F384586

General Info

Members Datasets Scaffolds Average Seq Length
281 197 562 108

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0125296|Ga0501077_0125296_917_1246
Length 109
Sequence MLHELRIYRCLPGRLPALNKRFETITLKLWEKHGIRQVAFWTVEIGGSSNTELYYLLEWENLAEREQRWNAFQSDPEWIAKRAETEKDGPILREIANLILKPTSYSKLR

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
87 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 0
Rhizoplane 0
Rhizosphere 82.56
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0125296 3300049593 Bacteria 1628
2 JGI24740J21852_10007389 3300001979 Bacteria 4470
3 JGI24739J22299_10023465 3300001989 Unclassified 2181
4 JGI24739J22299_10178351 3300001989 Bacteria 625
5 JGI24735J21928_10022222 3300002067 Bacteria 1933
6 JGI24738J21930_10006014 3300002075 Bacteria 2877
7 JGI25151J46595_10000474 3300003187 Bacteria 38089
8 JGI25153J46596_10040089 3300003215 Bacteria 1456
9 rootL2_10240124 3300003322 Unclassified 1037
10 rootH1_10244251 3300003323 Bacteria 1056
11 Ga0070658_10022923 3300005327 Bacteria 5012
12 Ga0070658_10060852 3300005327 Bacteria 3076
13 Ga0070676_10100708 3300005328 Bacteria 1784
14 Ga0070690_100000486 3300005330 Bacteria 19952
15 Ga0068869_100002903 3300005334 Bacteria 10409
16 Ga0070680_100055708 3300005336 Bacteria 3231
17 Ga0070680_100206749 3300005336 Bacteria 1656
18 Ga0070682_100029880 3300005337 Bacteria 3285
19 Ga0070682_100698746 3300005337 Unclassified 813
20 Ga0068868_100309179 3300005338 Bacteria 1344
21 Ga0070660_100106851 3300005339 Unclassified 2223
22 Ga0070660_100417961 3300005339 Bacteria 1110
23 Ga0070689_100026759 3300005340 Bacteria 4344
24 Ga0070691_10014865 3300005341 Bacteria 3574
25 Ga0070661_100172820 3300005344 Bacteria 1641
26 Ga0070661_100733553 3300005344 Bacteria 807
27 Ga0070692_10021021 3300005345 Bacteria 3172
28 Ga0070692_10051305 3300005345 Bacteria 2145
29 Ga0070674_101825404 3300005356 Unclassified 551
30 Ga0070673_102409340 3300005364 Unclassified 500
31 Ga0070688_100024186 3300005365 Bacteria 3580
32 Ga0070659_100036271 3300005366 Bacteria 3843
33 Ga0070659_101797155 3300005366 Bacteria 549
34 Ga0070709_10138967 3300005434 Bacteria 1667
35 Ga0070714_100202869 3300005435 Bacteria 1815
36 Ga0070713_100125662 3300005436 Bacteria 2255
37 Ga0070713_100571696 3300005436 Bacteria 1072
38 Ga0070710_10165451 3300005437 Bacteria 1374
39 Ga0070710_11127810 3300005437 Unclassified 577
40 Ga0070701_10000955 3300005438 Bacteria 10480
41 Ga0070711_100274911 3300005439 Bacteria 1330
42 Ga0070705_100164106 3300005440 Bacteria 1488
43 Ga0070700_100000199 3300005441 Bacteria 34018
44 Ga0070700_100288810 3300005441 Bacteria 1192
45 Ga0070694_100005329 3300005444 Bacteria 7779
46 Ga0070678_100005618 3300005456 Bacteria 7280
47 Ga0070662_100107313 3300005457 Unclassified 2122
48 Ga0070681_10090705 3300005458 Bacteria 3006
49 Ga0070681_10333284 3300005458 Bacteria 1427
50 Ga0070681_10876934 3300005458 Bacteria 815
51 Ga0068867_100108372 3300005459 Bacteria 2130
52 Ga0068867_100563869 3300005459 Bacteria 988
53 Ga0070685_10021973 3300005466 Bacteria 3472
54 Ga0070698_100434274 3300005471 Bacteria 1248
55 Ga0070679_100137494 3300005530 Bacteria 2424
56 Ga0070679_100203067 3300005530 Bacteria 1947
57 Ga0070684_100122945 3300005535 Bacteria 2336
58 Ga0070686_100006610 3300005544 Bacteria 6453
59 Ga0070695_100032293 3300005545 Bacteria 3272
60 Ga0070696_100189531 3300005546 Bacteria 1530
61 Ga0070696_100507873 3300005546 Bacteria 960
62 Ga0070696_100528673 3300005546 Bacteria 942
63 Ga0070693_100010995 3300005547 Bacteria 4549
64 Ga0070704_100083557 3300005549 Bacteria 2358
65 Ga0068855_100086138 3300005563 Bacteria 3633
66 Ga0070664_100044596 3300005564 Bacteria 3744
67 Ga0068854_100026339 3300005578 Bacteria 3996
68 Ga0070702_100000107 3300005615 Bacteria 24776
69 Ga0068852_101462377 3300005616 Bacteria 706
70 Ga0068859_100018985 3300005617 Bacteria 6905
71 Ga0068866_10000721 3300005718 Bacteria 15007
72 Ga0068861_100003333 3300005719 Bacteria 10631
73 Ga0068851_10255873 3300005834 Bacteria 994
74 Ga0068870_10001416 3300005840 Bacteria 9692
75 Ga0068858_100009133 3300005842 Bacteria 9478
76 Ga0068860_100086645 3300005843 Bacteria 2981
77 Ga0068862_100009109 3300005844 Bacteria 8218
78 Ga0081540_1004167 3300005983 Bacteria 11127
79 Ga0070717_10718549 3300006028 Bacteria 908
80 Ga0075365_10488930 3300006038 Bacteria 870
81 Ga0075364_10652161 3300006051 Bacteria 719
82 Ga0070712_100222365 3300006175 Bacteria 1495
83 Ga0070712_101547165 3300006175 Bacteria 580
84 Ga0075367_10561809 3300006178 Bacteria 725
85 Ga0075366_10016005 3300006195 Bacteria 4306
86 Ga0075366_10051367 3300006195 Bacteria 2449
87 Ga0097621_100047379 3300006237 Bacteria 3483
88 Ga0068871_100003553 3300006358 Bacteria 10731
89 Ga0068871_101704412 3300006358 Bacteria 598
90 Ga0075429_101491688 3300006880 Unclassified 588
91 Ga0068865_100000840 3300006881 Bacteria 17335
92 Ga0068865_100096968 3300006881 Bacteria 2151
93 Ga0068865_100997704 3300006881 Unclassified 733
94 Ga0075436_100617190 3300006914 Bacteria 800
95 Ga0097620_100018985 3300006931 Bacteria 6905
96 Ga0099794_10198235 3300007265 Unclassified 1028
97 Ga0099794_10348317 3300007265 Bacteria 770
98 Ga0099795_10246315 3300007788 Unclassified 769
99 Ga0105250_10303551 3300009092 Unclassified 691
100 Ga0105240_10014843 3300009093 Bacteria 10619
101 Ga0105245_10010542 3300009098 Bacteria 8042
102 Ga0105247_10173446 3300009101 Bacteria 1435
103 Ga0105243_10017398 3300009148 Bacteria 5434
104 Ga0105243_10074168 3300009148 Bacteria 2759
105 Ga0105241_10347540 3300009174 Bacteria 1287
106 Ga0105241_10886661 3300009174 Bacteria 827
107 Ga0105242_10006095 3300009176 Bacteria 9294
108 Ga0105248_10322132 3300009177 Bacteria 1741
109 Ga0105238_10251818 3300009551 Bacteria 1745
110 Ga0105238_11032817 3300009551 Bacteria 843
111 Ga0105249_10006422 3300009553 Bacteria 10221
112 Ga0105033_123656 3300009986 Unclassified 563
113 Ga0105035_100626 3300009988 Bacteria 2201
114 Ga0157373_10127175 3300013100 Bacteria 1792
115 Ga0157371_10079482 3300013102 Bacteria 2323
116 Ga0157371_10354302 3300013102 Unclassified 1069
117 Ga0157369_10151475 3300013105 Bacteria 2451
118 Ga0157369_10212694 3300013105 Bacteria 2026
119 Ga0157378_10004190 3300013297 Bacteria 12724
120 Ga0157378_10508517 3300013297 Bacteria 1204
121 Ga0157378_12275640 3300013297 Unclassified 593
122 Ga0163162_10045892 3300013306 Bacteria 4379
123 Ga0157372_10052537 3300013307 Bacteria 4538
124 Ga0157375_10044743 3300013308 Bacteria 4304
125 Ga0157515_115462 3300013875 Bacteria 521
126 Ga0157380_10005168 3300014326 Bacteria 9125
127 Ga0157380_10095321 3300014326 Bacteria 2465
128 Ga0157379_10024471 3300014968 Bacteria 5360
129 Ga0213873_10052172 3300021358 Bacteria 1086
130 Ga0213872_10125962 3300021361 Bacteria 1131
131 Ga0213874_10016514 3300021377 Bacteria 1966
132 Ga0213876_10004601 3300021384 Bacteria 7691
133 Ga0213876_10095903 3300021384 Bacteria 1571
134 Ga0213876_10105973 3300021384 Bacteria 1492
135 Ga0213876_10632804 3300021384 Bacteria 569
136 Ga0213875_10001344 3300021388 Bacteria 16189
137 Ga0213875_10004429 3300021388 Bacteria 7714
138 Ga0213875_10084830 3300021388 Bacteria 1478
139 Ga0213875_10095590 3300021388 Bacteria 1385
140 Ga0209025_1000582 3300025294 Bacteria 66224
141 Ga0209758_1011019 3300025297 Bacteria 5300
142 Ga0207656_10005388 3300025321 Bacteria 4519
143 Ga0207692_11156727 3300025898 Bacteria 513
144 Ga0207642_10004977 3300025899 Bacteria 4307
145 Ga0207647_10003347 3300025904 Bacteria 12021
146 Ga0207699_10098764 3300025906 Bacteria 1848
147 Ga0207699_10418011 3300025906 Bacteria 957
148 Ga0207645_10118737 3300025907 Unclassified 1716
149 Ga0207643_10041218 3300025908 Bacteria 2601
150 Ga0207705_10025425 3300025909 Bacteria 4227
151 Ga0207654_10001932 3300025911 Bacteria 10735
152 Ga0207654_10227444 3300025911 Unclassified 1241
153 Ga0207707_10018787 3300025912 Bacteria 6028
154 Ga0207695_10007515 3300025913 Bacteria 13825
155 Ga0207695_10189308 3300025913 Bacteria 1976
156 Ga0207671_10001159 3300025914 Bacteria 31442
157 Ga0207693_10014010 3300025915 Bacteria 6456
158 Ga0207693_10154325 3300025915 Bacteria 1806
159 Ga0207663_10046628 3300025916 Bacteria 2671
160 Ga0207660_10117726 3300025917 Bacteria 2008
161 Ga0207660_10422477 3300025917 Bacteria 1075
162 Ga0207660_10663319 3300025917 Bacteria 850
163 Ga0207660_11551821 3300025917 Bacteria 534
164 Ga0207657_10014888 3300025919 Bacteria 7566
165 Ga0207657_10320180 3300025919 Bacteria 1226
166 Ga0207649_10972974 3300025920 Bacteria 667
167 Ga0207652_10037367 3300025921 Bacteria 4110
168 Ga0207652_10651104 3300025921 Unclassified 942
169 Ga0207694_10129467 3300025924 Bacteria 2022
170 Ga0207687_10016734 3300025927 Bacteria 4820
171 Ga0207700_10233260 3300025928 Bacteria 1565
172 Ga0207664_10405248 3300025929 Bacteria 1213
173 Ga0207664_10693720 3300025929 Bacteria 915
174 Ga0207690_10138798 3300025932 Unclassified 1788
175 Ga0207690_10239436 3300025932 Bacteria 1397
176 Ga0207686_10000279 3300025934 Bacteria 38089
177 Ga0207686_10026085 3300025934 Bacteria 3407
178 Ga0207709_10124359 3300025935 Bacteria 1747
179 Ga0207709_10157454 3300025935 Bacteria 1580
180 Ga0207670_10004023 3300025936 Bacteria 7858
181 Ga0207669_10029952 3300025937 Bacteria 3018
182 Ga0207704_10003852 3300025938 Bacteria 6818
183 Ga0207665_10294454 3300025939 Bacteria 1211
184 Ga0207711_10400780 3300025941 Bacteria 1275
185 Ga0207689_10003072 3300025942 Bacteria 15383
186 Ga0207667_10028843 3300025949 Bacteria 6025
187 Ga0207667_10223285 3300025949 Bacteria 1930
188 Ga0207712_10019259 3300025961 Bacteria 4455
189 Ga0207640_10306590 3300025981 Bacteria 1258
190 Ga0207677_10244565 3300026023 Bacteria 1453
191 Ga0207703_10003484 3300026035 Bacteria 13172
192 Ga0207639_10037574 3300026041 Bacteria 3597
193 Ga0207639_10901847 3300026041 Unclassified 826
194 Ga0207678_10043961 3300026067 Bacteria 3865
195 Ga0207708_10000067 3300026075 Bacteria 83659
196 Ga0207708_10026036 3300026075 Bacteria 4425
197 Ga0207702_10005873 3300026078 Bacteria 10672
198 Ga0207702_10170085 3300026078 Bacteria 1997
199 Ga0207702_11519068 3300026078 Bacteria 663
200 Ga0207648_10000232 3300026089 Bacteria 59568
201 Ga0207648_11232617 3300026089 Bacteria 703
202 Ga0207675_100000258 3300026118 Bacteria 50669
203 Ga0207683_10024478 3300026121 Bacteria 5201
204 Ga0207698_10077171 3300026142 Bacteria 2670
205 Ga0207698_10173952 3300026142 Unclassified 1899
206 Ga0207698_10742811 3300026142 Bacteria 979
207 Ga0268265_10085033 3300028380 Bacteria 2509
208 Ga0268264_10009377 3300028381 Bacteria 8102
209 Ga0265325_10000821 3300031241 Bacteria 22542
210 Ga0265313_10016125 3300031595 Bacteria 4312
211 Ga0307410_11284372 3300031852 Bacteria 640
212 Ga0307407_10749952 3300031903 Bacteria 739
213 Ga0373937_1443962 3300036401 Bacteria 636
214 Ga0395900_0808479 3300037418 Bacteria 865
215 Ga0395905_0069619 3300037471 Bacteria 3296
216 Ga0436364_0177728 3300037853 Bacteria 960
217 Ga0436364_0197130 3300037853 Bacteria 17743
218 Ga0436364_0461387 3300037853 Bacteria 1074
219 Ga0436364_0617972 3300037853 Bacteria 7054
220 Ga0436364_0740264 3300037853 Bacteria 4806
221 Ga0436364_1155216 3300037853 Unclassified 506
222 Ga0395901_1251538 3300038443 Bacteria 706
223 Ga0436365_0306156 3300039437 Bacteria 1100
224 Ga0436365_0364034 3300039437 Bacteria 67701
225 Ga0436365_0773905 3300039437 Bacteria 4279
226 Ga0436365_1078535 3300039437 Bacteria 2251
227 Ga0436365_1140355 3300039437 Bacteria 554
228 Ga0436365_1231871 3300039437 Bacteria 735
229 Ga0436365_1424493 3300039437 Bacteria 16000
230 Ga0436365_1651533 3300039437 Bacteria 1401
231 Ga0436360_0929109 3300039438 Unclassified 522
232 Ga0436361_0314021 3300039447 Bacteria 2862
233 Ga0436363_0145876 3300039450 Bacteria 588
234 Ga0436363_0239262 3300039450 Bacteria 9304
235 Ga0436363_0880288 3300039450 Bacteria 1128
236 Ga0436363_0922216 3300039450 Bacteria 4051
237 Ga0436362_0104926 3300039453 Bacteria 807
238 Ga0436362_0362206 3300039453 Bacteria 4670
239 Ga0451839_0187830 3300041496 Unclassified 542
240 Ga0466965_0357591 3300044683 Bacteria 801
241 Ga0466963_0324048 3300044694 Bacteria 1084
242 Ga0466960_0029446 3300044901 Bacteria 2520
243 Ga0466960_0068014 3300044901 Bacteria 1766
244 Ga0466960_0526391 3300044901 Bacteria 695
245 Ga0466958_0184625 3300045836 Bacteria 1324
246 Ga0495610_0063777 3300046512 Bacteria 1743
247 Ga0495587_0014893 3300046536 Bacteria 4865
248 Ga0495686_0355705 3300047472 Unclassified 795
249 Ga0496121_0395853 3300048924 Bacteria 906
250 Ga0501032_0079530 3300049569 Unclassified 2183
251 Ga0501034_0103020 3300049571 Bacteria 2847
252 Ga0501034_0200129 3300049571 Archaea 1956
253 Ga0501034_1347132 3300049571 Unclassified 590
254 Ga0501036_1556133 3300049572 Archaea 534
255 Ga0501038_1355369 3300049574 Bacteria 512
256 Ga0501039_0256164 3300049575 Archaea 1376
257 Ga0501047_0431403 3300049581 Archaea 1149
258 Ga0501070_0039383 3300049586 Bacteria 3943
259 Ga0501070_0074393 3300049586 Bacteria 2812
260 Ga0501071_0470939 3300049587 Bacteria 962
261 Ga0501071_0871566 3300049587 Unclassified 694
262 Ga0501072_0342077 3300049588 Unclassified 1188
263 Ga0501073_0694278 3300049589 Bacteria 702
264 Ga0501073_1182847 3300049589 Unclassified 525
265 Ga0501076_1021038 3300049592 Bacteria 681
266 Ga0501083_0081241 3300049744 Bacteria 2149
267 Ga0501035_0070173 3300049822 Bacteria 3104
268 Ga0501044_0376794 3300049823 Bacteria 1335
269 Ga0501045_0285736 3300049824 Bacteria 1228
270 nmdc:mga03683_164868_c1 3300050489 Bacteria 1005
271 nmdc:mga03683_89974_c1 3300050489 Bacteria 1337
272 nmdc:mga03n38_233849_c1 3300050490 Bacteria 964
273 nmdc:mga00v17_361327_c1 3300050491 Bacteria 944
274 nmdc:mga0yw44_1074059_c1 3300050492 Bacteria 544
275 nmdc:mga0k408_12326_c1 3300050493 Bacteria 4671
276 nmdc:mga0k408_27719_c1 3300050493 Bacteria 3218
277 nmdc:mga06z11_791703_c1 3300050494 Bacteria 578
278 nmdc:mga06z11_986977_c1 3300050494 Bacteria 513
279 nmdc:mga08x19_641904_c1 3300050514 Bacteria 753
280 Ga0587071_161660 3300060344 Bacteria 564
281 Ga0501082_0325216 3300060353 Bacteria 1340
282 Ga0501077_0125296
283 JGI24740J21852_10007389
284 JGI24739J22299_10023465
285 JGI24739J22299_10178351
286 JGI24735J21928_10022222
287 JGI24738J21930_10006014
288 JGI25151J46595_10000474
289 JGI25153J46596_10040089
290 rootL2_10240124
291 rootH1_10244251
292 Ga0070658_10022923
293 Ga0070658_10060852
294 Ga0070676_10100708
295 Ga0070690_100000486
296 Ga0068869_100002903
297 Ga0070680_100055708
298 Ga0070680_100206749
299 Ga0070682_100029880
300 Ga0070682_100698746
301 Ga0068868_100309179
302 Ga0070660_100106851
303 Ga0070660_100417961
304 Ga0070689_100026759
305 Ga0070691_10014865
306 Ga0070661_100172820
307 Ga0070661_100733553
308 Ga0070692_10021021
309 Ga0070692_10051305
310 Ga0070674_101825404
311 Ga0070673_102409340
312 Ga0070688_100024186
313 Ga0070659_100036271
314 Ga0070659_101797155
315 Ga0070709_10138967
316 Ga0070714_100202869
317 Ga0070713_100125662
318 Ga0070713_100571696
319 Ga0070710_10165451
320 Ga0070710_11127810
321 Ga0070701_10000955
322 Ga0070711_100274911
323 Ga0070705_100164106
324 Ga0070700_100000199
325 Ga0070700_100288810
326 Ga0070694_100005329
327 Ga0070678_100005618
328 Ga0070662_100107313
329 Ga0070681_10090705
330 Ga0070681_10333284
331 Ga0070681_10876934
332 Ga0068867_100108372
333 Ga0068867_100563869
334 Ga0070685_10021973
335 Ga0070698_100434274
336 Ga0070679_100137494
337 Ga0070679_100203067
338 Ga0070684_100122945
339 Ga0070686_100006610
340 Ga0070695_100032293
341 Ga0070696_100189531
342 Ga0070696_100507873
343 Ga0070696_100528673
344 Ga0070693_100010995
345 Ga0070704_100083557
346 Ga0068855_100086138
347 Ga0070664_100044596
348 Ga0068854_100026339
349 Ga0070702_100000107
350 Ga0068852_101462377
351 Ga0068859_100018985
352 Ga0068866_10000721
353 Ga0068861_100003333
354 Ga0068851_10255873
355 Ga0068870_10001416
356 Ga0068858_100009133
357 Ga0068860_100086645
358 Ga0068862_100009109
359 Ga0081540_1004167
360 Ga0070717_10718549
361 Ga0075365_10488930
362 Ga0075364_10652161
363 Ga0070712_100222365
364 Ga0070712_101547165
365 Ga0075367_10561809
366 Ga0075366_10016005
367 Ga0075366_10051367
368 Ga0097621_100047379
369 Ga0068871_100003553
370 Ga0068871_101704412
371 Ga0075429_101491688
372 Ga0068865_100000840
373 Ga0068865_100096968
374 Ga0068865_100997704
375 Ga0075436_100617190
376 Ga0097620_100018985
377 Ga0099794_10198235
378 Ga0099794_10348317
379 Ga0099795_10246315
380 Ga0105250_10303551
381 Ga0105240_10014843
382 Ga0105245_10010542
383 Ga0105247_10173446
384 Ga0105243_10017398
385 Ga0105243_10074168
386 Ga0105241_10347540
387 Ga0105241_10886661
388 Ga0105242_10006095
389 Ga0105248_10322132
390 Ga0105238_10251818
391 Ga0105238_11032817
392 Ga0105249_10006422
393 Ga0105033_123656
394 Ga0105035_100626
395 Ga0157373_10127175
396 Ga0157371_10079482
397 Ga0157371_10354302
398 Ga0157369_10151475
399 Ga0157369_10212694
400 Ga0157378_10004190
401 Ga0157378_10508517
402 Ga0157378_12275640
403 Ga0163162_10045892
404 Ga0157372_10052537
405 Ga0157375_10044743
406 Ga0157515_115462
407 Ga0157380_10005168
408 Ga0157380_10095321
409 Ga0157379_10024471
410 Ga0213873_10052172
411 Ga0213872_10125962
412 Ga0213874_10016514
413 Ga0213876_10004601
414 Ga0213876_10095903
415 Ga0213876_10105973
416 Ga0213876_10632804
417 Ga0213875_10001344
418 Ga0213875_10004429
419 Ga0213875_10084830
420 Ga0213875_10095590
421 Ga0209025_1000582
422 Ga0209758_1011019
423 Ga0207656_10005388
424 Ga0207692_11156727
425 Ga0207642_10004977
426 Ga0207647_10003347
427 Ga0207699_10098764
428 Ga0207699_10418011
429 Ga0207645_10118737
430 Ga0207643_10041218
431 Ga0207705_10025425
432 Ga0207654_10001932
433 Ga0207654_10227444
434 Ga0207707_10018787
435 Ga0207695_10007515
436 Ga0207695_10189308
437 Ga0207671_10001159
438 Ga0207693_10014010
439 Ga0207693_10154325
440 Ga0207663_10046628
441 Ga0207660_10117726
442 Ga0207660_10422477
443 Ga0207660_10663319
444 Ga0207660_11551821
445 Ga0207657_10014888
446 Ga0207657_10320180
447 Ga0207649_10972974
448 Ga0207652_10037367
449 Ga0207652_10651104
450 Ga0207694_10129467
451 Ga0207687_10016734
452 Ga0207700_10233260
453 Ga0207664_10405248
454 Ga0207664_10693720
455 Ga0207690_10138798
456 Ga0207690_10239436
457 Ga0207686_10000279
458 Ga0207686_10026085
459 Ga0207709_10124359
460 Ga0207709_10157454
461 Ga0207670_10004023
462 Ga0207669_10029952
463 Ga0207704_10003852
464 Ga0207665_10294454
465 Ga0207711_10400780
466 Ga0207689_10003072
467 Ga0207667_10028843
468 Ga0207667_10223285
469 Ga0207712_10019259
470 Ga0207640_10306590
471 Ga0207677_10244565
472 Ga0207703_10003484
473 Ga0207639_10037574
474 Ga0207639_10901847
475 Ga0207678_10043961
476 Ga0207708_10000067
477 Ga0207708_10026036
478 Ga0207702_10005873
479 Ga0207702_10170085
480 Ga0207702_11519068
481 Ga0207648_10000232
482 Ga0207648_11232617
483 Ga0207675_100000258
484 Ga0207683_10024478
485 Ga0207698_10077171
486 Ga0207698_10173952
487 Ga0207698_10742811
488 Ga0268265_10085033
489 Ga0268264_10009377
490 Ga0265325_10000821
491 Ga0265313_10016125
492 Ga0307410_11284372
493 Ga0307407_10749952
494 Ga0373937_1443962
495 Ga0395900_0808479
496 Ga0395905_0069619
497 Ga0436364_0177728
498 Ga0436364_0197130
499 Ga0436364_0461387
500 Ga0436364_0617972
501 Ga0436364_0740264
502 Ga0436364_1155216
503 Ga0395901_1251538
504 Ga0436365_0306156
505 Ga0436365_0364034
506 Ga0436365_0773905
507 Ga0436365_1078535
508 Ga0436365_1140355
509 Ga0436365_1231871
510 Ga0436365_1424493
511 Ga0436365_1651533
512 Ga0436360_0929109
513 Ga0436361_0314021
514 Ga0436363_0145876
515 Ga0436363_0239262
516 Ga0436363_0880288
517 Ga0436363_0922216
518 Ga0436362_0104926
519 Ga0436362_0362206
520 Ga0451839_0187830
521 Ga0466965_0357591
522 Ga0466963_0324048
523 Ga0466960_0029446
524 Ga0466960_0068014
525 Ga0466960_0526391
526 Ga0466958_0184625
527 Ga0495610_0063777
528 Ga0495587_0014893
529 Ga0495686_0355705
530 Ga0496121_0395853
531 Ga0501032_0079530
532 Ga0501034_0103020
533 Ga0501034_0200129
534 Ga0501034_1347132
535 Ga0501036_1556133
536 Ga0501038_1355369
537 Ga0501039_0256164
538 Ga0501047_0431403
539 Ga0501070_0039383
540 Ga0501070_0074393
541 Ga0501071_0470939
542 Ga0501071_0871566
543 Ga0501072_0342077
544 Ga0501073_0694278
545 Ga0501073_1182847
546 Ga0501076_1021038
547 Ga0501083_0081241
548 Ga0501035_0070173
549 Ga0501044_0376794
550 Ga0501045_0285736
551 nmdc:mga03683_164868_c1
552 nmdc:mga03683_89974_c1
553 nmdc:mga03n38_233849_c1
554 nmdc:mga00v17_361327_c1
555 nmdc:mga0yw44_1074059_c1
556 nmdc:mga0k408_12326_c1
557 nmdc:mga0k408_27719_c1
558 nmdc:mga06z11_791703_c1
559 nmdc:mga06z11_986977_c1
560 nmdc:mga08x19_641904_c1
561 Ga0587071_161660
562 Ga0501082_0325216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07978

NIPSNAP

NIPSNAP

3

107

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vqy-assembly1.cif.gz_C crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution 0.9098 2 107
5ixu-assembly1.cif.gz_A crystal structure of an uncharacterized nipsnap domain protein from burkholderia xenovorans 0.9092 1 104
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.9086 1 107
5kak-assembly1.cif.gz_E crystal structure of an uncharacterized nipsnap-like domain protein from burkholderia xenovorans 0.9015 2 104
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.9005 1 107
ID Description Score Start End Superfamily
5ixuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9093 1 104 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9086 1 107 3.30.70.100
5kakE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9015 2 104 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9005 1 107 3.30.70.100
1vqyA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8879 1 107 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3S2DZA0-F1-model_v4 deleted 0.9914 1 92
AF-A0A444IJ71-F1-model_v4 NIPSNAP family protein 0.9911 1 104
AF-A0A2S6MR02-F1-model_v4 NIPSNAP family protein 0.9904 1 106
AF-A0A831Y7A0-F1-model_v4 NIPSNAP family protein 0.9902 1 104
AF-A0A418V2S2-F1-model_v4 NIPSNAP family protein 0.9867 1 107

Map