F384389

General Info

Members Datasets Scaffolds Average Seq Length
281 199 562 184

Family's Representative Sequence

Representative Sequence 3300031595|Ga0265313_10028790|Ga0265313_100287901
Length 200
Sequence MVHHKGVATAMEMTARSLWTMVHGMGFGALYLLACSGAFVELYRRYAPSSSGEVTEGDETFLCAYLIAMAVVAWITVLTGAFIIYPWYRAAAPPGTADLSAFPQMLVKSHPGTSGWHSRGMEWKEHVAWFTPIAATMVSVVFLKYGHRLKGLPQLRAAVLFFTLISFVSAGIAGFFGAMLNKHAPVEGGQRIQLMNREKQ

Samples

Sample ID Description Type Environment
1 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
72 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
87 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
88 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
89 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
90 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
174 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
175 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
176 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
177 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
178 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
179 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
180 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
181 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
182 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
183 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
184 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
185 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
186 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
187 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
188 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
189 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
190 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
191 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
192 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
193 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
194 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
195 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
196 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
197 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
198 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
199 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.97
Metatranscriptomes 0.36
Isolates 10.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 8.54
Rhizoplane 2.14
Rhizosphere 82.21
Stem 0
Stem Tuber 0
Unclassified 18.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265313_10028790 3300031595 Bacteria 2882
2 JGI24737J22298_10070964 3300001990 Bacteria 1040
3 rootH1_10000514 3300003316 Bacteria 4299
4 rootH2_10280945 3300003320 Bacteria 1434
5 Ga0070683_100239107 3300005329 Bacteria 1727
6 Ga0070660_100000049 3300005339 Bacteria 69269
7 Ga0070689_100751533 3300005340 Bacteria 855
8 Ga0070673_100162830 3300005364 Bacteria 1898
9 Ga0070659_100000085 3300005366 Bacteria 70518
10 Ga0070709_10564786 3300005434 Bacteria 872
11 Ga0070714_100749111 3300005435 Bacteria 944
12 Ga0070663_100005863 3300005455 Bacteria 7343
13 Ga0070696_100706047 3300005546 Unclassified 822
14 Ga0068855_100001449 3300005563 Bacteria 29567
15 Ga0068855_101070809 3300005563 Bacteria 844
16 Ga0068856_100370083 3300005614 Bacteria 1452
17 Ga0068856_100624162 3300005614 Unclassified 1099
18 Ga0068852_100018207 3300005616 Bacteria 5530
19 Ga0070717_10800687 3300006028 Unclassified 857
20 Ga0070712_100107225 3300006175 Bacteria 2078
21 Ga0070712_100694007 3300006175 Unclassified 867
22 Ga0075428_100158518 3300006844 Bacteria 2457
23 Ga0075430_100092893 3300006846 Bacteria 2522
24 Ga0075431_100125500 3300006847 Bacteria 2648
25 Ga0075431_100452551 3300006847 Unclassified 1279
26 Ga0075429_100092156 3300006880 Bacteria 2643
27 Ga0105240_10018633 3300009093 Bacteria 9307
28 Ga0105245_10539909 3300009098 Bacteria 1187
29 Ga0105247_10566521 3300009101 Unclassified 837
30 Ga0114129_10005329 3300009147 Bacteria 18156
31 Ga0105237_10009524 3300009545 Bacteria 10402
32 Ga0105238_10005897 3300009551 Bacteria 12134
33 Ga0105239_10011427 3300010375 Bacteria 9901
34 Ga0105239_10036064 3300010375 Bacteria 5430
35 Ga0105239_10458656 3300010375 Bacteria 1446
36 Ga0105246_10828927 3300011119 Unclassified 823
37 Ga0157373_10086110 3300013100 Bacteria 2214
38 Ga0157370_10041978 3300013104 Bacteria 4409
39 Ga0157369_10000059 3300013105 Bacteria 154283
40 Ga0157369_10178462 3300013105 Bacteria 2235
41 Ga0157369_11001149 3300013105 Unclassified 856
42 Ga0157375_10136365 3300013308 Bacteria 2578
43 Ga0157379_10522337 3300014968 Unclassified 1102
44 Ga0182005_1022619 3300015265 Bacteria 1722
45 Ga0207647_10079387 3300025904 Bacteria 1970
46 Ga0207695_10071128 3300025913 Bacteria 3553
47 Ga0207671_10057931 3300025914 Bacteria 2872
48 Ga0207693_10141034 3300025915 Bacteria 1895
49 Ga0207657_10000406 3300025919 Bacteria 45531
50 Ga0207700_10005226 3300025928 Bacteria 7734
51 Ga0207700_10251472 3300025928 Bacteria 1510
52 Ga0207690_10000097 3300025932 Bacteria 71940
53 Ga0207667_10001016 3300025949 Bacteria 35740
54 Ga0207651_10012562 3300025960 Bacteria 4800
55 Ga0207678_10012432 3300026067 Bacteria 7472
56 Ga0207702_10727355 3300026078 Unclassified 979
57 Ga0207698_10016569 3300026142 Bacteria 4973
58 Ga0265318_10024217 3300028577 Unclassified 2411
59 Ga0265318_10109246 3300028577 Bacteria 1017
60 Ga0265338_10001617 3300028800 Bacteria 36047
61 Ga0265338_10271925 3300028800 Unclassified 1241
62 Ga0265338_10272463 3300028800 Bacteria 1240
63 Ga0265330_10000326 3300031235 Bacteria 34208
64 Ga0265330_10010254 3300031235 Bacteria 4423
65 Ga0265330_10107845 3300031235 Bacteria 1191
66 Ga0265328_10025444 3300031239 Unclassified 2230
67 Ga0265320_10089281 3300031240 Unclassified 1429
68 Ga0265325_10001354 3300031241 Bacteria 17356
69 Ga0265325_10016585 3300031241 Bacteria 4116
70 Ga0265325_10028116 3300031241 Bacteria 3034
71 Ga0265325_10083787 3300031241 Bacteria 1581
72 Ga0265340_10009618 3300031247 Bacteria 5182
73 Ga0265340_10056151 3300031247 Bacteria 1895
74 Ga0265339_10013705 3300031249 Unclassified 4907
75 Ga0265339_10043827 3300031249 Unclassified 2471
76 Ga0265339_10185011 3300031249 Bacteria 1036
77 Ga0265331_10129899 3300031250 Unclassified 1150
78 Ga0265316_10007060 3300031344 Bacteria 10635
79 Ga0265316_10047926 3300031344 Bacteria 3378
80 Ga0265316_10109923 3300031344 Bacteria 2088
81 Ga0265316_10223048 3300031344 Unclassified 1390
82 Ga0307408_100547310 3300031548 Bacteria 1021
83 Ga0265313_10001060 3300031595 Bacteria 26699
84 Ga0265313_10067632 3300031595 Bacteria 1652
85 Ga0265313_10102471 3300031595 Bacteria 1269
86 Ga0265313_10213968 3300031595 Unclassified 797
87 Ga0307508_10043533 3300031616 Bacteria 4022
88 Ga0307508_10280982 3300031616 Bacteria 1258
89 Ga0265314_10004281 3300031711 Bacteria 13345
90 Ga0265314_10070219 3300031711 Unclassified 2348
91 Ga0265314_10121542 3300031711 Unclassified 1643
92 Ga0265314_10493513 3300031711 Bacteria 645
93 Ga0265342_10001150 3300031712 Bacteria 25234
94 Ga0265342_10019857 3300031712 Unclassified 4322
95 Ga0265342_10091505 3300031712 Unclassified 1743
96 Ga0265342_10108692 3300031712 Unclassified 1572
97 Ga0307413_10507095 3300031824 Unclassified 970
98 Ga0307406_10286931 3300031901 Unclassified 1258
99 Ga0307406_10649712 3300031901 Unclassified 875
100 Ga0307412_10254689 3300031911 Bacteria 1365
101 Ga0307409_100041571 3300031995 Bacteria 3435
102 Ga0307416_100200496 3300032002 Unclassified 1893
103 Ga0307411_10804803 3300032005 Unclassified 828
104 Ga0307415_100000458 3300032126 Bacteria 17568
105 Ga0307415_100466728 3300032126 Bacteria 1095
106 Ga0307415_100504182 3300032126 Unclassified 1059
107 Ga0307415_100976382 3300032126 Unclassified 786
108 Ga0373926_0029243 3300035083 Bacteria 1936
109 Ga0373944_0028848 3300035089 Bacteria 1654
110 Ga0373923_0435468 3300035111 Unclassified 634
111 Ga0373945_0021260 3300035116 Bacteria 2228
112 Ga0373943_0007247 3300035170 Bacteria 4976
113 Ga0373946_0010075 3300035171 Bacteria 3494
114 Ga0373931_0676529 3300035691 Bacteria 680
115 Ga0373935_0575473 3300035692 Unclassified 822
116 Ga0373927_0025331 3300035695 Bacteria 3877
117 Ga0373927_0054595 3300035695 Bacteria 2584
118 Ga0373927_0260952 3300035695 Bacteria 1139
119 Ga0373933_0641268 3300035724 Bacteria 698
120 Ga0373947_0010570 3300035725 Bacteria 5294
121 Ga0373947_0115210 3300035725 Unclassified 1703
122 Ga0373947_0202748 3300035725 Bacteria 1298
123 Ga0373937_0126158 3300036401 Bacteria 2388
124 Ga0373937_0155203 3300036401 Unclassified 2145
125 Ga0373937_0405115 3300036401 Bacteria 1294
126 Ga0373937_0458984 3300036401 Bacteria 1210
127 Ga0373925_0005804 3300037068 Bacteria 9171
128 Ga0373925_0072139 3300037068 Bacteria 2612
129 Ga0373925_0197241 3300037068 Bacteria 1600
130 Ga0373925_0391475 3300037068 Bacteria 1133
131 Ga0373925_0849154 3300037068 Bacteria 753
132 Ga0373925_1170819 3300037068 Unclassified 632
133 Ga0395901_0136545 3300038443 Bacteria 2577
134 Ga0395901_1477192 3300038443 Archaea 636
135 Ga0436361_0755676 3300039447 Unclassified 586
136 Ga0436363_0239477 3300039450 Bacteria 2704
137 Ga0439443_023342 3300042003 Bacteria 987
138 Ga0439454_009627 3300042011 Bacteria 1258
139 Ga0439463_104218 3300042016 Bacteria 732
140 Ga0439464_0140074 3300042439 Bacteria 753
141 Ga0439440_0017357 3300042993 Bacteria 1584
142 Ga0466966_0046211 3300044684 Bacteria 2780
143 Ga0466961_0228322 3300044693 Bacteria 1146
144 Ga0453684_0648703 3300044712 Bacteria 1152
145 Ga0466959_0041459 3300045049 Bacteria 3398
146 Ga0495592_0227143 3300046454 Unclassified 1245
147 Ga0495629_0383653 3300046459 Unclassified 956
148 Ga0495651_0105900 3300046462 Bacteria 2085
149 Ga0495651_0492262 3300046462 Bacteria 786
150 Ga0495580_0022584 3300046472 Bacteria 4629
151 Ga0495662_0199852 3300046476 Bacteria 985
152 Ga0495664_0080696 3300046477 Unclassified 1950
153 Ga0495664_0717641 3300046477 Unclassified 590
154 Ga0495618_0602144 3300046514 Bacteria 654
155 Ga0495666_0049292 3300046526 Bacteria 2026
156 Ga0495652_0307892 3300046529 Unclassified 1149
157 Ga0495665_0011698 3300046531 Bacteria 4754
158 Ga0495640_0033193 3300046533 Bacteria 3669
159 Ga0495640_0071611 3300046533 Bacteria 2326
160 Ga0495640_0324137 3300046533 Bacteria 954
161 Ga0495645_0021918 3300046543 Bacteria 4620
162 Ga0495634_0106962 3300046642 Bacteria 1802
163 Ga0495635_0026841 3300046663 Bacteria 4006
164 Ga0495635_0214399 3300046663 Bacteria 1303
165 Ga0495623_0004010 3300046679 Bacteria 9690
166 Ga0495623_0108134 3300046679 Bacteria 1688
167 Ga0495646_0241249 3300046680 Unclassified 971
168 Ga0495658_0143851 3300046683 Bacteria 1460
169 Ga0495613_0036749 3300046689 Bacteria 3632
170 Ga0495624_0027001 3300046690 Bacteria 3761
171 Ga0495600_0083271 3300046809 Bacteria 2088
172 Ga0495600_0206762 3300046809 Unclassified 1259
173 Ga0495581_0015003 3300047315 Bacteria 4496
174 Ga0495604_0001030 3300047317 Bacteria 23239
175 Ga0495604_0049294 3300047317 Unclassified 3273
176 Ga0495674_0076938 3300047319 Unclassified 2870
177 Ga0495676_0209432 3300047321 Bacteria 1349
178 Ga0495680_0047122 3300047322 Bacteria 3393
179 Ga0495680_0293121 3300047322 Bacteria 1144
180 Ga0495675_0013446 3300047444 Bacteria 5166
181 Ga0495684_0019809 3300047471 Bacteria 5183
182 Ga0495684_0094359 3300047471 Bacteria 2266
183 Ga0495684_0295269 3300047471 Unclassified 1165
184 Ga0495684_0639082 3300047471 Bacteria 713
185 Ga0495593_0019917 3300047673 Bacteria 3758
186 Ga0495602_0003512 3300048088 Bacteria 16217
187 Ga0495602_0053801 3300048088 Bacteria 3561
188 Ga0496100_0523776 3300048903 Bacteria 915
189 Ga0496102_0745795 3300048905 Bacteria 902
190 Ga0496104_0006791 3300048907 Bacteria 10080
191 Ga0496105_0030760 3300048908 Bacteria 4400
192 Ga0496112_0014200 3300048915 Bacteria 7382
193 Ga0496113_0337778 3300048916 Bacteria 1208
194 Ga0496117_0056228 3300048920 Bacteria 2742
195 Ga0496118_0007390 3300048921 Bacteria 11664
196 Ga0496119_0191094 3300048922 Bacteria 1067
197 Ga0496121_0005275 3300048924 Bacteria 16666
198 Ga0496122_0052076 3300048925 Bacteria 3103
199 Ga0496123_0009639 3300048926 Bacteria 8667
200 Ga0496124_0086857 3300048927 Bacteria 2559
201 Ga0496125_0027067 3300048928 Bacteria 5207
202 Ga0501306_055655 3300049127 Bacteria 643
203 Ga0501032_0253356 3300049569 Bacteria 1142
204 Ga0501034_0971913 3300049571 Bacteria 734
205 Ga0501036_0027291 3300049572 Bacteria 4824
206 Ga0501036_0046852 3300049572 Bacteria 3661
207 Ga0501036_0478117 3300049572 Bacteria 1037
208 Ga0501037_0384348 3300049573 Bacteria 964
209 Ga0501038_0032270 3300049574 Bacteria 4622
210 Ga0501039_0019646 3300049575 Bacteria 5180
211 Ga0501039_0100186 3300049575 Bacteria 2261
212 Ga0501040_0002951 3300049576 Bacteria 11004
213 Ga0501041_0009423 3300049577 Bacteria 5757
214 Ga0501042_0057387 3300049578 Bacteria 2778
215 Ga0501043_0183589 3300049579 Bacteria 1629
216 Ga0501046_0078651 3300049580 Bacteria 2551
217 Ga0501046_0082158 3300049580 Bacteria 2488
218 Ga0501046_0217386 3300049580 Unclassified 1417
219 Ga0501048_0050521 3300049582 Bacteria 2961
220 Ga0501068_0631100 3300049584 Bacteria 699
221 Ga0501070_0112260 3300049586 Bacteria 2253
222 Ga0501071_0071938 3300049587 Bacteria 2521
223 Ga0501072_0032988 3300049588 Bacteria 4056
224 Ga0501072_0097034 3300049588 Bacteria 2342
225 Ga0501075_0043253 3300049591 Bacteria 3378
226 Ga0501076_0007973 3300049592 Bacteria 7730
227 Ga0501077_0035085 3300049593 Bacteria 3193
228 Ga0501077_0037717 3300049593 Bacteria 3077
229 Ga0501257_020749 3300049686 Bacteria 1545
230 Ga0501079_0026046 3300049741 Bacteria 4485
231 Ga0501079_0116700 3300049741 Bacteria 2075
232 Ga0501081_0003243 3300049743 Bacteria 10354
233 Ga0501081_0012532 3300049743 Bacteria 5576
234 Ga0501083_0266502 3300049744 Bacteria 1114
235 Ga0501045_0036111 3300049824 Bacteria 3588
236 Ga0501045_0230912 3300049824 Bacteria 1377
237 nmdc:mga05p37_3570_c1 3300050507 Bacteria 18170
238 nmdc:mga09592_32792_c1 3300050508 Bacteria 4331
239 nmdc:mga0qj67_104284_c1 3300050509 Bacteria 2288
240 nmdc:mga06r32_106347_c1 3300050510 Bacteria 2757
241 nmdc:mga06r32_249949_c1 3300050510 Bacteria 1761
242 Ga0495601_0114640 3300053077 Unclassified 1747
243 Ga0495619_0180204 3300053085 Unclassified 1462
244 Ga0495619_0234014 3300053085 Unclassified 1273
245 Ga0500600_0313440 3300053149 Bacteria 665
246 Ga0501084_0070806 3300054114 Bacteria 2919
247 Ga0501084_0497252 3300054114 Bacteria 1030
248 Ga0501082_0052765 3300060353 Bacteria 3505
249 Ga0501082_0148619 3300060353 Bacteria 2035
250 Ga0530510_0044795 3300061734 Bacteria 3197
251 Ga0530510_0826177 3300061734 Bacteria 707
252 2513555712 2513237082 Bacteria 8640282
253 2513560494 2513237083 Bacteria 8410967
254 2513562779 2513237083 Bacteria 8410967
255 2514054714 2513237166 Bacteria 10373764
256 2597029197 2596583598 Bacteria 5251611
257 2808890848 2808606370 Bacteria 4942454
258 2811848852 2808606982 Bacteria 7791042
259 2812357168 2811994879 Bacteria 9313447
260 2871502107 2871495908 Bacteria 6935695
261 2874125490 2874123672 Bacteria 7238285
262 2874128030 2874123672 Bacteria 7238285
263 2878765998 2878760144 Bacteria 6823465
264 2878773192 2878767105 Bacteria 6898628
265 2881152097 2881147464 Bacteria 7779814
266 2885278896 2885270888 Bacteria 9831543
267 2885316170 2885312484 Bacteria 6415165
268 2903546983 2903540706 Bacteria 7062119
269 2904616440 2904615490 Bacteria 10047340
270 2938000825 2937994558 Bacteria 7036190
271 2958171175 2958165035 Bacteria 6906348
272 2961169604 2961163497 Bacteria 6901077
273 2965024366 2965018300 Bacteria 6883036
274 2968178008 2968171901 Bacteria 6894245
275 2970530237 2970524798 Bacteria 6840927
276 2970544489 2970540015 Bacteria 6977556
277 2970560854 2970554993 Bacteria 6814252
278 2987665765 2987659509 Bacteria 6966464
279 3004194849 3004188549 Bacteria 6952365
280 8003958121 8003955200 Bacteria 8601927
281 8003961278 8003955200 Bacteria 8601927
282 Ga0265313_10028790
283 JGI24737J22298_10070964
284 rootH1_10000514
285 rootH2_10280945
286 Ga0070683_100239107
287 Ga0070660_100000049
288 Ga0070689_100751533
289 Ga0070673_100162830
290 Ga0070659_100000085
291 Ga0070709_10564786
292 Ga0070714_100749111
293 Ga0070663_100005863
294 Ga0070696_100706047
295 Ga0068855_100001449
296 Ga0068855_101070809
297 Ga0068856_100370083
298 Ga0068856_100624162
299 Ga0068852_100018207
300 Ga0070717_10800687
301 Ga0070712_100107225
302 Ga0070712_100694007
303 Ga0075428_100158518
304 Ga0075430_100092893
305 Ga0075431_100125500
306 Ga0075431_100452551
307 Ga0075429_100092156
308 Ga0105240_10018633
309 Ga0105245_10539909
310 Ga0105247_10566521
311 Ga0114129_10005329
312 Ga0105237_10009524
313 Ga0105238_10005897
314 Ga0105239_10011427
315 Ga0105239_10036064
316 Ga0105239_10458656
317 Ga0105246_10828927
318 Ga0157373_10086110
319 Ga0157370_10041978
320 Ga0157369_10000059
321 Ga0157369_10178462
322 Ga0157369_11001149
323 Ga0157375_10136365
324 Ga0157379_10522337
325 Ga0182005_1022619
326 Ga0207647_10079387
327 Ga0207695_10071128
328 Ga0207671_10057931
329 Ga0207693_10141034
330 Ga0207657_10000406
331 Ga0207700_10005226
332 Ga0207700_10251472
333 Ga0207690_10000097
334 Ga0207667_10001016
335 Ga0207651_10012562
336 Ga0207678_10012432
337 Ga0207702_10727355
338 Ga0207698_10016569
339 Ga0265318_10024217
340 Ga0265318_10109246
341 Ga0265338_10001617
342 Ga0265338_10271925
343 Ga0265338_10272463
344 Ga0265330_10000326
345 Ga0265330_10010254
346 Ga0265330_10107845
347 Ga0265328_10025444
348 Ga0265320_10089281
349 Ga0265325_10001354
350 Ga0265325_10016585
351 Ga0265325_10028116
352 Ga0265325_10083787
353 Ga0265340_10009618
354 Ga0265340_10056151
355 Ga0265339_10013705
356 Ga0265339_10043827
357 Ga0265339_10185011
358 Ga0265331_10129899
359 Ga0265316_10007060
360 Ga0265316_10047926
361 Ga0265316_10109923
362 Ga0265316_10223048
363 Ga0307408_100547310
364 Ga0265313_10001060
365 Ga0265313_10067632
366 Ga0265313_10102471
367 Ga0265313_10213968
368 Ga0307508_10043533
369 Ga0307508_10280982
370 Ga0265314_10004281
371 Ga0265314_10070219
372 Ga0265314_10121542
373 Ga0265314_10493513
374 Ga0265342_10001150
375 Ga0265342_10019857
376 Ga0265342_10091505
377 Ga0265342_10108692
378 Ga0307413_10507095
379 Ga0307406_10286931
380 Ga0307406_10649712
381 Ga0307412_10254689
382 Ga0307409_100041571
383 Ga0307416_100200496
384 Ga0307411_10804803
385 Ga0307415_100000458
386 Ga0307415_100466728
387 Ga0307415_100504182
388 Ga0307415_100976382
389 Ga0373926_0029243
390 Ga0373944_0028848
391 Ga0373923_0435468
392 Ga0373945_0021260
393 Ga0373943_0007247
394 Ga0373946_0010075
395 Ga0373931_0676529
396 Ga0373935_0575473
397 Ga0373927_0025331
398 Ga0373927_0054595
399 Ga0373927_0260952
400 Ga0373933_0641268
401 Ga0373947_0010570
402 Ga0373947_0115210
403 Ga0373947_0202748
404 Ga0373937_0126158
405 Ga0373937_0155203
406 Ga0373937_0405115
407 Ga0373937_0458984
408 Ga0373925_0005804
409 Ga0373925_0072139
410 Ga0373925_0197241
411 Ga0373925_0391475
412 Ga0373925_0849154
413 Ga0373925_1170819
414 Ga0395901_0136545
415 Ga0395901_1477192
416 Ga0436361_0755676
417 Ga0436363_0239477
418 Ga0439443_023342
419 Ga0439454_009627
420 Ga0439463_104218
421 Ga0439464_0140074
422 Ga0439440_0017357
423 Ga0466966_0046211
424 Ga0466961_0228322
425 Ga0453684_0648703
426 Ga0466959_0041459
427 Ga0495592_0227143
428 Ga0495629_0383653
429 Ga0495651_0105900
430 Ga0495651_0492262
431 Ga0495580_0022584
432 Ga0495662_0199852
433 Ga0495664_0080696
434 Ga0495664_0717641
435 Ga0495618_0602144
436 Ga0495666_0049292
437 Ga0495652_0307892
438 Ga0495665_0011698
439 Ga0495640_0033193
440 Ga0495640_0071611
441 Ga0495640_0324137
442 Ga0495645_0021918
443 Ga0495634_0106962
444 Ga0495635_0026841
445 Ga0495635_0214399
446 Ga0495623_0004010
447 Ga0495623_0108134
448 Ga0495646_0241249
449 Ga0495658_0143851
450 Ga0495613_0036749
451 Ga0495624_0027001
452 Ga0495600_0083271
453 Ga0495600_0206762
454 Ga0495581_0015003
455 Ga0495604_0001030
456 Ga0495604_0049294
457 Ga0495674_0076938
458 Ga0495676_0209432
459 Ga0495680_0047122
460 Ga0495680_0293121
461 Ga0495675_0013446
462 Ga0495684_0019809
463 Ga0495684_0094359
464 Ga0495684_0295269
465 Ga0495684_0639082
466 Ga0495593_0019917
467 Ga0495602_0003512
468 Ga0495602_0053801
469 Ga0496100_0523776
470 Ga0496102_0745795
471 Ga0496104_0006791
472 Ga0496105_0030760
473 Ga0496112_0014200
474 Ga0496113_0337778
475 Ga0496117_0056228
476 Ga0496118_0007390
477 Ga0496119_0191094
478 Ga0496121_0005275
479 Ga0496122_0052076
480 Ga0496123_0009639
481 Ga0496124_0086857
482 Ga0496125_0027067
483 Ga0501306_055655
484 Ga0501032_0253356
485 Ga0501034_0971913
486 Ga0501036_0027291
487 Ga0501036_0046852
488 Ga0501036_0478117
489 Ga0501037_0384348
490 Ga0501038_0032270
491 Ga0501039_0019646
492 Ga0501039_0100186
493 Ga0501040_0002951
494 Ga0501041_0009423
495 Ga0501042_0057387
496 Ga0501043_0183589
497 Ga0501046_0078651
498 Ga0501046_0082158
499 Ga0501046_0217386
500 Ga0501048_0050521
501 Ga0501068_0631100
502 Ga0501070_0112260
503 Ga0501071_0071938
504 Ga0501072_0032988
505 Ga0501072_0097034
506 Ga0501075_0043253
507 Ga0501076_0007973
508 Ga0501077_0035085
509 Ga0501077_0037717
510 Ga0501257_020749
511 Ga0501079_0026046
512 Ga0501079_0116700
513 Ga0501081_0003243
514 Ga0501081_0012532
515 Ga0501083_0266502
516 Ga0501045_0036111
517 Ga0501045_0230912
518 nmdc:mga05p37_3570_c1
519 nmdc:mga09592_32792_c1
520 nmdc:mga0qj67_104284_c1
521 nmdc:mga06r32_106347_c1
522 nmdc:mga06r32_249949_c1
523 Ga0495601_0114640
524 Ga0495619_0180204
525 Ga0495619_0234014
526 Ga0500600_0313440
527 Ga0501084_0070806
528 Ga0501084_0497252
529 Ga0501082_0052765
530 Ga0501082_0148619
531 Ga0530510_0044795
532 Ga0530510_0826177
533 2513555712
534 2513560494
535 2513562779
536 2514054714
537 2597029197
538 2808890848
539 2811848852
540 2812357168
541 2871502107
542 2874125490
543 2874128030
544 2878765998
545 2878773192
546 2881152097
547 2885278896
548 2885316170
549 2903546983
550 2904616440
551 2938000825
552 2958171175
553 2961169604
554 2965024366
555 2968178008
556 2970530237
557 2970544489
558 2970560854
559 2987665765
560 3004194849
561 8003958121
562 8003961278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.6378 6 176
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.5992 1 177
5l0d-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.596 42 182
3jbk-assembly1.cif.gz_M cryo-em reconstruction of the metavinculin-actin interface 0.579 15 177
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.5786 6 177
ID Description Score Start End Superfamily
af_E9AG81_15_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.725 6 86 1.20.140.150
af_B8A2X5_37_205_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6767 3 74 1.20.140.40
af_A4HUD3_72_214_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6756 4 87 1.20.140.150
af_A0A381MTA7_15_169_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6748 6 92 1.20.140.150
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6537 10 173 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A3N5RP47-F1-model_v4 Uncharacterized protein 0.9695 45 177 GO:0016020
AF-A0A3N5RP47-F1-model_v4 Uncharacterized protein 0.9625 45 177 GO:0016020
AF-A0A7U1Q1B1-F1-model_v4 deleted 0.939 1 188
AF-A0A4R9X226-F1-model_v4 Uncharacterized protein 0.9377 1 188 GO:0016020
AF-A0A1F2T080-F1-model_v4 Uncharacterized protein 0.9339 3 177 GO:0016020

Map