F384588

General Info

Members Datasets Scaffolds Average Seq Length
281 165 562 177

Family's Representative Sequence

Representative Sequence 3300049661|Ga0501217_050568|Ga0501217_050568_331_945
Length 204
Sequence LPFLNGEHLPSIVALWKHLKQNTMAIQWKIDNSHSEILFKVKHLMISTVTGYFKNFNLEVETETKDFNTAKRFEFTADIDSIDTNNAQRDTHLRSADFFNAEAFNQLQFIGTKYEANEDGATLQGNLTIRDITKPVKLNVEFGGIVVDPYGQTKAGFTVNGKISRKEFGLTWNAVTEAGSVVVSDEIKIHAEVQLIKQAELVTA

Samples

Sample ID Description Type Environment
1 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
84 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
99 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
100 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
101 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
125 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
126 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
127 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
128 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
129 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
130 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
131 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
132 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
133 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
134 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
135 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
136 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
137 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
138 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
143 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
144 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
150 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
151 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
158 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
159 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
160 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
161 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
162 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
163 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
164 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
165 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 62.99
Metatranscriptomes 33.45
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0
Rhizoplane 0.36
Rhizosphere 90.39
Stem 0
Stem Tuber 0
Unclassified 9.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501217_050568 3300049661 Bacteria 1085
2 SwRhRL2b_contig_1887178 2162886007 Bacteria 121938
3 SwRhRL2b_contig_2681273 2162886007 Bacteria 1495
4 MRS1b_contig_1148322 2162886011 Bacteria 1493
5 JGI25158J39367_1006004 3300002739 Bacteria 1756
6 JGI25159J45721_1012327 3300002987 Bacteria 2045
7 JGI25406J46586_10192495 3300003203 Unclassified 595
8 JGI25153J46596_10012513 3300003215 Bacteria 3654
9 rootH2_10040804 3300003320 Bacteria 4128
10 rootH2_10092964 3300003320 Bacteria 8258
11 rootL2_10220970 3300003322 Bacteria 1307
12 rootH1_10012550 3300003323 Bacteria 13592
13 rootH1_10027440 3300003323 Bacteria 16533
14 JGI25160J50197_1008995 3300003354 Bacteria 3747
15 Ga0065165_1023209 3300005262 Bacteria 2108
16 Ga0065704_10070136 3300005289 Bacteria 560402
17 Ga0065712_10076407 3300005290 Bacteria 3666
18 Ga0065712_10485037 3300005290 Bacteria 647
19 Ga0070670_100048430 3300005331 Bacteria 3657
20 Ga0070677_10387001 3300005333 Bacteria 734
21 Ga0070687_100466315 3300005343 Bacteria 843
22 Ga0070668_100090519 3300005347 Bacteria 2410
23 Ga0070675_100106859 3300005354 Bacteria 2363
24 Ga0070675_100219681 3300005354 Bacteria 1655
25 Ga0070673_100198206 3300005364 Bacteria 1728
26 Ga0070663_100880246 3300005455 Bacteria 772
27 Ga0070678_100959132 3300005456 Unclassified 784
28 Ga0070698_100113704 3300005471 Bacteria 2672
29 Ga0068853_100121541 3300005539 Bacteria 2330
30 Ga0068853_100650712 3300005539 Bacteria 1003
31 Ga0070672_100118401 3300005543 Bacteria 2166
32 Ga0070672_100228460 3300005543 Bacteria 1563
33 Ga0068855_100007523 3300005563 Bacteria 13184
34 Ga0068857_100055628 3300005577 Bacteria 3511
35 Ga0068857_100081345 3300005577 Bacteria 2893
36 Ga0068856_101524441 3300005614 Bacteria 682
37 Ga0068861_100007481 3300005719 Bacteria 7487
38 Ga0081539_10001000 3300005985 Bacteria 52492
39 Ga0070712_100142468 3300006175 Bacteria 1831
40 Ga0075431_100029944 3300006847 Bacteria 5605
41 Ga0075429_100017748 3300006880 Bacteria 6154
42 Ga0105240_10022092 3300009093 Bacteria 8444
43 Ga0111539_10027742 3300009094 Bacteria 6917
44 Ga0111539_10054106 3300009094 Bacteria 4776
45 Ga0114129_10073386 3300009147 Bacteria 4767
46 Ga0105241_10060962 3300009174 Bacteria 2904
47 Ga0105242_10963392 3300009176 Bacteria 858
48 Ga0105237_10044913 3300009545 Bacteria 4448
49 Ga0105239_10001735 3300010375 Bacteria 28734
50 Ga0157373_10013523 3300013100 Bacteria 5985
51 Ga0157373_10029426 3300013100 Bacteria 3956
52 Ga0157371_10001101 3300013102 Bacteria 29303
53 Ga0157371_10002549 3300013102 Bacteria 17292
54 Ga0157371_10005044 3300013102 Bacteria 11291
55 Ga0157371_10441505 3300013102 Bacteria 956
56 Ga0157371_10462904 3300013102 Bacteria 933
57 Ga0157369_10424916 3300013105 Bacteria 1378
58 Ga0157372_10001579 3300013307 Bacteria 24848
59 Ga0157372_10003673 3300013307 Bacteria 16500
60 Ga0157372_10051053 3300013307 Bacteria 4601
61 Ga0157372_10092317 3300013307 Bacteria 3444
62 Ga0157372_10126379 3300013307 Bacteria 2940
63 Ga0157372_10317786 3300013307 Bacteria 1813
64 Ga0157372_10386338 3300013307 Bacteria 1631
65 Ga0157372_10494733 3300013307 Bacteria 1426
66 Ga0157372_10701932 3300013307 Bacteria 1177
67 Ga0157375_12317507 3300013308 Bacteria 640
68 Ga0157380_10000383 3300014326 Bacteria 26712
69 Ga0157380_10014544 3300014326 Bacteria 5759
70 Ga0163161_10002083 3300017792 Bacteria 14500
71 Ga0209436_102280 3300025208 Bacteria 5908
72 Ga0209130_1002000 3300025284 Bacteria 11129
73 Ga0209758_1014138 3300025297 Bacteria 4275
74 Ga0207426_1000263 3300025302 Bacteria 110923
75 Ga0207426_1000513 3300025302 Bacteria 56488
76 Ga0207684_10720191 3300025910 Bacteria 847
77 Ga0207695_10466602 3300025913 Bacteria 1145
78 Ga0207681_10507915 3300025923 Unclassified 988
79 Ga0207650_10046468 3300025925 Bacteria 3197
80 Ga0207659_10039908 3300025926 Bacteria 3278
81 Ga0207686_10512184 3300025934 Bacteria 933
82 Ga0207691_10058041 3300025940 Bacteria 3521
83 Ga0207651_10325159 3300025960 Bacteria 1287
84 Ga0207640_10783058 3300025981 Bacteria 825
85 Ga0207640_10982737 3300025981 Bacteria 742
86 Ga0207639_10500210 3300026041 Bacteria 1110
87 Ga0207678_10774107 3300026067 Bacteria 847
88 Ga0207702_10462759 3300026078 Bacteria 1232
89 Ga0207648_10300934 3300026089 Bacteria 1438
90 Ga0207674_10020503 3300026116 Bacteria 7141
91 Ga0207674_10056149 3300026116 Bacteria 4000
92 Ga0207675_100013096 3300026118 Bacteria 7739
93 Ga0307408_100000220 3300031548 Bacteria 61009
94 Ga0307408_100144430 3300031548 Bacteria 1871
95 Ga0307405_10023494 3300031731 Bacteria 3505
96 Ga0307405_10116156 3300031731 Bacteria 1822
97 Ga0307405_10384111 3300031731 Bacteria 1094
98 Ga0307413_10012532 3300031824 Bacteria 4224
99 Ga0307413_10040438 3300031824 Bacteria 2721
100 Ga0307413_10671899 3300031824 Unclassified 857
101 Ga0307410_10048083 3300031852 Bacteria 2855
102 Ga0307410_10377947 3300031852 Bacteria 1139
103 Ga0307406_10055449 3300031901 Bacteria 2534
104 Ga0307407_10030826 3300031903 Bacteria 2898
105 Ga0307412_10010346 3300031911 Bacteria 5371
106 Ga0307412_10314439 3300031911 Bacteria 1243
107 Ga0307409_100072065 3300031995 Bacteria 2750
108 Ga0307409_100073658 3300031995 Bacteria 2725
109 Ga0307416_100000406 3300032002 Bacteria 22136
110 Ga0307416_100001501 3300032002 Bacteria 12707
111 Ga0307416_100019284 3300032002 Bacteria 4831
112 Ga0307416_100191197 3300032002 Bacteria 1931
113 Ga0307416_100422483 3300032002 Bacteria 1378
114 Ga0307416_101645359 3300032002 Bacteria 747
115 Ga0307414_10218930 3300032004 Bacteria 1562
116 Ga0307414_10636421 3300032004 Bacteria 960
117 Ga0307415_100002312 3300032126 Bacteria 9458
118 Ga0307415_100135196 3300032126 Bacteria 1874
119 Ga0307415_100728763 3300032126 Bacteria 898
120 Ga0395898_0474072 3300037466 Bacteria 1191
121 Ga0395898_0826636 3300037466 Bacteria 866
122 Ga0395905_0009452 3300037471 Bacteria 9526
123 Ga0395905_0059365 3300037471 Unclassified 3576
124 Ga0395901_0818343 3300038443 Bacteria 919
125 Ga0439439_0000869 3300041406 Bacteria 5563
126 Ga0439449_0094359 3300042007 Bacteria 1105
127 Ga0439449_0140169 3300042007 Bacteria 900
128 Ga0439457_002577 3300042014 Bacteria 5133
129 Ga0439462_0028416 3300042015 Bacteria 1479
130 Ga0466959_0068772 3300045049 Bacteria 2566
131 Ga0466967_0514355 3300045976 Bacteria 1176
132 Ga0495606_0057994 3300046507 Bacteria 2491
133 Ga0495609_0081361 3300046538 Bacteria 1416
134 Ga0495668_0005139 3300046616 Bacteria 8995
135 Ga0496115_0055026 3300048918 Bacteria 3196
136 Ga0501306_002896 3300049127 Bacteria 1804
137 Ga0501306_005421 3300049127 Bacteria 1462
138 Ga0501306_005968 3300049127 Bacteria 1414
139 Ga0501306_014593 3300049127 Bacteria 1038
140 Ga0501306_019480 3300049127 Bacteria 936
141 Ga0501306_025799 3300049127 Bacteria 848
142 Ga0501306_029490 3300049127 Unclassified 809
143 Ga0501306_044883 3300049127 Bacteria 695
144 Ga0501306_045190 3300049127 Unclassified 693
145 Ga0501306_066653 3300049127 Bacteria 601
146 Ga0501308_007210 3300049128 Bacteria 1159
147 Ga0501308_012858 3300049128 Bacteria 961
148 Ga0501308_059206 3300049128 Bacteria 575
149 Ga0501308_067098 3300049128 Bacteria 551
150 Ga0501309_006224 3300049129 Bacteria 1449
151 Ga0501309_015641 3300049129 Bacteria 1028
152 Ga0501309_043969 3300049129 Bacteria 688
153 Ga0501309_061938 3300049129 Bacteria 603
154 Ga0501310_005416 3300049130 Bacteria 1309
155 Ga0501310_020736 3300049130 Bacteria 818
156 Ga0501310_026723 3300049130 Bacteria 749
157 Ga0501310_043019 3300049130 Bacteria 634
158 Ga0501310_047066 3300049130 Bacteria 615
159 Ga0501304_014234 3300049160 Bacteria 735
160 Ga0501304_016271 3300049160 Bacteria 703
161 Ga0501304_027345 3300049160 Unclassified 592
162 Ga0501304_038945 3300049160 Unclassified 526
163 Ga0501305_010420 3300049161 Bacteria 1241
164 Ga0501305_029684 3300049161 Bacteria 847
165 Ga0501305_046082 3300049161 Bacteria 721
166 Ga0501305_055588 3300049161 Bacteria 672
167 Ga0501305_064463 3300049161 Bacteria 635
168 Ga0501305_066691 3300049161 Bacteria 627
169 Ga0501307_003973 3300049162 Bacteria 1483
170 Ga0501307_006275 3300049162 Bacteria 1279
171 Ga0501307_015775 3300049162 Bacteria 936
172 Ga0501307_035859 3300049162 Unclassified 705
173 Ga0501307_048053 3300049162 Bacteria 635
174 Ga0501307_075897 3300049162 Bacteria 542
175 Ga0501297_006639 3300049520 Unclassified 1240
176 Ga0501298_000639 3300049521 Bacteria 4823
177 Ga0501300_062888 3300049523 Bacteria 590
178 Ga0501311_043088 3300049527 Bacteria 689
179 Ga0501312_000913 3300049528 Bacteria 2677
180 Ga0501312_005703 3300049528 Bacteria 1525
181 Ga0501312_008324 3300049528 Bacteria 1345
182 Ga0501312_025597 3300049528 Unclassified 900
183 Ga0501312_039663 3300049528 Bacteria 766
184 Ga0501312_054044 3300049528 Unclassified 683
185 Ga0501312_057348 3300049528 Bacteria 668
186 Ga0501313_011343 3300049529 Bacteria 1027
187 Ga0501313_023613 3300049529 Unclassified 771
188 Ga0501313_042032 3300049529 Bacteria 616
189 Ga0501314_013585 3300049530 Bacteria 790
190 Ga0501314_030793 3300049530 Bacteria 596
191 Ga0501315_005448 3300049531 Bacteria 1378
192 Ga0501315_006406 3300049531 Bacteria 1308
193 Ga0501315_008312 3300049531 Bacteria 1204
194 Ga0501315_009058 3300049531 Bacteria 1170
195 Ga0501315_015129 3300049531 Unclassified 985
196 Ga0501315_033975 3300049531 Bacteria 747
197 Ga0501315_042731 3300049531 Bacteria 691
198 Ga0501315_044617 3300049531 Bacteria 681
199 Ga0501315_046933 3300049531 Bacteria 669
200 Ga0501316_003880 3300049532 Bacteria 1477
201 Ga0501316_006845 3300049532 Unclassified 1224
202 Ga0501316_007909 3300049532 Bacteria 1164
203 Ga0501316_038139 3300049532 Bacteria 663
204 Ga0501316_054602 3300049532 Bacteria 581
205 Ga0501317_013800 3300049533 Unclassified 1015
206 Ga0501319_020257 3300049535 Bacteria 592
207 Ga0501320_001637 3300049536 Bacteria 1682
208 Ga0501320_003157 3300049536 Unclassified 1378
209 Ga0501320_048545 3300049536 Bacteria 573
210 Ga0501321_033193 3300049537 Unclassified 699
211 Ga0501322_000555 3300049538 Bacteria 1805
212 Ga0501322_007853 3300049538 Bacteria 784
213 Ga0501322_013192 3300049538 Bacteria 664
214 Ga0501322_018826 3300049538 Bacteria 594
215 Ga0501325_019818 3300049541 Bacteria 700
216 Ga0501325_023210 3300049541 Bacteria 668
217 Ga0501325_026919 3300049541 Bacteria 639
218 Ga0501327_02414 3300049543 Bacteria 970
219 Ga0501333_011618 3300049549 Bacteria 638
220 Ga0501334_06968 3300049550 Bacteria 772
221 Ga0501335_004270 3300049551 Bacteria 1243
222 Ga0501335_006794 3300049551 Bacteria 1048
223 Ga0501335_015338 3300049551 Bacteria 781
224 Ga0501335_030228 3300049551 Bacteria 610
225 Ga0501335_030952 3300049551 Bacteria 604
226 Ga0501336_014410 3300049552 Bacteria 669
227 Ga0501337_019758 3300049553 Bacteria 543
228 Ga0501338_05651 3300049554 Bacteria 778
229 Ga0501340_004639 3300049556 Bacteria 872
230 Ga0501040_0018554 3300049576 Bacteria 4620
231 Ga0501043_0003923 3300049579 Bacteria 12202
232 Ga0501047_0158170 3300049581 Bacteria 2138
233 Ga0501198_022823 3300049649 Bacteria 1005
234 Ga0501201_006158 3300049651 Unclassified 1132
235 Ga0501201_006456 3300049651 Bacteria 1111
236 Ga0501202_001781 3300049652 Bacteria 3523
237 Ga0501202_026296 3300049652 Unclassified 1190
238 Ga0501207_000182 3300049654 Bacteria 6070
239 Ga0501216_092203 3300049660 Unclassified 656
240 Ga0501217_018036 3300049661 Bacteria 1634
241 Ga0501223_007071 3300049663 Bacteria 2306
242 Ga0501223_016802 3300049663 Bacteria 1446
243 Ga0501224_015702 3300049664 Bacteria 1122
244 Ga0501233_192832 3300049668 Bacteria 589
245 Ga0501235_007618 3300049669 Bacteria 2359
246 Ga0501240_034309 3300049673 Unclassified 823
247 Ga0501242_044025 3300049674 Bacteria 639
248 Ga0501243_000836 3300049675 Bacteria 4290
249 Ga0501257_106604 3300049686 Unclassified 739
250 Ga0501259_002753 3300049688 Bacteria 2822
251 Ga0501261_008502 3300049690 Bacteria 1326
252 Ga0501225_0005975 3300049705 Bacteria 3559
253 Ga0501234_002575 3300049707 Bacteria 2857
254 Ga0501083_0555554 3300049744 Bacteria 747
255 Ga0501268_031630 3300049765 Bacteria 960
256 Ga0501268_071770 3300049765 Unclassified 702
257 Ga0501270_028347 3300049767 Bacteria 907
258 Ga0501212_040965 3300049851 Bacteria 766
259 nmdc:mga05p37_146501_c1 3300050507 Bacteria 2891
260 nmdc:mga09592_104436_c1 3300050508 Bacteria 2428
261 nmdc:mga09592_271966_c1 3300050508 Bacteria 1469
262 nmdc:mga06r32_78367_c1 3300050510 Bacteria 3212
263 nmdc:mga08y16_138487_c1 3300050511 Bacteria 2530
264 Ga0500578_0000190 3300053086 Bacteria 74445
265 Ga0500592_024672 3300053116 Bacteria 969
266 Ga0500604_0003487 3300053151 Bacteria 4239
267 Ga0500622_0224694 3300053156 Bacteria 839
268 Ga0587077_049995 3300059493 Bacteria 871
269 Ga0587090_025329 3300059510 Unclassified 957
270 Ga0587076_019701 3300059645 Bacteria 1100
271 Ga0466962_0183301 3300061719 Bacteria 1021
272 2740034542 2739367866 Bacteria 4215900
273 2819677282 2818991460 Bacteria 7595395
274 2839991045 2839989709 Bacteria 3773432
275 2839992561 2839989709 Bacteria 3773432
276 2884797149 2884791551 Bacteria 8511252
277 2910245892 2910245624 Bacteria 6935613
278 2929177310 2929177148 Bacteria 7883697
279 2945979676 2945977869 Bacteria 7777518
280 2946014457 2946013367 Bacteria 7766675
281 8003157561 8003151029 Bacteria 8187759
282 Ga0501217_050568
283 SwRhRL2b_contig_1887178
284 SwRhRL2b_contig_2681273
285 MRS1b_contig_1148322
286 JGI25158J39367_1006004
287 JGI25159J45721_1012327
288 JGI25406J46586_10192495
289 JGI25153J46596_10012513
290 rootH2_10040804
291 rootH2_10092964
292 rootL2_10220970
293 rootH1_10012550
294 rootH1_10027440
295 JGI25160J50197_1008995
296 Ga0065165_1023209
297 Ga0065704_10070136
298 Ga0065712_10076407
299 Ga0065712_10485037
300 Ga0070670_100048430
301 Ga0070677_10387001
302 Ga0070687_100466315
303 Ga0070668_100090519
304 Ga0070675_100106859
305 Ga0070675_100219681
306 Ga0070673_100198206
307 Ga0070663_100880246
308 Ga0070678_100959132
309 Ga0070698_100113704
310 Ga0068853_100121541
311 Ga0068853_100650712
312 Ga0070672_100118401
313 Ga0070672_100228460
314 Ga0068855_100007523
315 Ga0068857_100055628
316 Ga0068857_100081345
317 Ga0068856_101524441
318 Ga0068861_100007481
319 Ga0081539_10001000
320 Ga0070712_100142468
321 Ga0075431_100029944
322 Ga0075429_100017748
323 Ga0105240_10022092
324 Ga0111539_10027742
325 Ga0111539_10054106
326 Ga0114129_10073386
327 Ga0105241_10060962
328 Ga0105242_10963392
329 Ga0105237_10044913
330 Ga0105239_10001735
331 Ga0157373_10013523
332 Ga0157373_10029426
333 Ga0157371_10001101
334 Ga0157371_10002549
335 Ga0157371_10005044
336 Ga0157371_10441505
337 Ga0157371_10462904
338 Ga0157369_10424916
339 Ga0157372_10001579
340 Ga0157372_10003673
341 Ga0157372_10051053
342 Ga0157372_10092317
343 Ga0157372_10126379
344 Ga0157372_10317786
345 Ga0157372_10386338
346 Ga0157372_10494733
347 Ga0157372_10701932
348 Ga0157375_12317507
349 Ga0157380_10000383
350 Ga0157380_10014544
351 Ga0163161_10002083
352 Ga0209436_102280
353 Ga0209130_1002000
354 Ga0209758_1014138
355 Ga0207426_1000263
356 Ga0207426_1000513
357 Ga0207684_10720191
358 Ga0207695_10466602
359 Ga0207681_10507915
360 Ga0207650_10046468
361 Ga0207659_10039908
362 Ga0207686_10512184
363 Ga0207691_10058041
364 Ga0207651_10325159
365 Ga0207640_10783058
366 Ga0207640_10982737
367 Ga0207639_10500210
368 Ga0207678_10774107
369 Ga0207702_10462759
370 Ga0207648_10300934
371 Ga0207674_10020503
372 Ga0207674_10056149
373 Ga0207675_100013096
374 Ga0307408_100000220
375 Ga0307408_100144430
376 Ga0307405_10023494
377 Ga0307405_10116156
378 Ga0307405_10384111
379 Ga0307413_10012532
380 Ga0307413_10040438
381 Ga0307413_10671899
382 Ga0307410_10048083
383 Ga0307410_10377947
384 Ga0307406_10055449
385 Ga0307407_10030826
386 Ga0307412_10010346
387 Ga0307412_10314439
388 Ga0307409_100072065
389 Ga0307409_100073658
390 Ga0307416_100000406
391 Ga0307416_100001501
392 Ga0307416_100019284
393 Ga0307416_100191197
394 Ga0307416_100422483
395 Ga0307416_101645359
396 Ga0307414_10218930
397 Ga0307414_10636421
398 Ga0307415_100002312
399 Ga0307415_100135196
400 Ga0307415_100728763
401 Ga0395898_0474072
402 Ga0395898_0826636
403 Ga0395905_0009452
404 Ga0395905_0059365
405 Ga0395901_0818343
406 Ga0439439_0000869
407 Ga0439449_0094359
408 Ga0439449_0140169
409 Ga0439457_002577
410 Ga0439462_0028416
411 Ga0466959_0068772
412 Ga0466967_0514355
413 Ga0495606_0057994
414 Ga0495609_0081361
415 Ga0495668_0005139
416 Ga0496115_0055026
417 Ga0501306_002896
418 Ga0501306_005421
419 Ga0501306_005968
420 Ga0501306_014593
421 Ga0501306_019480
422 Ga0501306_025799
423 Ga0501306_029490
424 Ga0501306_044883
425 Ga0501306_045190
426 Ga0501306_066653
427 Ga0501308_007210
428 Ga0501308_012858
429 Ga0501308_059206
430 Ga0501308_067098
431 Ga0501309_006224
432 Ga0501309_015641
433 Ga0501309_043969
434 Ga0501309_061938
435 Ga0501310_005416
436 Ga0501310_020736
437 Ga0501310_026723
438 Ga0501310_043019
439 Ga0501310_047066
440 Ga0501304_014234
441 Ga0501304_016271
442 Ga0501304_027345
443 Ga0501304_038945
444 Ga0501305_010420
445 Ga0501305_029684
446 Ga0501305_046082
447 Ga0501305_055588
448 Ga0501305_064463
449 Ga0501305_066691
450 Ga0501307_003973
451 Ga0501307_006275
452 Ga0501307_015775
453 Ga0501307_035859
454 Ga0501307_048053
455 Ga0501307_075897
456 Ga0501297_006639
457 Ga0501298_000639
458 Ga0501300_062888
459 Ga0501311_043088
460 Ga0501312_000913
461 Ga0501312_005703
462 Ga0501312_008324
463 Ga0501312_025597
464 Ga0501312_039663
465 Ga0501312_054044
466 Ga0501312_057348
467 Ga0501313_011343
468 Ga0501313_023613
469 Ga0501313_042032
470 Ga0501314_013585
471 Ga0501314_030793
472 Ga0501315_005448
473 Ga0501315_006406
474 Ga0501315_008312
475 Ga0501315_009058
476 Ga0501315_015129
477 Ga0501315_033975
478 Ga0501315_042731
479 Ga0501315_044617
480 Ga0501315_046933
481 Ga0501316_003880
482 Ga0501316_006845
483 Ga0501316_007909
484 Ga0501316_038139
485 Ga0501316_054602
486 Ga0501317_013800
487 Ga0501319_020257
488 Ga0501320_001637
489 Ga0501320_003157
490 Ga0501320_048545
491 Ga0501321_033193
492 Ga0501322_000555
493 Ga0501322_007853
494 Ga0501322_013192
495 Ga0501322_018826
496 Ga0501325_019818
497 Ga0501325_023210
498 Ga0501325_026919
499 Ga0501327_02414
500 Ga0501333_011618
501 Ga0501334_06968
502 Ga0501335_004270
503 Ga0501335_006794
504 Ga0501335_015338
505 Ga0501335_030228
506 Ga0501335_030952
507 Ga0501336_014410
508 Ga0501337_019758
509 Ga0501338_05651
510 Ga0501340_004639
511 Ga0501040_0018554
512 Ga0501043_0003923
513 Ga0501047_0158170
514 Ga0501198_022823
515 Ga0501201_006158
516 Ga0501201_006456
517 Ga0501202_001781
518 Ga0501202_026296
519 Ga0501207_000182
520 Ga0501216_092203
521 Ga0501217_018036
522 Ga0501223_007071
523 Ga0501223_016802
524 Ga0501224_015702
525 Ga0501233_192832
526 Ga0501235_007618
527 Ga0501240_034309
528 Ga0501242_044025
529 Ga0501243_000836
530 Ga0501257_106604
531 Ga0501259_002753
532 Ga0501261_008502
533 Ga0501225_0005975
534 Ga0501234_002575
535 Ga0501083_0555554
536 Ga0501268_031630
537 Ga0501268_071770
538 Ga0501270_028347
539 Ga0501212_040965
540 nmdc:mga05p37_146501_c1
541 nmdc:mga09592_104436_c1
542 nmdc:mga09592_271966_c1
543 nmdc:mga06r32_78367_c1
544 nmdc:mga08y16_138487_c1
545 Ga0500578_0000190
546 Ga0500592_024672
547 Ga0500604_0003487
548 Ga0500622_0224694
549 Ga0587077_049995
550 Ga0587090_025329
551 Ga0587076_019701
552 Ga0466962_0183301
553 2740034542
554 2819677282
555 2839991045
556 2839992561
557 2884797149
558 2910245892
559 2929177310
560 2945979676
561 2946014457
562 8003157561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

28

195

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9146 5 177
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9129 5 176
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9042 5 177
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9024 5 176
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9008 8 172
ID Description Score Start End Superfamily
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9439 8 172 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9192 5 177 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9163 8 172 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9088 5 177 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8951 24 177 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A1C2GMP5-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9963 2 176
AF-J0VA48-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9919 1 147
AF-A0A1C2GMP5-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9907 2 176
AF-A0A1H7A9D2-F1-model_v4 Polyisoprenoid-binding protein YceI 0.9891 2 177
AF-A0A088F423-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9886 1 177

Map