300026023 Bacteria 3807
174 Ga0207639_10025101 3300026041 Bacteria 4320
175 Ga0207639_10059773 3300026041 Bacteria 2938
176 Ga0207639_10080034 3300026041 Bacteria 2584
177 Ga0207678_10047800 3300026067 Bacteria 3699
178 Ga0207702_10000586 3300026078 Bacteria 40370
179 Ga0207702_10020425 3300026078 Bacteria 5486
180 Ga0207702_10156640 3300026078 Bacteria 2077
181 Ga0207648_10000658 3300026089 Bacteria 38677
182 Ga0207674_10132812 3300026116 Bacteria 2452
183 Ga0207683_10002693 3300026121 Bacteria 15527
184 Ga0268266_10000053 3300028379 Bacteria 295181
185 Ga0307517_10000198 3300028786 Bacteria 102181
186 Ga0307515_10001710 3300028794 Bacteria 48899
187 Ga0307515_10218574 3300028794 Unclassified 1730
188 Ga0265338_10061134 3300028800 Bacteria 3303
189 Ga0316177_1119485 3300030731 Bacteria 20673
190 Ga0316183_1025240 3300030742 Bacteria 70534
191 Ga0316181_1127411 3300030744 Bacteria 10048
192 Ga0316182_1213793 3300030745 Bacteria 1572
193 Ga0307509_10044847 3300031507 Bacteria 4774
194 Ga0307412_10000001 3300031911 Bacteria 822691
195 Ga0307414_10002147 3300032004 Bacteria 10297
196 Ga0307414_10057673 3300032004 Unclassified 2731
197 Ga0307507_10000309 3300033179 Bacteria 98028
198 Ga0307510_10000417 3300033180 Bacteria 40763
199 Ga0395899_0000024 3300037312 Bacteria 357402
200 Ga0395899_0002947 3300037312 Bacteria 13640
201 Ga0395899_0036029 3300037312 Bacteria 3713
202 Ga0395900_0000195 3300037418 Bacteria 97204
203 Ga0395900_0000275 3300037418 Bacteria 78207
204 Ga0395900_0063790 3300037418 Bacteria 3787
205 Ga0395900_0262340 3300037418 Bacteria 1725
206 Ga0395898_0036026 3300037466 Bacteria 4917
207 Ga0395898_0083030 3300037466 Bacteria 3088
208 Ga0395905_0005229 3300037471 Bacteria 13283
209 Ga0395905_0023064 3300037471 Bacteria 5883
210 Ga0395901_0000644 3300038443 Bacteria 40364
211 Ga0395901_0007512 3300038443 Bacteria 11008
212 Ga0395901_0028065 3300038443 Bacteria 5789
213 Ga0436361_0290112 3300039447 Bacteria 12409
214 Ga0466969_0060982 3300044656 Bacteria 1833
215 Ga0466959_0074163 3300045049 Bacteria 2461
216 Ga0466959_0290865 3300045049 Unclassified 1120
217 Ga0466958_0296838 3300045836 Bacteria 1037
218 Ga0495638_0288291 3300046460 Bacteria 889
219 Ga0495650_0001198 3300046471 Bacteria 27382
220 Ga0495650_0058068 3300046471 Bacteria 1564
221 Ga0495585_0000074 3300046492 Bacteria 102651
222 Ga0495585_0000241 3300046492 Bacteria 56727
223 Ga0495583_0035372 3300046506 Bacteria 2384
224 Ga0495606_0000425 3300046507 Bacteria 70202
225 Ga0495606_0009721 3300046507 Bacteria 8092
226 Ga0495606_0010375 3300046507 Bacteria 7741
227 Ga0495606_0023089 3300046507 Bacteria 4518
228 Ga0495610_0005131 3300046512 Bacteria 9404
229 Ga0495610_0106154 3300046512 Bacteria 1251
230 Ga0495616_0002470 3300046513 Bacteria 12255
231 Ga0495616_0023673 3300046513 Bacteria 3301
232 Ga0495631_0021300 3300046518 Bacteria 3019
233 Ga0495644_0049680 3300046523 Unclassified 1574
234 Ga0495648_0002824 3300046524 Bacteria 15618
235 Ga0495633_0000006 3300046558 Bacteria 326774
236 Ga0495633_0002853 3300046558 Bacteria 11870
237 Ga0495668_0000054 3300046616 Bacteria 203960
238 Ga0495625_0000067 3300046660 Bacteria 171483
239 Ga0495625_0000355 3300046660 Bacteria 69806
240 Ga0495625_0000548 3300046660 Bacteria 55064
241 Ga0495625_0004553 3300046660 Bacteria 13050
242 Ga0495625_0015165 3300046660 Bacteria 6116
243 Ga0495625_0144911 3300046660 Bacteria 1600
244 Ga0495661_0000946 3300046665 Bacteria 26340
245 Ga0495661_0006900 3300046665 Bacteria 7939
246 Ga0495649_0000135 3300046694 Bacteria 64533
247 Ga0495687_035445 3300047443 Bacteria 2244
248 Ga0495677_0072916 3300047445 Unclassified 1281
249 Ga0495686_0000533 3300047472 Bacteria 54324
250 Ga0495686_0002591 3300047472 Bacteria 16802
251 Ga0495686_0186022 3300047472 Bacteria 1200
252 Ga0496122_0000876 3300048925 Bacteria 56653
253 Ga0496123_0000777 3300048926 Bacteria 51679
254 Ga0496125_0158600 3300048928 Bacteria 1541
255 Ga0495678_003201 3300049459 Bacteria 10305
256 Ga0495682_0025753 3300049460 Bacteria 2188
257 Ga0501223_004610 3300049663 Unclassified 2936
258 nmdc:mga0k408_245_c1 3300050493 Bacteria 29347
259 nmdc:mga0k408_7448_c1 3300050493 Bacteria 5844
260 Ga0500635_0000479 3300053080 Bacteria 11303
261 Ga0500635_0006586 3300053080 Bacteria 3108
262 Ga0500651_0000058 3300053093 Bacteria 72493
263 Ga0500608_000674 3300053122 Bacteria 12492
264 Ga0500608_018720 3300053122 Bacteria 3165
265 Ga0500618_000018 3300053125 Bacteria 163272
266 Ga0500559_0081134 3300053136 Bacteria 1474
267 Ga0500622_0005326 3300053156 Bacteria 7755
268 Ga0500624_001084 3300053157 Bacteria 5180
269 Ga0500636_0037808 3300053177 Bacteria 2855

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2884933994 2884935720 271
2 3300046660 Ga0495625_0144911 Ga0495625_0144911_129_947 272
3 3300046460 Ga0495638_0288291 Ga0495638_0288291_45_872 275
4 3300005329 Ga0070683_100141063 Ga0070683_1001410633 290
5 3300005614 Ga0068856_100376169 Ga0068856_1003761692 290
6 3300013100 Ga0157373_10000057 Ga0157373_1000005778 290
7 3300013307 Ga0157372_10028617 Ga0157372_100286173 290
8 3300026078 Ga0207702_10156640 Ga0207702_101566402 290
9 3300032004 Ga0307414_10057673 Ga0307414_100576733 292
10 iso_pu_bacteria 2599185184 2599481844 295
11 iso_pu_bacteria 2738541283 2738756073 295
12 iso_pu_bacteria 2738541284 2738763302 295
13 iso_pu_bacteria 2739367656 2739615245 295
14 iso_pu_bacteria 2775506987 2776616091 295
15 iso_pu_bacteria 2842903701 2842904761 295
16 iso_pu_bacteria 2852623160 2852625755 295
17 iso_pu_bacteria 2902048731 2902050758 295
18 iso_pu_bacteria 2919437846 2919440514 295
19 iso_pu_bacteria 2928078545 2928083995 295
20 iso_pu_bacteria 2928147474 2928152920 295
21 iso_pu_bacteria 2932082852 2932086010 295
22 iso_pu_bacteria 2977232053 2977235670 295
23 2162886007 SwRhRL2b_contig_877448 SwRhRL2b_0275.00002230 299
24 3300001979 JGI24740J21852_10011059 JGI24740J21852_100110593 299
25 3300001979 JGI24740J21852_10040954 JGI24740J21852_100409542 299
26 3300001990 JGI24737J22298_10000997 JGI24737J22298_100009975 299
27 3300002067 JGI24735J21928_10000033 JGI24735J21928_1000003367 299
28 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016171 299
29 3300002737 JGI25162J39368_1002453 JGI25162J39368_10024534 299
30 3300002772 JGI25164J39214_1001487 JGI25164J39214_10014874 299
31 3300003214 JGI25165J46597_1001447 JGI25165J46597_10014474 299
32 3300003316 rootH1_10008126 rootH1_1000812615 299
33 3300003316 rootH1_10024265 rootH1_100242653 299
34 3300003320 rootH2_10010159 rootH2_1001015926 299
35 3300003320 rootH2_10025215 rootH2_100252154 299
36 3300003322 rootL2_10137200 rootL2_101372005 299
37 3300003322 rootL2_10183275 rootL2_101832753 299
38 3300003323 rootH1_10003399 rootH1_100033992 299
39 3300003323 rootH1_10068310 rootH1_100683107 299
40 3300003791 Ga0055530_10001274 Ga0055530_1000127415 299
41 3300005327 Ga0070658_10000008 Ga0070658_10000008236 299
42 3300005336 Ga0070680_100016876 Ga0070680_1000168762 299
43 3300005355 Ga0070671_100039221 Ga0070671_1000392212 299
44 3300005356 Ga0070674_100086481 Ga0070674_1000864812 299
45 3300005364 Ga0070673_100002151 Ga0070673_1000021511 299
46 3300005366 Ga0070659_100001709 Ga0070659_1000017095 299
47 3300005455 Ga0070663_100034324 Ga0070663_1000343243 299
48 3300005456 Ga0070678_100023841 Ga0070678_1000238412 299
49 3300005457 Ga0070662_100000090 Ga0070662_1000000906 299
50 3300005458 Ga0070681_10015313 Ga0070681_100153133 299
51 3300005459 Ga0068867_100009824 Ga0068867_1000098245 299
52 3300005530 Ga0070679_100098021 Ga0070679_1000980212 299
53 3300005539 Ga0068853_100033574 Ga0068853_1000335742 299
54 3300005539 Ga0068853_100175864 Ga0068853_1001758642 299
55 3300005548 Ga0070665_100000061 Ga0070665_100000061168 299
56 3300005563 Ga0068855_100000130 Ga0068855_1000001307 299
57 3300005563 Ga0068855_100000895 Ga0068855_10000089524 299
58 3300005563 Ga0068855_100027047 Ga0068855_1000270473 299
59 3300005563 Ga0068855_100029063 Ga0068855_1000290633 299
60 3300005563 Ga0068855_100213530 Ga0068855_1002135302 299
61 3300005563 Ga0068855_100559003 Ga0068855_1005590032 299
62 3300005577 Ga0068857_100381727 Ga0068857_1003817271 299
63 3300005578 Ga0068854_100013127 Ga0068854_1000131272 299
64 3300005614 Ga0068856_100000385 Ga0068856_10000038517 299
65 3300005614 Ga0068856_100100143 Ga0068856_1001001432 299
66 3300005616 Ga0068852_100002609 Ga0068852_1000026092 299
67 3300005616 Ga0068852_100085564 Ga0068852_1000855642 299
68 3300006195 Ga0075366_10000261 Ga0075366_1000026112 299
69 3300006195 Ga0075366_10015325 Ga0075366_100153253 299
70 3300006237 Ga0097621_100000016 Ga0097621_10000001682 299
71 3300006358 Ga0068871_100002222 Ga0068871_1000022227 299
72 3300006881 Ga0068865_100047451 Ga0068865_1000474512 299
73 3300009093 Ga0105240_10000082 Ga0105240_1000008246 299
74 3300009093 Ga0105240_10019701 Ga0105240_100197015 299
75 3300009093 Ga0105240_10115538 Ga0105240_101155383 299
76 3300009093 Ga0105240_10183317 Ga0105240_101833172 299
77 3300009093 Ga0105240_10279786 Ga0105240_102797862 299
78 3300009093 Ga0105240_10651159 Ga0105240_106511592 299
79 3300009098 Ga0105245_10395244 Ga0105245_103952442 299
80 3300009174 Ga0105241_10002288 Ga0105241_1000228810 299
81 3300009174 Ga0105241_10007786 Ga0105241_100077864 299
82 3300009174 Ga0105241_10253947 Ga0105241_102539472 299
83 3300009545 Ga0105237_10000310 Ga0105237_1000031035 299
84 3300009545 Ga0105237_10002729 Ga0105237_100027299 299
85 3300009545 Ga0105237_10003308 Ga0105237_1000330812 299
86 3300009545 Ga0105237_10003434 Ga0105237_100034347 299
87 3300009545 Ga0105237_10003503 Ga0105237_100035035 299
88 3300009545 Ga0105237_10020731 Ga0105237_100207315 299
89 3300009545 Ga0105237_10076903 Ga0105237_100769033 299
90 3300009545 Ga0105237_10079469 Ga0105237_100794692 299
91 3300009545 Ga0105237_10086407 Ga0105237_100864072 299
92 3300009551 Ga0105238_10005960 Ga0105238_100059603 299
93 3300010375 Ga0105239_10000009 Ga0105239_1000000993 299
94 3300010375 Ga0105239_10000049 Ga0105239_10000049120 299
95 3300010375 Ga0105239_10001336 Ga0105239_1000133624 299
96 3300010375 Ga0105239_10001982 Ga0105239_100019826 299
97 3300010375 Ga0105239_10002604 Ga0105239_1000260416 299
98 3300010375 Ga0105239_10032689 Ga0105239_100326894 299
99 3300010375 Ga0105239_10034116 Ga0105239_100341166 299
100 3300010375 Ga0105239_10041094 Ga0105239_100410941 299
101 3300010375 Ga0105239_10074408 Ga0105239_100744082 299
102 3300010375 Ga0105239_10547558 Ga0105239_105475582 299
103 3300011119 Ga0105246_10030545 Ga0105246_100305453 299
104 3300013100 Ga0157373_10004893 Ga0157373_100048933 299
105 3300013100 Ga0157373_10018955 Ga0157373_100189553 299
106 3300013100 Ga0157373_10022660 Ga0157373_100226602 299
107 3300013102 Ga0157371_10000107 Ga0157371_100001075 299
108 3300013102 Ga0157371_10003959 Ga0157371_100039599 299
109 3300013102 Ga0157371_10005161 Ga0157371_100051613 299
110 3300013102 Ga0157371_10005219 Ga0157371_100052195 299
111 3300013102 Ga0157371_10010298 Ga0157371_100102988 299
112 3300013102 Ga0157371_10096713 Ga0157371_100967132 299
113 3300013104 Ga0157370_10004723 Ga0157370_1000472311 299
114 3300013104 Ga0157370_10006417 Ga0157370_100064176 299
115 3300013104 Ga0157370_10008980 Ga0157370_100089808 299
116 3300013104 Ga0157370_10020883 Ga0157370_100208835 299
117 3300013104 Ga0157370_10035046 Ga0157370_100350463 299
118 3300013104 Ga0157370_10047204 Ga0157370_100472043 299
119 3300013104 Ga0157370_10061762 Ga0157370_100617624 299
120 3300013104 Ga0157370_10633068 Ga0157370_106330681 299
121 3300013105 Ga0157369_10004189 Ga0157369_1000418911 299
122 3300013105 Ga0157369_10103704 Ga0157369_101037042 299
123 3300013105 Ga0157369_10229921 Ga0157369_102299213 299
124 3300013296 Ga0157374_10002405 Ga0157374_100024056 299
125 3300013297 Ga0157378_10004071 Ga0157378_100040713 299
126 3300013306 Ga0163162_10000012 Ga0163162_10000012198 299
127 3300013306 Ga0163162_10001113 Ga0163162_1000111317 299
128 3300013307 Ga0157372_10000039 Ga0157372_1000003961 299
129 3300013307 Ga0157372_10001628 Ga0157372_100016288 299
130 3300013307 Ga0157372_10002721 Ga0157372_100027213 299
131 3300014497 Ga0182008_10000020 Ga0182008_10000020138 299
132 3300014497 Ga0182008_10000053 Ga0182008_1000005383 299
133 3300014497 Ga0182008_10030898 Ga0182008_100308982 299
134 3300015261 Ga0182006_1000270 Ga0182006_100027032 299
135 3300015261 Ga0182006_1003557 Ga0182006_10035575 299
136 3300015261 Ga0182006_1004281 Ga0182006_10042817 299
137 3300015262 Ga0182007_10006500 Ga0182007_100065003 299
138 3300015262 Ga0182007_10033585 Ga0182007_100335852 299
139 3300015262 Ga0182007_10070310 Ga0182007_100703101 299
140 3300017792 Ga0163161_10001764 Ga0163161_1000176412 299
141 3300017792 Ga0163161_10002223 Ga0163161_1000222312 299
142 3300021361 Ga0213872_10005042 Ga0213872_100050425 299
143 3300025230 Ga0209563_107195 Ga0209563_1071953 299
144 3300025231 Ga0207427_100122 Ga0207427_10012268 299
145 3300025233 Ga0209437_100048 Ga0209437_100048228 299
146 3300025233 Ga0209437_100119 Ga0209437_10011987 299
147 3300025261 Ga0209233_1000029 Ga0209233_1000029148 299
148 3300025261 Ga0209233_1001171 Ga0209233_10011713 299
149 3300025272 Ga0209455_1011097 Ga0209455_10110972 299
150 3300025292 Ga0209676_1000022 Ga0209676_100002268 299
151 3300025298 Ga0209050_1000020 Ga0209050_1000020472 299
152 3300025904 Ga0207647_10000018 Ga0207647_1000001862 299
153 3300025904 Ga0207647_10000256 Ga0207647_1000025639 299
154 3300025904 Ga0207647_10057295 Ga0207647_100572952 299
155 3300025907 Ga0207645_10000172 Ga0207645_1000017211 299
156 3300025909 Ga0207705_10000026 Ga0207705_10000026237 299
157 3300025911 Ga0207654_10001545 Ga0207654_100015453 299
158 3300025911 Ga0207654_10009630 Ga0207654_100096303 299
159 3300025911 Ga0207654_10152367 Ga0207654_101523672 299
160 3300025912 Ga0207707_10113335 Ga0207707_101133352 299
161 3300025913 Ga0207695_10000053 Ga0207695_10000053305 299
162 3300025913 Ga0207695_10008492 Ga0207695_100084925 299
163 3300025913 Ga0207695_10014708 Ga0207695_100147082 299
164 3300025913 Ga0207695_10053168 Ga0207695_100531686 299
165 3300025913 Ga0207695_10096670 Ga0207695_100966703 299
166 3300025914 Ga0207671_10000366 Ga0207671_1000036630 299
167 3300025914 Ga0207671_10000925 Ga0207671_1000092514 299
168 3300025914 Ga0207671_10001165 Ga0207671_1000116514 299
169 3300025914 Ga0207671_10001993 Ga0207671_1000199315 299
170 3300025914 Ga0207671_10002661 Ga0207671_100026618 299
171 3300025914 Ga0207671_10024174 Ga0207671_100241742 299
172 3300025914 Ga0207671_10050184 Ga0207671_100501842 299
173 3300025914 Ga0207671_10054447 Ga0207671_100544474 299
174 3300025914 Ga0207671_10109835 Ga0207671_101098352 299
175 3300025917 Ga0207660_10012815 Ga0207660_100128152 299
176 3300025919 Ga0207657_10065270 Ga0207657_100652702 299
177 3300025919 Ga0207657_10117474 Ga0207657_101174741 299
178 3300025921 Ga0207652_10013929 Ga0207652_100139293 299
179 3300025921 Ga0207652_10087166 Ga0207652_100871662 299
180 3300025931 Ga0207644_10024160 Ga0207644_100241602 299
181 3300025932 Ga0207690_10030096 Ga0207690_100300961 299
182 3300025932 Ga0207690_10114193 Ga0207690_101141932 299
183 3300025933 Ga0207706_10000718 Ga0207706_1000071810 299
184 3300025938 Ga0207704_10001706 Ga0207704_100017066 299
185 3300025949 Ga0207667_10000274 Ga0207667_1000027416 299
186 3300025949 Ga0207667_10000394 Ga0207667_1000039429 299
187 3300025949 Ga0207667_10013681 Ga0207667_100136817 299
188 3300025949 Ga0207667_10053760 Ga0207667_100537602 299
189 3300025949 Ga0207667_10235241 Ga0207667_102352412 299
190 3300026023 Ga0207677_10023555 Ga0207677_100235552 299
191 3300026041 Ga0207639_10025101 Ga0207639_100251013 299
192 3300026041 Ga0207639_10059773 Ga0207639_100597732 299
193 3300026041 Ga0207639_10080034 Ga0207639_100800343 299
194 3300026067 Ga0207678_10047800 Ga0207678_100478005 299
195 3300026078 Ga0207702_10000586 Ga0207702_1000058634 299
196 3300026078 Ga0207702_10020425 Ga0207702_100204254 299
197 3300026089 Ga0207648_10000658 Ga0207648_1000065813 299
198 3300026116 Ga0207674_10132812 Ga0207674_101328122 299
199 3300026121 Ga0207683_10002693 Ga0207683_100026933 299
200 3300028379 Ga0268266_10000053 Ga0268266_1000005336 299
201 3300028786 Ga0307517_10000198 Ga0307517_100001985 299
202 3300028794 Ga0307515_10001710 Ga0307515_1000171040 299
203 3300028794 Ga0307515_10218574 Ga0307515_102185741 299
204 3300028800 Ga0265338_10061134 Ga0265338_100611341 299
205 3300030731 Ga0316177_1119485 Ga0316177_11194855 299
206 3300030742 Ga0316183_1025240 Ga0316183_102524011 299
207 3300030744 Ga0316181_1127411 Ga0316181_11274114 299
208 3300030745 Ga0316182_1213793 Ga0316182_12137932 299
209 3300031507 Ga0307509_10044847 Ga0307509_100448473 299
210 3300031911 Ga0307412_10000001 Ga0307412_10000001258 299
211 3300032004 Ga0307414_10002147 Ga0307414_100021478 299
212 3300033179 Ga0307507_10000309 Ga0307507_1000030958 299
213 3300033180 Ga0307510_10000417 Ga0307510_1000041735 299
214 3300037312 Ga0395899_0000024 Ga0395899_0000024_354870_355781 299
215 3300037312 Ga0395899_0002947 Ga0395899_0002947_11685_12602 299
216 3300037312 Ga0395899_0036029 Ga0395899_0036029_114_1040 299
217 3300037418 Ga0395900_0000195 Ga0395900_0000195_24605_25522 299
218 3300037418 Ga0395900_0000275 Ga0395900_0000275_67716_68633 299
219 3300037418 Ga0395900_0063790 Ga0395900_0063790_1280_2206 299
220 3300037418 Ga0395900_0262340 Ga0395900_0262340_582_1493 299
221 3300037466 Ga0395898_0036026 Ga0395898_0036026_3721_4638 299
222 3300037466 Ga0395898_0083030 Ga0395898_0083030_810_1736 299
223 3300037471 Ga0395905_0005229 Ga0395905_0005229_4578_5504 299
224 3300037471 Ga0395905_0023064 Ga0395905_0023064_1121_2038 299
225 3300038443 Ga0395901_0000644 Ga0395901_0000644_34172_35089 299
226 3300038443 Ga0395901_0007512 Ga0395901_0007512_5522_6448 299
227 3300038443 Ga0395901_0028065 Ga0395901_0028065_2719_3639 299
228 3300039447 Ga0436361_0290112 Ga0436361_0290112_2510_3430 299
229 3300044656 Ga0466969_0060982 Ga0466969_0060982_400_1311 299
230 3300045049 Ga0466959_0074163 Ga0466959_0074163_1205_2116 299
231 3300045049 Ga0466959_0290865 Ga0466959_0290865_119_1036 299
232 3300045836 Ga0466958_0296838 Ga0466958_0296838_12_923 299
233 3300046471 Ga0495650_0001198 Ga0495650_0001198_14350_15252 299
234 3300046471 Ga0495650_0058068 Ga0495650_0058068_593_1492 299
235 3300046492 Ga0495585_0000074 Ga0495585_0000074_66150_67052 299
236 3300046492 Ga0495585_0000241 Ga0495585_0000241_37512_38411 299
237 3300046506 Ga0495583_0035372 Ga0495583_0035372_606_1508 299
238 3300046507 Ga0495606_0000425 Ga0495606_0000425_2388_3290 299
239 3300046507 Ga0495606_0009721 Ga0495606_0009721_5472_6371 299
240 3300046507 Ga0495606_0010375 Ga0495606_0010375_6542_7441 299
241 3300046507 Ga0495606_0023089 Ga0495606_0023089_25_924 299
242 3300046512 Ga0495610_0005131 Ga0495610_0005131_7206_8108 299
243 3300046512 Ga0495610_0106154 Ga0495610_0106154_13_912 299
244 3300046513 Ga0495616_0002470 Ga0495616_0002470_6152_7054 299
245 3300046513 Ga0495616_0023673 Ga0495616_0023673_269_1168 299
246 3300046518 Ga0495631_0021300 Ga0495631_0021300_1728_2645 299
247 3300046523 Ga0495644_0049680 Ga0495644_0049680_571_1488 299
248 3300046524 Ga0495648_0002824 Ga0495648_0002824_6362_7261 299
249 3300046558 Ga0495633_0000006 Ga0495633_0000006_15266_16165 299
250 3300046558 Ga0495633_0002853 Ga0495633_0002853_6008_6910 299
251 3300046616 Ga0495668_0000054 Ga0495668_0000054_184729_185658 299
252 3300046660 Ga0495625_0000067 Ga0495625_0000067_108354_109256 299
253 3300046660 Ga0495625_0000355 Ga0495625_0000355_18317_19216 299
254 3300046660 Ga0495625_0000548 Ga0495625_0000548_41314_42231 299
255 3300046660 Ga0495625_0004553 Ga0495625_0004553_5747_6646 299
256 3300046660 Ga0495625_0015165 Ga0495625_0015165_3730_4629 299
257 3300046665 Ga0495661_0000946 Ga0495661_0000946_8052_8963 299
258 3300046665 Ga0495661_0006900 Ga0495661_0006900_3743_4645 299
259 3300046694 Ga0495649_0000135 Ga0495649_0000135_62188_63090 299
260 3300047443 Ga0495687_035445 Ga0495687_035445_1267_2166 299
261 3300047445 Ga0495677_0072916 Ga0495677_0072916_317_1234 299
262 3300047472 Ga0495686_0000533 Ga0495686_0000533_51633_52550 299
263 3300047472 Ga0495686_0002591 Ga0495686_0002591_1359_2258 299
264 3300047472 Ga0495686_0186022 Ga0495686_0186022_31_948 299
265 3300048925 Ga0496122_0000876 Ga0496122_0000876_32526_33425 299
266 3300048926 Ga0496123_0000777 Ga0496123_0000777_42062_42961 299
267 3300048928 Ga0496125_0158600 Ga0496125_0158600_169_1068 299
268 3300049459 Ga0495678_003201 Ga0495678_003201_9297_10196 299
269 3300049460 Ga0495682_0025753 Ga0495682_0025753_399_1298 299
270 3300049663 Ga0501223_004610 Ga0501223_004610_511_1425 299
271 3300050493 nmdc:mga0k408_245_c1 nmdc:mga0k408_245_c1_11171_12088 299
272 3300050493 nmdc:mga0k408_7448_c1 nmdc:mga0k408_7448_c1_4169_5071 299
273 3300053080 Ga0500635_0000479 Ga0500635_0000479_1438_2355 299
274 3300053080 Ga0500635_0006586 Ga0500635_0006586_1544_2461 299
275 3300053093 Ga0500651_0000058 Ga0500651_0000058_68173_69072 299
276 3300053122 Ga0500608_000674 Ga0500608_000674_8346_9263 299
277 3300053122 Ga0500608_018720 Ga0500608_018720_69_968 299
278 3300053125 Ga0500618_000018 Ga0500618_000018_85451_86350 299
279 3300053136 Ga0500559_0081134 Ga0500559_0081134_485_1414 299
280 3300053156 Ga0500622_0005326 Ga0500622_0005326_217_1116 299
281 3300053157 Ga0500624_001084 Ga0500624_001084_2314_3213 299
282 3300053177 Ga0500636_0037808 Ga0500636_0037808_1293_2222 299

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z86-assembly2.cif.gz_C crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7327 4 130
2z86-assembly1.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7303 1 130
2z86-assembly2.cif.gz_D crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7284 3 130
2z87-assembly2.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.7166 3 131
2z87-assembly3.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.7082 1 130
ID Description Score Start End Superfamily
af_A0A1D6MR53_58_299_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7538 9 233 3.90.550.10
af_A0A368UI76_104_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7469 3 239 3.90.550.10
af_Q4D3G6_70_312_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7314 8 227 3.90.550.10
2z86A02 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7303 1 130 3.90.550.10
af_G5EBG7_70_294_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7254 3 250 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A520D6I9-F1-model_v4 Glycosyltransferase 0.998 1 235 GO:0016740
AF-A0A5J4QI32-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9948 4 132 GO:0000139
GO:0006486
GO:0008375
GO:0046872
AF-A0A520D6I9-F1-model_v4 Glycosyltransferase 0.9938 1 235 GO:0016740
AF-A0A4V1T1Z3-F1-model_v4 Sugar transferase 0.9922 1 162 GO:0016740
AF-A0A359AZQ9-F1-model_v4 Glycosyl transferase 0.99 3 174 GO:0016740

Feature Viewer

pLDDT pTM Quality
90.53 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map