F384516

General Info

Members Datasets Scaffolds Average Seq Length
281 195 562 119

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0062334|Ga0495630_0062334_852_1265
Length 137
Sequence VTTIRPLNKLNSKGKIIMAHYVDGFVLPVPKKNLNAYRRIAQKAGRIFRELGALEYCECAGDDLNVKIGLPFPRGIRTKSGETVVFSYIVYKSRAHRDSVNAKVMKDPRIAALCDPKKMPFDCKRMLYGGFKTIVKA

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
122 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
123 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.52
Nodule 0
Rhizoplane 0.36
Rhizosphere 86.12
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0062334 3300046517 Bacteria 2801
2 SwRhRL2b_contig_2370353 2162886007 Bacteria 936
3 Ga0065707_10006779 3300005295 Bacteria 2993
4 Ga0065707_10279703 3300005295 Bacteria 1024
5 Ga0065707_10829280 3300005295 Bacteria 589
6 Ga0070676_10875714 3300005328 Bacteria 667
7 Ga0070676_11240868 3300005328 Bacteria 568
8 Ga0070690_100225038 3300005330 Unclassified 1316
9 Ga0070690_100873276 3300005330 Bacteria 702
10 Ga0070690_100943636 3300005330 Bacteria 677
11 Ga0070670_100734302 3300005331 Bacteria 889
12 Ga0068869_100215085 3300005334 Bacteria 1521
13 Ga0070666_10869848 3300005335 Bacteria 666
14 Ga0070689_100369757 3300005340 Bacteria 1206
15 Ga0070691_10487015 3300005341 Bacteria 711
16 Ga0070661_101072833 3300005344 Bacteria 670
17 Ga0070668_100692560 3300005347 Bacteria 898
18 Ga0070669_100013774 3300005353 Bacteria 5748
19 Ga0070675_100270468 3300005354 Bacteria 1491
20 Ga0070673_101478584 3300005364 Bacteria 640
21 Ga0070688_100039675 3300005365 Unclassified 2882
22 Ga0070688_100908045 3300005365 Unclassified 695
23 Ga0070667_102319295 3300005367 Unclassified 505
24 Ga0070701_10829465 3300005438 Bacteria 633
25 Ga0070700_100620441 3300005441 Bacteria 850
26 Ga0070708_100039339 3300005445 Unclassified 4137
27 Ga0070663_101681760 3300005455 Bacteria 567
28 Ga0070662_100156783 3300005457 Bacteria 1778
29 Ga0070681_10045022 3300005458 Bacteria 4417
30 Ga0068867_100438630 3300005459 Bacteria 1110
31 Ga0070685_10847166 3300005466 Bacteria 677
32 Ga0070707_100320210 3300005468 Bacteria 1507
33 Ga0070699_100142816 3300005518 Bacteria 2115
34 Ga0070697_100712808 3300005536 Bacteria 886
35 Ga0070672_100452745 3300005543 Bacteria 1106
36 Ga0070672_101175528 3300005543 Bacteria 683
37 Ga0070686_100303271 3300005544 Bacteria 1185
38 Ga0070686_100326906 3300005544 Bacteria 1145
39 Ga0070695_101226157 3300005545 Unclassified 618
40 Ga0070695_101770095 3300005545 Bacteria 518
41 Ga0070693_101232622 3300005547 Bacteria 576
42 Ga0070665_100256781 3300005548 Bacteria 1749
43 Ga0068855_100105574 3300005563 Bacteria 3238
44 Ga0070702_100075967 3300005615 Bacteria 1998
45 Ga0068859_100688451 3300005617 Bacteria 1113
46 Ga0068864_100723455 3300005618 Bacteria 974
47 Ga0068861_101889728 3300005719 Bacteria 594
48 Ga0068862_100087129 3300005844 Bacteria 2716
49 Ga0068862_100597773 3300005844 Bacteria 1059
50 Ga0081455_10000861 3300005937 Bacteria 39120
51 Ga0081455_10016096 3300005937 Bacteria 7233
52 Ga0081455_10034575 3300005937 Bacteria 4527
53 Ga0081539_10002802 3300005985 Bacteria 23304
54 Ga0075365_10306417 3300006038 Bacteria 1118
55 Ga0075368_10185394 3300006042 Bacteria 878
56 Ga0075363_100706755 3300006048 Bacteria 609
57 Ga0075364_10087184 3300006051 Bacteria 2068
58 Ga0075432_10379102 3300006058 Bacteria 606
59 Ga0075362_10021347 3300006177 Bacteria 2715
60 Ga0075362_10065539 3300006177 Bacteria 1649
61 Ga0075362_10214541 3300006177 Bacteria 939
62 Ga0075367_10062062 3300006178 Bacteria 2231
63 Ga0075367_10093093 3300006178 Bacteria 1835
64 Ga0075367_10127940 3300006178 Bacteria 1569
65 Ga0075367_10262863 3300006178 Bacteria 1083
66 Ga0075367_10343485 3300006178 Bacteria 942
67 Ga0075367_10596773 3300006178 Bacteria 702
68 Ga0075369_10003733 3300006186 Bacteria 5572
69 Ga0075369_10094800 3300006186 Bacteria 1334
70 Ga0075369_10402271 3300006186 Bacteria 645
71 Ga0075366_10147516 3300006195 Bacteria 1424
72 Ga0097621_101237520 3300006237 Bacteria 704
73 Ga0075370_10100490 3300006353 Bacteria 1674
74 Ga0075370_10198962 3300006353 Bacteria 1182
75 Ga0068871_100208106 3300006358 Bacteria 1691
76 Ga0068871_100682504 3300006358 Bacteria 940
77 Ga0075428_100426772 3300006844 Bacteria 1420
78 Ga0075428_100744104 3300006844 Bacteria 1043
79 Ga0075428_100899462 3300006844 Bacteria 939
80 Ga0075430_100103837 3300006846 Bacteria 2373
81 Ga0075430_101488918 3300006846 Bacteria 556
82 Ga0075431_100000648 3300006847 Bacteria 29516
83 Ga0075433_10886736 3300006852 Bacteria 778
84 Ga0075433_11586921 3300006852 Bacteria 564
85 Ga0075434_101474670 3300006871 Bacteria 690
86 Ga0075429_100045703 3300006880 Bacteria 3810
87 Ga0075429_100237348 3300006880 Unclassified 1597
88 Ga0075436_100065612 3300006914 Bacteria 2509
89 Ga0097620_100688513 3300006931 Bacteria 1113
90 Ga0097620_101966665 3300006931 Unclassified 646
91 Ga0075435_100239681 3300007076 Unclassified 1542
92 Ga0075435_101147882 3300007076 Unclassified 679
93 Ga0105240_10032946 3300009093 Bacteria 6700
94 Ga0105240_10101286 3300009093 Bacteria 3503
95 Ga0105240_10282788 3300009093 Bacteria 1905
96 Ga0111539_10022829 3300009094 Bacteria 7686
97 Ga0111539_11354678 3300009094 Bacteria 826
98 Ga0114129_10061422 3300009147 Bacteria 5251
99 Ga0105243_10460659 3300009148 Unclassified 1195
100 Ga0105243_11381629 3300009148 Bacteria 724
101 Ga0105242_12762916 3300009176 Bacteria 541
102 Ga0105248_11092547 3300009177 Bacteria 901
103 Ga0105248_12758867 3300009177 Bacteria 560
104 Ga0105249_10004489 3300009553 Bacteria 12065
105 Ga0105249_10279926 3300009553 Bacteria 1665
106 Ga0105249_11516898 3300009553 Bacteria 743
107 Ga0105035_115641 3300009988 Bacteria 697
108 Ga0099796_10142399 3300010159 Bacteria 938
109 Ga0105246_10478812 3300011119 Bacteria 1053
110 Ga0105246_10607040 3300011119 Bacteria 946
111 Ga0157370_10367260 3300013104 Unclassified 1326
112 Ga0157370_10957568 3300013104 Unclassified 776
113 Ga0157370_11644970 3300013104 Bacteria 577
114 Ga0157374_12699981 3300013296 Bacteria 524
115 Ga0157378_10364242 3300013297 Bacteria 1415
116 Ga0163162_11716669 3300013306 Bacteria 717
117 Ga0157375_10381774 3300013308 Unclassified 1575
118 Ga0157375_10438100 3300013308 Unclassified 1473
119 Ga0157375_13120048 3300013308 Bacteria 553
120 Ga0163163_12296603 3300014325 Bacteria 598
121 Ga0157380_10723720 3300014326 Bacteria 1003
122 Ga0157376_11051153 3300014969 Bacteria 838
123 Ga0206353_10329709 3300020082 Bacteria 674
124 Ga0207697_10430705 3300025315 Bacteria 585
125 Ga0207680_10629649 3300025903 Bacteria 768
126 Ga0207707_10034495 3300025912 Bacteria 4427
127 Ga0207695_10085746 3300025913 Bacteria 3177
128 Ga0207695_10289797 3300025913 Bacteria 1529
129 Ga0207649_11260763 3300025920 Bacteria 584
130 Ga0207681_10035646 3300025923 Bacteria 3279
131 Ga0207659_10976885 3300025926 Bacteria 728
132 Ga0207706_10120834 3300025933 Unclassified 2303
133 Ga0207670_11482886 3300025936 Bacteria 576
134 Ga0207691_10065535 3300025940 Bacteria 3287
135 Ga0207691_11144023 3300025940 Bacteria 646
136 Ga0207711_12067172 3300025941 Bacteria 512
137 Ga0207689_10183284 3300025942 Bacteria 1726
138 Ga0207712_10019861 3300025961 Bacteria 4392
139 Ga0207668_10645187 3300025972 Bacteria 926
140 Ga0207668_11216670 3300025972 Bacteria 677
141 Ga0207639_10642645 3300026041 Bacteria 981
142 Ga0207639_11321414 3300026041 Bacteria 677
143 Ga0207678_10483871 3300026067 Bacteria 1078
144 Ga0207708_10649937 3300026075 Bacteria 897
145 Ga0207675_100749062 3300026118 Bacteria 988
146 Ga0207683_10414698 3300026121 Bacteria 1240
147 Ga0209971_1090934 3300027682 Unclassified 745
148 Ga0207428_10015853 3300027907 Bacteria 6502
149 Ga0207428_10345324 3300027907 Bacteria 1096
150 Ga0268265_10019667 3300028380 Bacteria 4700
151 Ga0268265_10367232 3300028380 Bacteria 1320
152 Ga0268264_10727083 3300028381 Bacteria 987
153 Ga0316575_10124253 3300031665 Bacteria 1056
154 Ga0307406_11363060 3300031901 Bacteria 621
155 Ga0307416_100759360 3300032002 Bacteria 1063
156 Ga0307411_10580707 3300032005 Bacteria 961
157 Ga0373930_0104834 3300034816 Bacteria 676
158 Ga0373939_0500600 3300035114 Bacteria 519
159 Ga0373956_0095728 3300035119 Unclassified 1373
160 Ga0373946_0244971 3300035171 Bacteria 873
161 Ga0373961_0163398 3300035241 Bacteria 766
162 Ga0316574_0027959 3300035398 Bacteria 3398
163 Ga0373947_0034496 3300035725 Bacteria 2993
164 Ga0373937_0284852 3300036401 Bacteria 1561
165 Ga0373937_0533169 3300036401 Bacteria 1115
166 Ga0373925_0719822 3300037068 Unclassified 823
167 Ga0395905_1017325 3300037471 Bacteria 732
168 Ga0395905_1219257 3300037471 Bacteria 656
169 Ga0439453_0018441 3300041408 Bacteria 1234
170 Ga0439465_0202461 3300041413 Bacteria 724
171 Ga0439432_250573 3300042006 Bacteria 508
172 Ga0439459_0042164 3300042438 Bacteria 974
173 Ga0450916_016002 3300042530 Bacteria 991
174 Ga0451577_0000536 3300042876 Bacteria 62369
175 Ga0451577_0611078 3300042876 Bacteria 989
176 Ga0451577_1370106 3300042876 Unclassified 628
177 Ga0453683_0003123 3300044673 Bacteria 12366
178 Ga0453683_0038589 3300044673 Bacteria 3003
179 Ga0453684_0000001 3300044712 Bacteria 2623166
180 Ga0453684_0001218 3300044712 Bacteria 78994
181 Ga0453684_0216999 3300044712 Bacteria 2219
182 Ga0451576_0004776 3300045051 Bacteria 17369
183 Ga0451576_0426869 3300045051 Bacteria 1391
184 Ga0495617_253582 3300046452 Bacteria 542
185 Ga0495653_0951321 3300046463 Unclassified 510
186 Ga0495580_0268854 3300046472 Bacteria 1165
187 Ga0495580_0578978 3300046472 Bacteria 743
188 Ga0495639_0060984 3300046475 Bacteria 1729
189 Ga0495662_0123165 3300046476 Unclassified 1273
190 Ga0495664_0056420 3300046477 Bacteria 2337
191 Ga0495608_0194114 3300046511 Bacteria 1281
192 Ga0495630_0001689 3300046517 Bacteria 15398
193 Ga0495666_0001614 3300046526 Bacteria 11101
194 Ga0495586_0001083 3300046535 Bacteria 15386
195 Ga0495586_0197694 3300046535 Bacteria 1139
196 Ga0495587_0148922 3300046536 Unclassified 1334
197 Ga0495587_0162972 3300046536 Unclassified 1268
198 Ga0495645_0092076 3300046543 Bacteria 2165
199 Ga0495634_0157519 3300046642 Bacteria 1433
200 Ga0495599_0082296 3300046678 Bacteria 2011
201 Ga0495647_0012989 3300046681 Bacteria 2877
202 Ga0495658_0843180 3300046683 Unclassified 586
203 Ga0495613_0040163 3300046689 Bacteria 3468
204 Ga0495581_0539255 3300047315 Unclassified 677
205 Ga0495674_0036531 3300047319 Bacteria 4421
206 Ga0495674_0087779 3300047319 Unclassified 2661
207 Ga0495676_0020354 3300047321 Bacteria 5822
208 Ga0495680_0642469 3300047322 Unclassified 706
209 Ga0495684_0562747 3300047471 Unclassified 774
210 Ga0495614_0052896 3300048089 Bacteria 1741
211 Ga0496112_0536939 3300048915 Bacteria 1104
212 Ga0501034_0384375 3300049571 Bacteria 1328
213 Ga0501039_0512605 3300049575 Bacteria 942
214 Ga0501039_0647233 3300049575 Bacteria 827
215 Ga0501041_0035502 3300049577 Bacteria 3020
216 Ga0501041_0975869 3300049577 Unclassified 545
217 Ga0501042_0140805 3300049578 Bacteria 1739
218 Ga0501043_0659997 3300049579 Bacteria 767
219 Ga0501046_0511291 3300049580 Bacteria 859
220 Ga0501067_0032204 3300049583 Bacteria 2910
221 Ga0501068_0064469 3300049584 Unclassified 2230
222 Ga0501069_0086855 3300049585 Bacteria 1766
223 Ga0501070_1103053 3300049586 Unclassified 612
224 Ga0501071_0372111 3300049587 Unclassified 1089
225 Ga0501072_0217944 3300049588 Bacteria 1521
226 Ga0501072_0875200 3300049588 Bacteria 702
227 Ga0501073_0839469 3300049589 Bacteria 633
228 Ga0501074_0064242 3300049590 Archaea 2643
229 Ga0501074_0253148 3300049590 Bacteria 1252
230 Ga0501075_0029404 3300049591 Bacteria 4064
231 Ga0501076_0171890 3300049592 Bacteria 1766
232 Ga0501076_0250496 3300049592 Bacteria 1449
233 Ga0501077_0603890 3300049593 Bacteria 705
234 Ga0501079_0628538 3300049741 Bacteria 845
235 Ga0501079_1364235 3300049741 Bacteria 558
236 Ga0501080_0222672 3300049742 Bacteria 1726
237 Ga0501080_0467971 3300049742 Bacteria 1129
238 Ga0501081_0201036 3300049743 Bacteria 1445
239 Ga0501083_0821908 3300049744 Bacteria 605
240 Ga0501035_0159179 3300049822 Bacteria 1956
241 Ga0501045_0097052 3300049824 Bacteria 2180
242 nmdc:mga03683_25070_c1 3300050489 Bacteria 2338
243 nmdc:mga03683_27491_c1 3300050489 Bacteria 2253
244 nmdc:mga03n38_230187_c1 3300050490 Bacteria 971
245 nmdc:mga03n38_470006_c1 3300050490 Bacteria 702
246 nmdc:mga03n38_952349_c1 3300050490 Bacteria 507
247 nmdc:mga00v17_139968_c1 3300050491 Bacteria 1551
248 nmdc:mga0yw44_356105_c1 3300050492 Bacteria 986
249 nmdc:mga0k408_535730_c1 3300050493 Bacteria 693
250 nmdc:mga06z11_277674_c1 3300050494 Bacteria 992
251 nmdc:mga06z11_404182_c1 3300050494 Bacteria 822
252 nmdc:mga06z11_63571_c1 3300050494 Bacteria 1931
253 nmdc:mga06z11_95109_c1 3300050494 Bacteria 1625
254 nmdc:mga07m45_83143_c1 3300050496 Bacteria 1829
255 nmdc:mga07m45_93137_c1 3300050496 Bacteria 1727
256 nmdc:mga05p37_1166876_c1 3300050507 Bacteria 799
257 nmdc:mga05p37_293933_c1 3300050507 Bacteria 1933
258 nmdc:mga05p37_47551_c1 3300050507 Bacteria 5276
259 nmdc:mga09592_19535_c1 3300050508 Bacteria 5565
260 nmdc:mga06r32_1234126_c1 3300050510 Unclassified 693
261 nmdc:mga06r32_14451_c1 3300050510 Bacteria 7166
262 nmdc:mga06r32_289758_c1 3300050510 Bacteria 1624
263 nmdc:mga0n895_1564896_c1 3300050512 Bacteria 624
264 nmdc:mga0n895_1705872_c1 3300050512 Bacteria 592
265 nmdc:mga0rr50_1026032_c1 3300050513 Bacteria 702
266 nmdc:mga0rr50_1031463_c1 3300050513 Unclassified 700
267 nmdc:mga0rr50_260022_c1 3300050513 Unclassified 1444
268 nmdc:mga08x19_477590_c1 3300050514 Unclassified 879
269 nmdc:mga0sz30_92923_c1 3300050516 Bacteria 1314
270 Ga0495619_0516301 3300053085 Unclassified 821
271 Ga0500651_0050720 3300053093 Bacteria 2603
272 Ga0500641_0008221 3300053096 Bacteria 3719
273 Ga0500594_0172812 3300053118 Bacteria 702
274 Ga0500588_0109523 3300053146 Unclassified 962
275 Ga0501084_0439914 3300054114 Archaea 1102
276 Ga0501082_0451862 3300060353 Bacteria 1123
277 Ga0501082_0961873 3300060353 Bacteria 747
278 Ga0501082_0968530 3300060353 Bacteria 744
279 Ga0530510_0032978 3300061734 Bacteria 3727
280 Ga0530510_0225579 3300061734 Unclassified 1393
281 Ga0530510_0597558 3300061734 Unclassified 839
282 Ga0495630_0062334
283 SwRhRL2b_contig_2370353
284 Ga0065707_10006779
285 Ga0065707_10279703
286 Ga0065707_10829280
287 Ga0070676_10875714
288 Ga0070676_11240868
289 Ga0070690_100225038
290 Ga0070690_100873276
291 Ga0070690_100943636
292 Ga0070670_100734302
293 Ga0068869_100215085
294 Ga0070666_10869848
295 Ga0070689_100369757
296 Ga0070691_10487015
297 Ga0070661_101072833
298 Ga0070668_100692560
299 Ga0070669_100013774
300 Ga0070675_100270468
301 Ga0070673_101478584
302 Ga0070688_100039675
303 Ga0070688_100908045
304 Ga0070667_102319295
305 Ga0070701_10829465
306 Ga0070700_100620441
307 Ga0070708_100039339
308 Ga0070663_101681760
309 Ga0070662_100156783
310 Ga0070681_10045022
311 Ga0068867_100438630
312 Ga0070685_10847166
313 Ga0070707_100320210
314 Ga0070699_100142816
315 Ga0070697_100712808
316 Ga0070672_100452745
317 Ga0070672_101175528
318 Ga0070686_100303271
319 Ga0070686_100326906
320 Ga0070695_101226157
321 Ga0070695_101770095
322 Ga0070693_101232622
323 Ga0070665_100256781
324 Ga0068855_100105574
325 Ga0070702_100075967
326 Ga0068859_100688451
327 Ga0068864_100723455
328 Ga0068861_101889728
329 Ga0068862_100087129
330 Ga0068862_100597773
331 Ga0081455_10000861
332 Ga0081455_10016096
333 Ga0081455_10034575
334 Ga0081539_10002802
335 Ga0075365_10306417
336 Ga0075368_10185394
337 Ga0075363_100706755
338 Ga0075364_10087184
339 Ga0075432_10379102
340 Ga0075362_10021347
341 Ga0075362_10065539
342 Ga0075362_10214541
343 Ga0075367_10062062
344 Ga0075367_10093093
345 Ga0075367_10127940
346 Ga0075367_10262863
347 Ga0075367_10343485
348 Ga0075367_10596773
349 Ga0075369_10003733
350 Ga0075369_10094800
351 Ga0075369_10402271
352 Ga0075366_10147516
353 Ga0097621_101237520
354 Ga0075370_10100490
355 Ga0075370_10198962
356 Ga0068871_100208106
357 Ga0068871_100682504
358 Ga0075428_100426772
359 Ga0075428_100744104
360 Ga0075428_100899462
361 Ga0075430_100103837
362 Ga0075430_101488918
363 Ga0075431_100000648
364 Ga0075433_10886736
365 Ga0075433_11586921
366 Ga0075434_101474670
367 Ga0075429_100045703
368 Ga0075429_100237348
369 Ga0075436_100065612
370 Ga0097620_100688513
371 Ga0097620_101966665
372 Ga0075435_100239681
373 Ga0075435_101147882
374 Ga0105240_10032946
375 Ga0105240_10101286
376 Ga0105240_10282788
377 Ga0111539_10022829
378 Ga0111539_11354678
379 Ga0114129_10061422
380 Ga0105243_10460659
381 Ga0105243_11381629
382 Ga0105242_12762916
383 Ga0105248_11092547
384 Ga0105248_12758867
385 Ga0105249_10004489
386 Ga0105249_10279926
387 Ga0105249_11516898
388 Ga0105035_115641
389 Ga0099796_10142399
390 Ga0105246_10478812
391 Ga0105246_10607040
392 Ga0157370_10367260
393 Ga0157370_10957568
394 Ga0157370_11644970
395 Ga0157374_12699981
396 Ga0157378_10364242
397 Ga0163162_11716669
398 Ga0157375_10381774
399 Ga0157375_10438100
400 Ga0157375_13120048
401 Ga0163163_12296603
402 Ga0157380_10723720
403 Ga0157376_11051153
404 Ga0206353_10329709
405 Ga0207697_10430705
406 Ga0207680_10629649
407 Ga0207707_10034495
408 Ga0207695_10085746
409 Ga0207695_10289797
410 Ga0207649_11260763
411 Ga0207681_10035646
412 Ga0207659_10976885
413 Ga0207706_10120834
414 Ga0207670_11482886
415 Ga0207691_10065535
416 Ga0207691_11144023
417 Ga0207711_12067172
418 Ga0207689_10183284
419 Ga0207712_10019861
420 Ga0207668_10645187
421 Ga0207668_11216670
422 Ga0207639_10642645
423 Ga0207639_11321414
424 Ga0207678_10483871
425 Ga0207708_10649937
426 Ga0207675_100749062
427 Ga0207683_10414698
428 Ga0209971_1090934
429 Ga0207428_10015853
430 Ga0207428_10345324
431 Ga0268265_10019667
432 Ga0268265_10367232
433 Ga0268264_10727083
434 Ga0316575_10124253
435 Ga0307406_11363060
436 Ga0307416_100759360
437 Ga0307411_10580707
438 Ga0373930_0104834
439 Ga0373939_0500600
440 Ga0373956_0095728
441 Ga0373946_0244971
442 Ga0373961_0163398
443 Ga0316574_0027959
444 Ga0373947_0034496
445 Ga0373937_0284852
446 Ga0373937_0533169
447 Ga0373925_0719822
448 Ga0395905_1017325
449 Ga0395905_1219257
450 Ga0439453_0018441
451 Ga0439465_0202461
452 Ga0439432_250573
453 Ga0439459_0042164
454 Ga0450916_016002
455 Ga0451577_0000536
456 Ga0451577_0611078
457 Ga0451577_1370106
458 Ga0453683_0003123
459 Ga0453683_0038589
460 Ga0453684_0000001
461 Ga0453684_0001218
462 Ga0453684_0216999
463 Ga0451576_0004776
464 Ga0451576_0426869
465 Ga0495617_253582
466 Ga0495653_0951321
467 Ga0495580_0268854
468 Ga0495580_0578978
469 Ga0495639_0060984
470 Ga0495662_0123165
471 Ga0495664_0056420
472 Ga0495608_0194114
473 Ga0495630_0001689
474 Ga0495666_0001614
475 Ga0495586_0001083
476 Ga0495586_0197694
477 Ga0495587_0148922
478 Ga0495587_0162972
479 Ga0495645_0092076
480 Ga0495634_0157519
481 Ga0495599_0082296
482 Ga0495647_0012989
483 Ga0495658_0843180
484 Ga0495613_0040163
485 Ga0495581_0539255
486 Ga0495674_0036531
487 Ga0495674_0087779
488 Ga0495676_0020354
489 Ga0495680_0642469
490 Ga0495684_0562747
491 Ga0495614_0052896
492 Ga0496112_0536939
493 Ga0501034_0384375
494 Ga0501039_0512605
495 Ga0501039_0647233
496 Ga0501041_0035502
497 Ga0501041_0975869
498 Ga0501042_0140805
499 Ga0501043_0659997
500 Ga0501046_0511291
501 Ga0501067_0032204
502 Ga0501068_0064469
503 Ga0501069_0086855
504 Ga0501070_1103053
505 Ga0501071_0372111
506 Ga0501072_0217944
507 Ga0501072_0875200
508 Ga0501073_0839469
509 Ga0501074_0064242
510 Ga0501074_0253148
511 Ga0501075_0029404
512 Ga0501076_0171890
513 Ga0501076_0250496
514 Ga0501077_0603890
515 Ga0501079_0628538
516 Ga0501079_1364235
517 Ga0501080_0222672
518 Ga0501080_0467971
519 Ga0501081_0201036
520 Ga0501083_0821908
521 Ga0501035_0159179
522 Ga0501045_0097052
523 nmdc:mga03683_25070_c1
524 nmdc:mga03683_27491_c1
525 nmdc:mga03n38_230187_c1
526 nmdc:mga03n38_470006_c1
527 nmdc:mga03n38_952349_c1
528 nmdc:mga00v17_139968_c1
529 nmdc:mga0yw44_356105_c1
530 nmdc:mga0k408_535730_c1
531 nmdc:mga06z11_277674_c1
532 nmdc:mga06z11_404182_c1
533 nmdc:mga06z11_63571_c1
534 nmdc:mga06z11_95109_c1
535 nmdc:mga07m45_83143_c1
536 nmdc:mga07m45_93137_c1
537 nmdc:mga05p37_1166876_c1
538 nmdc:mga05p37_293933_c1
539 nmdc:mga05p37_47551_c1
540 nmdc:mga09592_19535_c1
541 nmdc:mga06r32_1234126_c1
542 nmdc:mga06r32_14451_c1
543 nmdc:mga06r32_289758_c1
544 nmdc:mga0n895_1564896_c1
545 nmdc:mga0n895_1705872_c1
546 nmdc:mga0rr50_1026032_c1
547 nmdc:mga0rr50_1031463_c1
548 nmdc:mga0rr50_260022_c1
549 nmdc:mga08x19_477590_c1
550 nmdc:mga0sz30_92923_c1
551 Ga0495619_0516301
552 Ga0500651_0050720
553 Ga0500641_0008221
554 Ga0500594_0172812
555 Ga0500588_0109523
556 Ga0501084_0439914
557 Ga0501082_0451862
558 Ga0501082_0961873
559 Ga0501082_0968530
560 Ga0530510_0032978
561 Ga0530510_0225579
562 Ga0530510_0597558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

20

123

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9203 2 120
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9149 2 120
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8913 2 120
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8412 2 120
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.7883 1 89
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9113 3 120 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8967 3 120 3.30.70.100
5ixuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7274 4 120 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7193 1 118 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7133 1 118 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7V3H9G9-F1-model_v4 DUF1428 domain-containing protein 0.9872 3 119
AF-A0A2A2QDK1-F1-model_v4 RNA signal recognition particle 0.9819 1 120
AF-A0A6N6ZDC4-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9789 2 120
AF-A0A2N3EFM6-F1-model_v4 DUF1428 domain-containing protein 0.9755 3 120
AF-A0A3N5W334-F1-model_v4 DUF1428 domain-containing protein 0.9748 1 120

Map