F384166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 170 | 277 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100047687|Ga0068855_1000476877 |
| Length | 332 |
| Sequence | MGLAHPSGMRRRSIGDCRPGLKSHDVPADKNETSITVVSDAMNTTTTPATPSPALDFQPLRSPLPSLDAWTAHFFKAEIPILADTAANLEAMRAHEDDMDANLIGEMVADDPLMTLKILAYSATHRSERRVTDVETVTAAVVVLGISPFFSAFGPEQPVVEDRLAQVEGAPQGLADVLRRAHRAARFAFAFAVHRMDLDAAVIHEAALLHDFAEMLLWCHAPTLALQVRQALEATPGLRSSAAQQGVLGIQLPDLQQALMRAWRLPDLLIRITDDSHADHPSVRNVVLAIRLARHSSHGWENPAIPDDIEELAALLNLSRQATLELVRKVDI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 101 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 106 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 107 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 108 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 113 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 121 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 122 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 123 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 124 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 125 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 128 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 129 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 130 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 147 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 152 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 154 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 155 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 156 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 157 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 161 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 162 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 163 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 164 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 165 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 166 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 167 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 168 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 169 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 170 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.52 |
| Nodule | 0 |
| Rhizoplane | 1.07 |
| Rhizosphere | 73.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10200810 | 3300003320 | Bacteria | 1798 |
| 2 | rootL2_10276934 | 3300003322 | Bacteria | 3506 |
| 3 | Ga0055524_1000177 | 3300003775 | Bacteria | 72445 |
| 4 | Ga0070658_10104881 | 3300005327 | Bacteria | 2339 |
| 5 | Ga0070676_10004416 | 3300005328 | Bacteria | 7397 |
| 6 | Ga0070690_100010771 | 3300005330 | Bacteria | 5332 |
| 7 | Ga0070670_100015843 | 3300005331 | Bacteria | 6469 |
| 8 | Ga0070670_100109396 | 3300005331 | Bacteria | 2381 |
| 9 | Ga0070670_100241212 | 3300005331 | Bacteria | 1574 |
| 10 | Ga0070670_100319028 | 3300005331 | Bacteria | 1361 |
| 11 | Ga0070677_10033434 | 3300005333 | Bacteria | 1980 |
| 12 | Ga0070677_10089543 | 3300005333 | Bacteria | 1335 |
| 13 | Ga0068869_100004127 | 3300005334 | Bacteria | 9008 |
| 14 | Ga0070666_10040034 | 3300005335 | Bacteria | 3126 |
| 15 | Ga0068868_100069276 | 3300005338 | Bacteria | 2811 |
| 16 | Ga0068868_100174278 | 3300005338 | Bacteria | 1782 |
| 17 | Ga0070687_100039509 | 3300005343 | Bacteria | 2371 |
| 18 | Ga0070668_100006518 | 3300005347 | Bacteria | 8653 |
| 19 | Ga0070669_100016694 | 3300005353 | Bacteria | 5240 |
| 20 | Ga0070675_100020218 | 3300005354 | Bacteria | 5312 |
| 21 | Ga0070675_100037488 | 3300005354 | Bacteria | 3949 |
| 22 | Ga0070675_100048285 | 3300005354 | Bacteria | 3489 |
| 23 | Ga0070675_100096256 | 3300005354 | Bacteria | 2487 |
| 24 | Ga0070675_100121806 | 3300005354 | Bacteria | 2216 |
| 25 | Ga0070675_100236334 | 3300005354 | Bacteria | 1596 |
| 26 | Ga0070671_100020884 | 3300005355 | Bacteria | 5342 |
| 27 | Ga0070674_100014252 | 3300005356 | Bacteria | 4939 |
| 28 | Ga0070674_100030364 | 3300005356 | Bacteria | 3570 |
| 29 | Ga0070674_100170913 | 3300005356 | Bacteria | 1657 |
| 30 | Ga0070673_100120817 | 3300005364 | Bacteria | 2185 |
| 31 | Ga0070673_100264851 | 3300005364 | Bacteria | 1503 |
| 32 | Ga0070673_100673808 | 3300005364 | Bacteria | 948 |
| 33 | Ga0070667_100000975 | 3300005367 | Bacteria | 26309 |
| 34 | Ga0070667_100004171 | 3300005367 | Bacteria | 12205 |
| 35 | Ga0070667_100044133 | 3300005367 | Bacteria | 3743 |
| 36 | Ga0070667_100091689 | 3300005367 | Bacteria | 2613 |
| 37 | Ga0070667_100350093 | 3300005367 | Bacteria | 1337 |
| 38 | Ga0070663_100068571 | 3300005455 | Bacteria | 2575 |
| 39 | Ga0070663_100282445 | 3300005455 | Bacteria | 1323 |
| 40 | Ga0070678_100032118 | 3300005456 | Bacteria | 3630 |
| 41 | Ga0070678_100045618 | 3300005456 | Bacteria | 3137 |
| 42 | Ga0070678_100171815 | 3300005456 | Bacteria | 1766 |
| 43 | Ga0070662_100036590 | 3300005457 | Bacteria | 3473 |
| 44 | Ga0070662_100072231 | 3300005457 | Bacteria | 2547 |
| 45 | Ga0070662_100097745 | 3300005457 | Bacteria | 2216 |
| 46 | Ga0068867_100001985 | 3300005459 | Bacteria | 14269 |
| 47 | Ga0068867_100039424 | 3300005459 | Bacteria | 3444 |
| 48 | Ga0070706_100044257 | 3300005467 | Bacteria | 4112 |
| 49 | Ga0068853_100105748 | 3300005539 | Bacteria | 2493 |
| 50 | Ga0070672_100029210 | 3300005543 | Bacteria | 4133 |
| 51 | Ga0070672_100052960 | 3300005543 | Bacteria | 3171 |
| 52 | Ga0070672_100107415 | 3300005543 | Bacteria | 2271 |
| 53 | Ga0070672_100421461 | 3300005543 | Bacteria | 1146 |
| 54 | Ga0070686_100046209 | 3300005544 | Bacteria | 2746 |
| 55 | Ga0070665_100005903 | 3300005548 | Bacteria | 12544 |
| 56 | Ga0068855_100047687 | 3300005563 | Bacteria | 5061 |
| 57 | Ga0068857_100021440 | 3300005577 | Bacteria | 5687 |
| 58 | Ga0068852_100068908 | 3300005616 | Bacteria | 3098 |
| 59 | Ga0068852_100073982 | 3300005616 | Bacteria | 2999 |
| 60 | Ga0068859_100073069 | 3300005617 | Bacteria | 3467 |
| 61 | Ga0068864_100002874 | 3300005618 | Bacteria | 14233 |
| 62 | Ga0068866_10009957 | 3300005718 | Bacteria | 4057 |
| 63 | Ga0068863_100076295 | 3300005841 | Bacteria | 3171 |
| 64 | Ga0068858_100015233 | 3300005842 | Bacteria | 7232 |
| 65 | Ga0068860_100003706 | 3300005843 | Bacteria | 15722 |
| 66 | Ga0068860_100081664 | 3300005843 | Bacteria | 3074 |
| 67 | Ga0075362_10016699 | 3300006177 | Bacteria | 3010 |
| 68 | Ga0075362_10017426 | 3300006177 | Bacteria | 2959 |
| 69 | Ga0075367_10005112 | 3300006178 | Bacteria | 6474 |
| 70 | Ga0075366_10007365 | 3300006195 | Bacteria | 6075 |
| 71 | Ga0075366_10008687 | 3300006195 | Bacteria | 5657 |
| 72 | Ga0075366_10076449 | 3300006195 | Bacteria | 1998 |
| 73 | Ga0075366_10087911 | 3300006195 | Bacteria | 1861 |
| 74 | Ga0075366_10120264 | 3300006195 | Bacteria | 1583 |
| 75 | Ga0075366_10239416 | 3300006195 | Bacteria | 1106 |
| 76 | Ga0075366_10246066 | 3300006195 | Bacteria | 1090 |
| 77 | Ga0075370_10011071 | 3300006353 | Bacteria | 4730 |
| 78 | Ga0075370_10012199 | 3300006353 | Bacteria | 4535 |
| 79 | Ga0075370_10060422 | 3300006353 | Bacteria | 2159 |
| 80 | Ga0075429_100005450 | 3300006880 | Bacteria | 10959 |
| 81 | Ga0068865_100040344 | 3300006881 | Bacteria | 3171 |
| 82 | Ga0097620_100073059 | 3300006931 | Bacteria | 3467 |
| 83 | Ga0105245_10085840 | 3300009098 | Bacteria | 2886 |
| 84 | Ga0114129_10038970 | 3300009147 | Bacteria | 6699 |
| 85 | Ga0105243_10006936 | 3300009148 | Bacteria | 8723 |
| 86 | Ga0105243_10044534 | 3300009148 | Bacteria | 3482 |
| 87 | Ga0105242_10426001 | 3300009176 | Bacteria | 1245 |
| 88 | Ga0105248_10094328 | 3300009177 | Bacteria | 3370 |
| 89 | Ga0105248_10371048 | 3300009177 | Bacteria | 1611 |
| 90 | Ga0105249_10038415 | 3300009553 | Bacteria | 4344 |
| 91 | Ga0105246_10371369 | 3300011119 | Bacteria | 1179 |
| 92 | Ga0163162_10036592 | 3300013306 | Bacteria | 4894 |
| 93 | Ga0157375_10007862 | 3300013308 | Bacteria | 9332 |
| 94 | Ga0157375_10087254 | 3300013308 | Bacteria | 3172 |
| 95 | Ga0157375_10393605 | 3300013308 | Bacteria | 1552 |
| 96 | Ga0157380_10002399 | 3300014326 | Bacteria | 12601 |
| 97 | Ga0157377_10000021 | 3300014745 | Bacteria | 147105 |
| 98 | Ga0157379_10037880 | 3300014968 | Bacteria | 4301 |
| 99 | Ga0157376_10860723 | 3300014969 | Bacteria | 922 |
| 100 | Ga0163161_10020214 | 3300017792 | Bacteria | 4671 |
| 101 | Ga0209675_1024798 | 3300025291 | Bacteria | 1525 |
| 102 | Ga0207682_10005552 | 3300025893 | Bacteria | 5134 |
| 103 | Ga0207642_10004712 | 3300025899 | Bacteria | 4407 |
| 104 | Ga0207680_10048205 | 3300025903 | Bacteria | 2529 |
| 105 | Ga0207645_10014853 | 3300025907 | Bacteria | 5196 |
| 106 | Ga0207645_10045289 | 3300025907 | Bacteria | 2812 |
| 107 | Ga0207645_10090254 | 3300025907 | Bacteria | 1970 |
| 108 | Ga0207645_10113123 | 3300025907 | Bacteria | 1758 |
| 109 | Ga0207705_10212149 | 3300025909 | Bacteria | 1469 |
| 110 | Ga0207684_10033416 | 3300025910 | Bacteria | 4374 |
| 111 | Ga0207662_10065583 | 3300025918 | Bacteria | 2186 |
| 112 | Ga0207681_10008284 | 3300025923 | Bacteria | 6356 |
| 113 | Ga0207681_10287720 | 3300025923 | Bacteria | 1296 |
| 114 | Ga0207650_10003035 | 3300025925 | Bacteria | 11563 |
| 115 | Ga0207650_10084728 | 3300025925 | Bacteria | 2410 |
| 116 | Ga0207650_10105535 | 3300025925 | Bacteria | 2175 |
| 117 | Ga0207659_10016769 | 3300025926 | Bacteria | 4774 |
| 118 | Ga0207659_10021453 | 3300025926 | Bacteria | 4287 |
| 119 | Ga0207659_10066675 | 3300025926 | Bacteria | 2613 |
| 120 | Ga0207659_10143457 | 3300025926 | Bacteria | 1856 |
| 121 | Ga0207659_10319213 | 3300025926 | Bacteria | 1281 |
| 122 | Ga0207644_10114821 | 3300025931 | Bacteria | 2041 |
| 123 | Ga0207706_10037340 | 3300025933 | Bacteria | 4314 |
| 124 | Ga0207706_10301338 | 3300025933 | Bacteria | 1396 |
| 125 | Ga0207709_10002256 | 3300025935 | Bacteria | 12257 |
| 126 | Ga0207709_10030306 | 3300025935 | Bacteria | 3146 |
| 127 | Ga0207669_10041683 | 3300025937 | Bacteria | 2674 |
| 128 | Ga0207691_10004162 | 3300025940 | Bacteria | 14056 |
| 129 | Ga0207691_10071435 | 3300025940 | Bacteria | 3132 |
| 130 | Ga0207691_10074458 | 3300025940 | Bacteria | 3062 |
| 131 | Ga0207691_10137810 | 3300025940 | Bacteria | 2152 |
| 132 | Ga0207711_10225300 | 3300025941 | Bacteria | 1716 |
| 133 | Ga0207689_10024283 | 3300025942 | Bacteria | 5087 |
| 134 | Ga0207679_10291196 | 3300025945 | Bacteria | 1404 |
| 135 | Ga0207651_10020525 | 3300025960 | Bacteria | 3990 |
| 136 | Ga0207712_10027752 | 3300025961 | Bacteria | 3782 |
| 137 | Ga0207668_10010018 | 3300025972 | Bacteria | 5704 |
| 138 | Ga0207640_10276983 | 3300025981 | Bacteria | 1316 |
| 139 | Ga0207658_10004344 | 3300025986 | Bacteria | 9860 |
| 140 | Ga0207658_10069660 | 3300025986 | Bacteria | 2658 |
| 141 | Ga0207677_10018601 | 3300026023 | Bacteria | 4173 |
| 142 | Ga0207677_10065032 | 3300026023 | Bacteria | 2543 |
| 143 | Ga0207677_10184347 | 3300026023 | Bacteria | 1645 |
| 144 | Ga0207703_10005289 | 3300026035 | Bacteria | 10407 |
| 145 | Ga0207678_10035571 | 3300026067 | Bacteria | 4336 |
| 146 | Ga0207641_10011024 | 3300026088 | Bacteria | 7413 |
| 147 | Ga0207648_10002131 | 3300026089 | Bacteria | 21529 |
| 148 | Ga0207648_10007595 | 3300026089 | Bacteria | 10633 |
| 149 | Ga0207648_10066618 | 3300026089 | Bacteria | 3141 |
| 150 | Ga0207676_10078901 | 3300026095 | Bacteria | 2668 |
| 151 | Ga0207674_10015349 | 3300026116 | Bacteria | 8417 |
| 152 | Ga0207683_10025332 | 3300026121 | Bacteria | 5117 |
| 153 | Ga0207683_10071748 | 3300026121 | Bacteria | 3062 |
| 154 | Ga0207683_10089419 | 3300026121 | Bacteria | 2741 |
| 155 | Ga0207683_10101861 | 3300026121 | Bacteria | 2564 |
| 156 | Ga0209974_10001465 | 3300027876 | Bacteria | 8559 |
| 157 | Ga0268266_10032674 | 3300028379 | Bacteria | 4421 |
| 158 | Ga0268264_10009546 | 3300028381 | Bacteria | 8038 |
| 159 | Ga0307517_10006619 | 3300028786 | Bacteria | 17080 |
| 160 | Ga0307515_10002435 | 3300028794 | Bacteria | 40544 |
| 161 | Ga0307515_10003433 | 3300028794 | Bacteria | 33339 |
| 162 | Ga0307515_10007780 | 3300028794 | Bacteria | 21086 |
| 163 | Ga0307515_10022234 | 3300028794 | Bacteria | 11185 |
| 164 | Ga0307515_10117256 | 3300028794 | Bacteria | 3049 |
| 165 | Ga0307515_10220504 | 3300028794 | Bacteria | 1716 |
| 166 | Ga0307515_10231039 | 3300028794 | Bacteria | 1642 |
| 167 | Ga0307512_10009073 | 3300030522 | Bacteria | 9621 |
| 168 | Ga0307512_10026236 | 3300030522 | Bacteria | 5148 |
| 169 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 170 | Ga0307513_10008816 | 3300031456 | Bacteria | 12841 |
| 171 | Ga0307513_10009449 | 3300031456 | Bacteria | 12333 |
| 172 | Ga0307513_10010890 | 3300031456 | Bacteria | 11357 |
| 173 | Ga0307513_10132515 | 3300031456 | Bacteria | 2435 |
| 174 | Ga0307509_10006623 | 3300031507 | Bacteria | 15481 |
| 175 | Ga0307509_10010275 | 3300031507 | Bacteria | 11503 |
| 176 | Ga0307509_10024131 | 3300031507 | Bacteria | 6815 |
| 177 | Ga0307509_10119111 | 3300031507 | Bacteria | 2622 |
| 178 | Ga0307408_100090608 | 3300031548 | Bacteria | 2308 |
| 179 | Ga0307508_10000296 | 3300031616 | Bacteria | 60826 |
| 180 | Ga0307508_10001204 | 3300031616 | Bacteria | 29689 |
| 181 | Ga0307508_10061029 | 3300031616 | Bacteria | 3332 |
| 182 | Ga0307514_10024322 | 3300031649 | Bacteria | 4906 |
| 183 | Ga0307514_10058742 | 3300031649 | Bacteria | 2941 |
| 184 | Ga0307516_10001808 | 3300031730 | Bacteria | 29384 |
| 185 | Ga0307516_10005185 | 3300031730 | Bacteria | 15701 |
| 186 | Ga0307405_10252045 | 3300031731 | Bacteria | 1314 |
| 187 | Ga0307410_10127505 | 3300031852 | Bacteria | 1865 |
| 188 | Ga0307412_10114159 | 3300031911 | Bacteria | 1934 |
| 189 | Ga0307412_10377934 | 3300031911 | Bacteria | 1146 |
| 190 | Ga0307411_10374632 | 3300032005 | Bacteria | 1169 |
| 191 | Ga0307507_10024690 | 3300033179 | Bacteria | 6540 |
| 192 | Ga0307507_10070098 | 3300033179 | Bacteria | 3183 |
| 193 | Ga0307510_10020555 | 3300033180 | Bacteria | 7713 |
| 194 | Ga0307510_10047358 | 3300033180 | Bacteria | 4608 |
| 195 | Ga0307510_10113493 | 3300033180 | Bacteria | 2443 |
| 196 | Ga0373937_0271958 | 3300036401 | Bacteria | 1599 |
| 197 | Ga0395900_0001686 | 3300037418 | Bacteria | 25712 |
| 198 | Ga0395898_0002642 | 3300037466 | Bacteria | 20848 |
| 199 | Ga0451787_015381 | 3300041441 | Bacteria | 1026 |
| 200 | Ga0451853_4053387 | 3300041512 | Bacteria | 1396 |
| 201 | Ga0466969_0002962 | 3300044656 | Bacteria | 9066 |
| 202 | Ga0466969_0016300 | 3300044656 | Bacteria | 3892 |
| 203 | Ga0466969_0045932 | 3300044656 | Bacteria | 2166 |
| 204 | Ga0466972_0049068 | 3300044658 | Bacteria | 2039 |
| 205 | Ga0466965_0139751 | 3300044683 | Bacteria | 1260 |
| 206 | Ga0466966_0028110 | 3300044684 | Bacteria | 3664 |
| 207 | Ga0466966_0032885 | 3300044684 | Bacteria | 3357 |
| 208 | Ga0466966_0123574 | 3300044684 | Bacteria | 1588 |
| 209 | Ga0466961_0016026 | 3300044693 | Bacteria | 4811 |
| 210 | Ga0466961_0024950 | 3300044693 | Bacteria | 3846 |
| 211 | Ga0466963_0005488 | 3300044694 | Bacteria | 7424 |
| 212 | Ga0466964_0022430 | 3300044706 | Bacteria | 2449 |
| 213 | Ga0453684_0009499 | 3300044712 | Bacteria | 17005 |
| 214 | Ga0466971_0013249 | 3300044719 | Bacteria | 3618 |
| 215 | Ga0466971_0048965 | 3300044719 | Bacteria | 1900 |
| 216 | Ga0466971_0101331 | 3300044719 | Bacteria | 1324 |
| 217 | Ga0466970_0039370 | 3300044765 | Bacteria | 2508 |
| 218 | Ga0466970_0052008 | 3300044765 | Bacteria | 2187 |
| 219 | Ga0466970_0149075 | 3300044765 | Bacteria | 1291 |
| 220 | Ga0466957_0056678 | 3300044842 | Bacteria | 2396 |
| 221 | Ga0466960_0059170 | 3300044901 | Bacteria | 1873 |
| 222 | Ga0466959_0001418 | 3300045049 | Bacteria | 14666 |
| 223 | Ga0466959_0043459 | 3300045049 | Bacteria | 3312 |
| 224 | Ga0466959_0144435 | 3300045049 | Bacteria | 1679 |
| 225 | Ga0451576_0165387 | 3300045051 | Bacteria | 2308 |
| 226 | Ga0451576_0271505 | 3300045051 | Bacteria | 1773 |
| 227 | Ga0466958_0155240 | 3300045836 | Bacteria | 1444 |
| 228 | Ga0466967_0056175 | 3300045976 | Bacteria | 3470 |
| 229 | Ga0466967_0327806 | 3300045976 | Bacteria | 1478 |
| 230 | Ga0495592_0002694 | 3300046454 | Bacteria | 12565 |
| 231 | Ga0495610_0018904 | 3300046512 | Bacteria | 3874 |
| 232 | Ga0495610_0044852 | 3300046512 | Bacteria | 2192 |
| 233 | Ga0495620_0088415 | 3300046515 | Bacteria | 1245 |
| 234 | Ga0495632_0040420 | 3300046519 | Bacteria | 2349 |
| 235 | Ga0495643_0026737 | 3300046522 | Bacteria | 3251 |
| 236 | Ga0495625_0014620 | 3300046660 | Bacteria | 6254 |
| 237 | Ga0495647_0012684 | 3300046681 | Bacteria | 2907 |
| 238 | Ga0495658_0053960 | 3300046683 | Bacteria | 2285 |
| 239 | Ga0495658_0105704 | 3300046683 | Bacteria | 1686 |
| 240 | Ga0495686_0009871 | 3300047472 | Bacteria | 6840 |
| 241 | Ga0496106_0111760 | 3300048909 | Bacteria | 2128 |
| 242 | Ga0496112_0323349 | 3300048915 | Bacteria | 1487 |
| 243 | Ga0501298_028408 | 3300049521 | Bacteria | 1085 |
| 244 | Ga0501043_0000572 | 3300049579 | Bacteria | 32900 |
| 245 | Ga0501046_0000843 | 3300049580 | Bacteria | 29885 |
| 246 | Ga0501047_0000906 | 3300049581 | Bacteria | 30269 |
| 247 | Ga0501048_0001003 | 3300049582 | Bacteria | 21059 |
| 248 | Ga0501265_001463 | 3300049762 | Bacteria | 2661 |
| 249 | Ga0501045_0007135 | 3300049824 | Bacteria | 7752 |
| 250 | nmdc:mga03683_194992_c1 | 3300050489 | Bacteria | 928 |
| 251 | nmdc:mga0k408_117900_c1 | 3300050493 | Bacteria | 1571 |
| 252 | nmdc:mga0k408_183836_c1 | 3300050493 | Bacteria | 1247 |
| 253 | nmdc:mga0k408_20983_c1 | 3300050493 | Bacteria | 3666 |
| 254 | nmdc:mga0k408_233_c1 | 3300050493 | Bacteria | 29837 |
| 255 | nmdc:mga0k408_27439_c1 | 3300050493 | Bacteria | 3234 |
| 256 | nmdc:mga0k408_7434_c1 | 3300050493 | Bacteria | 1861 |
| 257 | nmdc:mga06z11_226840_c1 | 3300050494 | Bacteria | 1093 |
| 258 | nmdc:mga07m45_22415_c1 | 3300050496 | Bacteria | 3448 |
| 259 | nmdc:mga07m45_36911_c1 | 3300050496 | Bacteria | 2724 |
| 260 | nmdc:mga07m45_56109_c1 | 3300050496 | Bacteria | 2226 |
| 261 | nmdc:mga05p37_96190_c1 | 3300050507 | Bacteria | 3648 |
| 262 | nmdc:mga09592_8600_c1 | 3300050508 | Bacteria | 8305 |
| 263 | Ga0495612_0109575 | 3300053078 | Bacteria | 1181 |
| 264 | Ga0500644_0003125 | 3300053088 | Bacteria | 4099 |
| 265 | Ga0500651_0078854 | 3300053093 | Bacteria | 2042 |
| 266 | Ga0500593_000589 | 3300053117 | Bacteria | 13970 |
| 267 | Ga0500607_051038 | 3300053121 | Bacteria | 2201 |
| 268 | Ga0500559_0000176 | 3300053136 | Bacteria | 50699 |
| 269 | Ga0500559_0127854 | 3300053136 | Unclassified | 1186 |
| 270 | Ga0500619_000342 | 3300053154 | Bacteria | 8851 |
| 271 | Ga0500622_0003533 | 3300053156 | Bacteria | 10355 |
| 272 | Ga0500636_0032308 | 3300053177 | Bacteria | 3098 |
| 273 | Ga0500645_019513 | 3300053730 | Bacteria | 2108 |
| 274 | Ga0500587_001383 | 3300053739 | Bacteria | 3423 |
| 275 | Ga0500587_008478 | 3300053739 | Bacteria | 1321 |
| 276 | Ga0466962_0003825 | 3300061719 | Bacteria | 7195 |
| 277 | Ga0466962_0017795 | 3300061719 | Bacteria | 3420 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049521 | Ga0501298_028408 | Ga0501298_028408_23_757 | 243 |
| 2 | 3300028794 | Ga0307515_10002435 | Ga0307515_1000243543 | 250 |
| 3 | 3300045049 | Ga0466959_0144435 | Ga0466959_0144435_878_1651 | 250 |
| 4 | 3300006195 | Ga0075366_10087911 | Ga0075366_100879112 | 256 |
| 5 | 3300006353 | Ga0075370_10060422 | Ga0075370_100604222 | 256 |
| 6 | 3300025907 | Ga0207645_10045289 | Ga0207645_100452892 | 256 |
| 7 | 3300025923 | Ga0207681_10287720 | Ga0207681_102877202 | 256 |
| 8 | 3300025925 | Ga0207650_10084728 | Ga0207650_100847283 | 256 |
| 9 | 3300025926 | Ga0207659_10016769 | Ga0207659_100167692 | 256 |
| 10 | 3300025931 | Ga0207644_10114821 | Ga0207644_101148212 | 256 |
| 11 | 3300025935 | Ga0207709_10030306 | Ga0207709_100303063 | 256 |
| 12 | 3300026023 | Ga0207677_10018601 | Ga0207677_100186012 | 256 |
| 13 | 3300026089 | Ga0207648_10007595 | Ga0207648_100075958 | 256 |
| 14 | 3300026116 | Ga0207674_10015349 | Ga0207674_100153498 | 256 |
| 15 | 3300044683 | Ga0466965_0139751 | Ga0466965_0139751_301_1074 | 257 |
| 16 | 3300031548 | Ga0307408_100090608 | Ga0307408_1000906081 | 261 |
| 17 | 3300050494 | nmdc:mga06z11_226840_c1 | nmdc:mga06z11_226840_c1_15_800 | 261 |
| 18 | 3300025981 | Ga0207640_10276983 | Ga0207640_102769832 | 266 |
| 19 | 3300041441 | Ga0451787_015381 | Ga0451787_015381_165_1010 | 266 |
| 20 | 3300003322 | rootL2_10276934 | rootL2_102769344 | 268 |
| 21 | 3300045049 | Ga0466959_0043459 | Ga0466959_0043459_1242_2051 | 268 |
| 22 | 3300046515 | Ga0495620_0088415 | Ga0495620_0088415_415_1221 | 268 |
| 23 | 3300005328 | Ga0070676_10004416 | Ga0070676_100044163 | 269 |
| 24 | 3300005331 | Ga0070670_100015843 | Ga0070670_1000158437 | 269 |
| 25 | 3300005338 | Ga0068868_100069276 | Ga0068868_1000692762 | 269 |
| 26 | 3300005354 | Ga0070675_100236334 | Ga0070675_1002363341 | 269 |
| 27 | 3300005355 | Ga0070671_100020884 | Ga0070671_1000208847 | 269 |
| 28 | 3300005367 | Ga0070667_100350093 | Ga0070667_1003500931 | 269 |
| 29 | 3300005456 | Ga0070678_100171815 | Ga0070678_1001718151 | 269 |
| 30 | 3300005457 | Ga0070662_100097745 | Ga0070662_1000977452 | 269 |
| 31 | 3300005459 | Ga0068867_100001985 | Ga0068867_1000019856 | 269 |
| 32 | 3300005577 | Ga0068857_100021440 | Ga0068857_1000214405 | 269 |
| 33 | 3300009098 | Ga0105245_10085840 | Ga0105245_100858402 | 269 |
| 34 | 3300009148 | Ga0105243_10044534 | Ga0105243_100445343 | 269 |
| 35 | 3300013308 | Ga0157375_10007862 | Ga0157375_100078627 | 269 |
| 36 | 3300050493 | nmdc:mga0k408_7434_c1 | nmdc:mga0k408_7434_c1_819_1664 | 269 |
| 37 | 3300050496 | nmdc:mga07m45_56109_c1 | nmdc:mga07m45_56109_c1_647_1492 | 269 |
| 38 | 3300031911 | Ga0307412_10377934 | Ga0307412_103779341 | 270 |
| 39 | 3300006177 | Ga0075362_10016699 | Ga0075362_100166993 | 271 |
| 40 | 3300006195 | Ga0075366_10008687 | Ga0075366_100086875 | 271 |
| 41 | 3300037418 | Ga0395900_0001686 | Ga0395900_0001686_17201_18049 | 271 |
| 42 | 3300037466 | Ga0395898_0002642 | Ga0395898_0002642_7170_8018 | 271 |
| 43 | 3300050489 | nmdc:mga03683_194992_c1 | nmdc:mga03683_194992_c1_14_853 | 271 |
| 44 | 3300050493 | nmdc:mga0k408_233_c1 | nmdc:mga0k408_233_c1_10549_11388 | 271 |
| 45 | 3300053136 | Ga0500559_0127854 | Ga0500559_0127854_251_1108 | 271 |
| 46 | 3300053154 | Ga0500619_000342 | Ga0500619_000342_1230_2087 | 271 |
| 47 | 3300005333 | Ga0070677_10033434 | Ga0070677_100334341 | 273 |
| 48 | 3300005354 | Ga0070675_100048285 | Ga0070675_1000482855 | 273 |
| 49 | 3300005543 | Ga0070672_100029210 | Ga0070672_1000292101 | 273 |
| 50 | 3300025907 | Ga0207645_10113123 | Ga0207645_101131233 | 273 |
| 51 | 3300025940 | Ga0207691_10004162 | Ga0207691_100041623 | 273 |
| 52 | 3300026121 | Ga0207683_10101861 | Ga0207683_101018613 | 273 |
| 53 | 3300031507 | Ga0307509_10119111 | Ga0307509_101191113 | 273 |
| 54 | 3300031730 | Ga0307516_10001808 | Ga0307516_1000180824 | 273 |
| 55 | 3300041512 | Ga0451853_4053387 | Ga0451853_4053387_211_1059 | 273 |
| 56 | iso_pu_bacteria | 2585428057 | 2587727973 | 273 |
| 57 | 3300005843 | Ga0068860_100081664 | Ga0068860_1000816642 | 274 |
| 58 | 3300044656 | Ga0466969_0016300 | Ga0466969_0016300_1060_1908 | 274 |
| 59 | 3300044684 | Ga0466966_0028110 | Ga0466966_0028110_1596_2444 | 274 |
| 60 | 3300044693 | Ga0466961_0016026 | Ga0466961_0016026_1033_1881 | 274 |
| 61 | 3300044719 | Ga0466971_0013249 | Ga0466971_0013249_2310_3158 | 274 |
| 62 | 3300044765 | Ga0466970_0149075 | Ga0466970_0149075_328_1176 | 274 |
| 63 | 3300045976 | Ga0466967_0327806 | Ga0466967_0327806_254_1102 | 274 |
| 64 | 3300047472 | Ga0495686_0009871 | Ga0495686_0009871_2098_2922 | 274 |
| 65 | 3300061719 | Ga0466962_0003825 | Ga0466962_0003825_551_1399 | 274 |
| 66 | 3300006178 | Ga0075367_10005112 | Ga0075367_100051127 | 275 |
| 67 | 3300006353 | Ga0075370_10012199 | Ga0075370_100121994 | 275 |
| 68 | iso_pu_bacteria | 2643221654 | 2644303463 | 275 |
| 69 | 3300005467 | Ga0070706_100044257 | Ga0070706_1000442573 | 276 |
| 70 | 3300009148 | Ga0105243_10006936 | Ga0105243_1000693610 | 276 |
| 71 | 3300014745 | Ga0157377_10000021 | Ga0157377_10000021137 | 276 |
| 72 | 3300025910 | Ga0207684_10033416 | Ga0207684_100334162 | 276 |
| 73 | 3300025935 | Ga0207709_10002256 | Ga0207709_1000225610 | 276 |
| 74 | 3300026089 | Ga0207648_10002131 | Ga0207648_1000213113 | 276 |
| 75 | 3300026121 | Ga0207683_10089419 | Ga0207683_100894194 | 276 |
| 76 | 3300031911 | Ga0307412_10114159 | Ga0307412_101141592 | 276 |
| 77 | 3300049579 | Ga0501043_0000572 | Ga0501043_0000572_9734_10567 | 276 |
| 78 | 3300049580 | Ga0501046_0000843 | Ga0501046_0000843_23447_24280 | 276 |
| 79 | 3300049581 | Ga0501047_0000906 | Ga0501047_0000906_22384_23217 | 276 |
| 80 | 3300049582 | Ga0501048_0001003 | Ga0501048_0001003_19518_20351 | 276 |
| 81 | 3300049762 | Ga0501265_001463 | Ga0501265_001463_765_1601 | 276 |
| 82 | 3300049824 | Ga0501045_0007135 | Ga0501045_0007135_3689_4522 | 276 |
| 83 | 3300053078 | Ga0495612_0109575 | Ga0495612_0109575_252_1085 | 276 |
| 84 | 3300005455 | Ga0070663_100282445 | Ga0070663_1002824451 | 277 |
| 85 | 3300031649 | Ga0307514_10058742 | Ga0307514_100587422 | 277 |
| 86 | 3300050508 | nmdc:mga09592_8600_c1 | nmdc:mga09592_8600_c1_1308_2141 | 277 |
| 87 | iso_pu_bacteria | 2585428062 | 2587758901 | 277 |
| 88 | 3300005364 | Ga0070673_100673808 | Ga0070673_1006738081 | 278 |
| 89 | 3300005367 | Ga0070667_100091689 | Ga0070667_1000916892 | 278 |
| 90 | 3300006195 | Ga0075366_10007365 | Ga0075366_100073653 | 278 |
| 91 | 3300006195 | Ga0075366_10076449 | Ga0075366_100764492 | 278 |
| 92 | 3300006353 | Ga0075370_10011071 | Ga0075370_100110716 | 278 |
| 93 | 3300030522 | Ga0307512_10009073 | Ga0307512_100090733 | 278 |
| 94 | 3300031507 | Ga0307509_10006623 | Ga0307509_1000662310 | 278 |
| 95 | 3300033180 | Ga0307510_10020555 | Ga0307510_100205557 | 278 |
| 96 | 3300036401 | Ga0373937_0271958 | Ga0373937_0271958_96_935 | 278 |
| 97 | 3300044656 | Ga0466969_0045932 | Ga0466969_0045932_846_1691 | 278 |
| 98 | 3300044684 | Ga0466966_0123574 | Ga0466966_0123574_34_879 | 278 |
| 99 | 3300044693 | Ga0466961_0024950 | Ga0466961_0024950_2319_3164 | 278 |
| 100 | 3300044694 | Ga0466963_0005488 | Ga0466963_0005488_3112_3957 | 278 |
| 101 | 3300044706 | Ga0466964_0022430 | Ga0466964_0022430_161_1006 | 278 |
| 102 | 3300044712 | Ga0453684_0009499 | Ga0453684_0009499_9725_10567 | 278 |
| 103 | 3300044719 | Ga0466971_0048965 | Ga0466971_0048965_364_1209 | 278 |
| 104 | 3300044765 | Ga0466970_0039370 | Ga0466970_0039370_337_1182 | 278 |
| 105 | 3300044842 | Ga0466957_0056678 | Ga0466957_0056678_599_1444 | 278 |
| 106 | 3300045049 | Ga0466959_0001418 | Ga0466959_0001418_8650_9495 | 278 |
| 107 | 3300045051 | Ga0451576_0271505 | Ga0451576_0271505_701_1540 | 278 |
| 108 | 3300045836 | Ga0466958_0155240 | Ga0466958_0155240_189_1034 | 278 |
| 109 | 3300045976 | Ga0466967_0056175 | Ga0466967_0056175_1207_2052 | 278 |
| 110 | 3300046454 | Ga0495592_0002694 | Ga0495592_0002694_7676_8518 | 278 |
| 111 | 3300048915 | Ga0496112_0323349 | Ga0496112_0323349_300_1142 | 278 |
| 112 | 3300050493 | nmdc:mga0k408_27439_c1 | nmdc:mga0k408_27439_c1_257_1102 | 278 |
| 113 | 3300050496 | nmdc:mga07m45_36911_c1 | nmdc:mga07m45_36911_c1_1672_2538 | 278 |
| 114 | 3300061719 | Ga0466962_0017795 | Ga0466962_0017795_2536_3381 | 278 |
| 115 | 3300005327 | Ga0070658_10104881 | Ga0070658_101048812 | 279 |
| 116 | 3300005331 | Ga0070670_100241212 | Ga0070670_1002412121 | 279 |
| 117 | 3300005331 | Ga0070670_100319028 | Ga0070670_1003190282 | 279 |
| 118 | 3300005338 | Ga0068868_100174278 | Ga0068868_1001742782 | 279 |
| 119 | 3300005354 | Ga0070675_100121806 | Ga0070675_1001218062 | 279 |
| 120 | 3300005364 | Ga0070673_100264851 | Ga0070673_1002648512 | 279 |
| 121 | 3300005367 | Ga0070667_100000975 | Ga0070667_1000009754 | 279 |
| 122 | 3300005367 | Ga0070667_100044133 | Ga0070667_1000441332 | 279 |
| 123 | 3300005457 | Ga0070662_100072231 | Ga0070662_1000722312 | 279 |
| 124 | 3300005548 | Ga0070665_100005903 | Ga0070665_1000059033 | 279 |
| 125 | 3300005618 | Ga0068864_100002874 | Ga0068864_1000028744 | 279 |
| 126 | 3300006177 | Ga0075362_10017426 | Ga0075362_100174263 | 279 |
| 127 | 3300006195 | Ga0075366_10120264 | Ga0075366_101202642 | 279 |
| 128 | 3300006195 | Ga0075366_10239416 | Ga0075366_102394161 | 279 |
| 129 | 3300006195 | Ga0075366_10246066 | Ga0075366_102460662 | 279 |
| 130 | 3300009147 | Ga0114129_10038970 | Ga0114129_100389707 | 279 |
| 131 | 3300011119 | Ga0105246_10371369 | Ga0105246_103713692 | 279 |
| 132 | 3300013308 | Ga0157375_10393605 | Ga0157375_103936052 | 279 |
| 133 | 3300025909 | Ga0207705_10212149 | Ga0207705_102121491 | 279 |
| 134 | 3300025925 | Ga0207650_10105535 | Ga0207650_101055351 | 279 |
| 135 | 3300025926 | Ga0207659_10319213 | Ga0207659_103192131 | 279 |
| 136 | 3300025933 | Ga0207706_10301338 | Ga0207706_103013382 | 279 |
| 137 | 3300025940 | Ga0207691_10137810 | Ga0207691_101378102 | 279 |
| 138 | 3300025945 | Ga0207679_10291196 | Ga0207679_102911961 | 279 |
| 139 | 3300025986 | Ga0207658_10004344 | Ga0207658_100043447 | 279 |
| 140 | 3300026023 | Ga0207677_10065032 | Ga0207677_100650322 | 279 |
| 141 | 3300026095 | Ga0207676_10078901 | Ga0207676_100789012 | 279 |
| 142 | 3300028379 | Ga0268266_10032674 | Ga0268266_100326744 | 279 |
| 143 | 3300028786 | Ga0307517_10006619 | Ga0307517_1000661911 | 279 |
| 144 | 3300028794 | Ga0307515_10022234 | Ga0307515_100222343 | 279 |
| 145 | 3300028794 | Ga0307515_10117256 | Ga0307515_101172562 | 279 |
| 146 | 3300028794 | Ga0307515_10220504 | Ga0307515_102205042 | 279 |
| 147 | 3300028794 | Ga0307515_10231039 | Ga0307515_102310391 | 279 |
| 148 | 3300031456 | Ga0307513_10008816 | Ga0307513_100088163 | 279 |
| 149 | 3300031456 | Ga0307513_10009449 | Ga0307513_100094493 | 279 |
| 150 | 3300031456 | Ga0307513_10132515 | Ga0307513_101325152 | 279 |
| 151 | 3300031507 | Ga0307509_10010275 | Ga0307509_100102757 | 279 |
| 152 | 3300031507 | Ga0307509_10024131 | Ga0307509_100241317 | 279 |
| 153 | 3300031616 | Ga0307508_10000296 | Ga0307508_1000029649 | 279 |
| 154 | 3300031616 | Ga0307508_10061029 | Ga0307508_100610292 | 279 |
| 155 | 3300031730 | Ga0307516_10005185 | Ga0307516_100051859 | 279 |
| 156 | 3300031731 | Ga0307405_10252045 | Ga0307405_102520452 | 279 |
| 157 | 3300032005 | Ga0307411_10374632 | Ga0307411_103746321 | 279 |
| 158 | 3300033179 | Ga0307507_10024690 | Ga0307507_100246908 | 279 |
| 159 | 3300033180 | Ga0307510_10047358 | Ga0307510_100473585 | 279 |
| 160 | 3300033180 | Ga0307510_10113493 | Ga0307510_101134932 | 279 |
| 161 | 3300045051 | Ga0451576_0165387 | Ga0451576_0165387_51_917 | 279 |
| 162 | 3300046512 | Ga0495610_0044852 | Ga0495610_0044852_671_1537 | 279 |
| 163 | 3300046522 | Ga0495643_0026737 | Ga0495643_0026737_2232_3077 | 279 |
| 164 | 3300046660 | Ga0495625_0014620 | Ga0495625_0014620_3733_4578 | 279 |
| 165 | 3300046683 | Ga0495658_0105704 | Ga0495658_0105704_289_1134 | 279 |
| 166 | 3300048909 | Ga0496106_0111760 | Ga0496106_0111760_33_878 | 279 |
| 167 | 3300050493 | nmdc:mga0k408_117900_c1 | nmdc:mga0k408_117900_c1_592_1443 | 279 |
| 168 | 3300050493 | nmdc:mga0k408_183836_c1 | nmdc:mga0k408_183836_c1_143_988 | 279 |
| 169 | 3300050493 | nmdc:mga0k408_20983_c1 | nmdc:mga0k408_20983_c1_757_1638 | 279 |
| 170 | 3300050496 | nmdc:mga07m45_22415_c1 | nmdc:mga07m45_22415_c1_2450_3295 | 279 |
| 171 | 3300050507 | nmdc:mga05p37_96190_c1 | nmdc:mga05p37_96190_c1_1001_1846 | 279 |
| 172 | 3300053088 | Ga0500644_0003125 | Ga0500644_0003125_230_1096 | 279 |
| 173 | 3300053093 | Ga0500651_0078854 | Ga0500651_0078854_951_1817 | 279 |
| 174 | 3300053121 | Ga0500607_051038 | Ga0500607_051038_139_1008 | 279 |
| 175 | 3300053136 | Ga0500559_0000176 | Ga0500559_0000176_7550_8416 | 279 |
| 176 | 3300053156 | Ga0500622_0003533 | Ga0500622_0003533_7631_8497 | 279 |
| 177 | 3300053177 | Ga0500636_0032308 | Ga0500636_0032308_257_1123 | 279 |
| 178 | 3300053730 | Ga0500645_019513 | Ga0500645_019513_951_1796 | 279 |
| 179 | 3300053739 | Ga0500587_001383 | Ga0500587_001383_714_1580 | 279 |
| 180 | iso_pu_bacteria | 2585428058 | 2587731036 | 279 |
| 181 | 3300031238 | Ga0265332_10000006 | Ga0265332_10000006156 | 280 |
| 182 | 3300003320 | rootH2_10200810 | rootH2_102008104 | 281 |
| 183 | 3300003775 | Ga0055524_1000177 | Ga0055524_10001778 | 281 |
| 184 | 3300005330 | Ga0070690_100010771 | Ga0070690_1000107714 | 281 |
| 185 | 3300005331 | Ga0070670_100109396 | Ga0070670_1001093963 | 281 |
| 186 | 3300005333 | Ga0070677_10089543 | Ga0070677_100895431 | 281 |
| 187 | 3300005334 | Ga0068869_100004127 | Ga0068869_1000041272 | 281 |
| 188 | 3300005335 | Ga0070666_10040034 | Ga0070666_100400342 | 281 |
| 189 | 3300005343 | Ga0070687_100039509 | Ga0070687_1000395094 | 281 |
| 190 | 3300005347 | Ga0070668_100006518 | Ga0070668_1000065187 | 281 |
| 191 | 3300005353 | Ga0070669_100016694 | Ga0070669_1000166944 | 281 |
| 192 | 3300005354 | Ga0070675_100020218 | Ga0070675_1000202184 | 281 |
| 193 | 3300005354 | Ga0070675_100037488 | Ga0070675_1000374884 | 281 |
| 194 | 3300005354 | Ga0070675_100096256 | Ga0070675_1000962561 | 281 |
| 195 | 3300005356 | Ga0070674_100014252 | Ga0070674_1000142523 | 281 |
| 196 | 3300005356 | Ga0070674_100030364 | Ga0070674_1000303644 | 281 |
| 197 | 3300005356 | Ga0070674_100170913 | Ga0070674_1001709131 | 281 |
| 198 | 3300005364 | Ga0070673_100120817 | Ga0070673_1001208172 | 281 |
| 199 | 3300005367 | Ga0070667_100004171 | Ga0070667_1000041714 | 281 |
| 200 | 3300005455 | Ga0070663_100068571 | Ga0070663_1000685713 | 281 |
| 201 | 3300005456 | Ga0070678_100032118 | Ga0070678_1000321183 | 281 |
| 202 | 3300005456 | Ga0070678_100045618 | Ga0070678_1000456182 | 281 |
| 203 | 3300005457 | Ga0070662_100036590 | Ga0070662_1000365904 | 281 |
| 204 | 3300005459 | Ga0068867_100039424 | Ga0068867_1000394244 | 281 |
| 205 | 3300005539 | Ga0068853_100105748 | Ga0068853_1001057483 | 281 |
| 206 | 3300005543 | Ga0070672_100052960 | Ga0070672_1000529603 | 281 |
| 207 | 3300005543 | Ga0070672_100107415 | Ga0070672_1001074152 | 281 |
| 208 | 3300005543 | Ga0070672_100421461 | Ga0070672_1004214612 | 281 |
| 209 | 3300005544 | Ga0070686_100046209 | Ga0070686_1000462092 | 281 |
| 210 | 3300005563 | Ga0068855_100047687 | Ga0068855_1000476877 | 281 |
| 211 | 3300005616 | Ga0068852_100068908 | Ga0068852_1000689082 | 281 |
| 212 | 3300005616 | Ga0068852_100073982 | Ga0068852_1000739822 | 281 |
| 213 | 3300005617 | Ga0068859_100073069 | Ga0068859_1000730694 | 281 |
| 214 | 3300005718 | Ga0068866_10009957 | Ga0068866_100099572 | 281 |
| 215 | 3300005841 | Ga0068863_100076295 | Ga0068863_1000762952 | 281 |
| 216 | 3300005842 | Ga0068858_100015233 | Ga0068858_1000152337 | 281 |
| 217 | 3300005843 | Ga0068860_100003706 | Ga0068860_1000037062 | 281 |
| 218 | 3300006880 | Ga0075429_100005450 | Ga0075429_10000545013 | 281 |
| 219 | 3300006881 | Ga0068865_100040344 | Ga0068865_1000403442 | 281 |
| 220 | 3300006931 | Ga0097620_100073059 | Ga0097620_1000730594 | 281 |
| 221 | 3300009176 | Ga0105242_10426001 | Ga0105242_104260011 | 281 |
| 222 | 3300009177 | Ga0105248_10094328 | Ga0105248_100943283 | 281 |
| 223 | 3300009177 | Ga0105248_10371048 | Ga0105248_103710482 | 281 |
| 224 | 3300009553 | Ga0105249_10038415 | Ga0105249_100384153 | 281 |
| 225 | 3300013306 | Ga0163162_10036592 | Ga0163162_100365924 | 281 |
| 226 | 3300013308 | Ga0157375_10087254 | Ga0157375_100872543 | 281 |
| 227 | 3300014326 | Ga0157380_10002399 | Ga0157380_100023994 | 281 |
| 228 | 3300014968 | Ga0157379_10037880 | Ga0157379_100378804 | 281 |
| 229 | 3300014969 | Ga0157376_10860723 | Ga0157376_108607231 | 281 |
| 230 | 3300017792 | Ga0163161_10020214 | Ga0163161_100202143 | 281 |
| 231 | 3300025291 | Ga0209675_1024798 | Ga0209675_10247982 | 281 |
| 232 | 3300025893 | Ga0207682_10005552 | Ga0207682_100055524 | 281 |
| 233 | 3300025899 | Ga0207642_10004712 | Ga0207642_100047124 | 281 |
| 234 | 3300025903 | Ga0207680_10048205 | Ga0207680_100482052 | 281 |
| 235 | 3300025907 | Ga0207645_10014853 | Ga0207645_100148534 | 281 |
| 236 | 3300025907 | Ga0207645_10090254 | Ga0207645_100902542 | 281 |
| 237 | 3300025918 | Ga0207662_10065583 | Ga0207662_100655831 | 281 |
| 238 | 3300025923 | Ga0207681_10008284 | Ga0207681_100082846 | 281 |
| 239 | 3300025925 | Ga0207650_10003035 | Ga0207650_1000303510 | 281 |
| 240 | 3300025926 | Ga0207659_10021453 | Ga0207659_100214533 | 281 |
| 241 | 3300025926 | Ga0207659_10066675 | Ga0207659_100666753 | 281 |
| 242 | 3300025926 | Ga0207659_10143457 | Ga0207659_101434572 | 281 |
| 243 | 3300025933 | Ga0207706_10037340 | Ga0207706_100373403 | 281 |
| 244 | 3300025937 | Ga0207669_10041683 | Ga0207669_100416832 | 281 |
| 245 | 3300025940 | Ga0207691_10071435 | Ga0207691_100714353 | 281 |
| 246 | 3300025940 | Ga0207691_10074458 | Ga0207691_100744582 | 281 |
| 247 | 3300025941 | Ga0207711_10225300 | Ga0207711_102253002 | 281 |
| 248 | 3300025942 | Ga0207689_10024283 | Ga0207689_100242833 | 281 |
| 249 | 3300025960 | Ga0207651_10020525 | Ga0207651_100205254 | 281 |
| 250 | 3300025961 | Ga0207712_10027752 | Ga0207712_100277522 | 281 |
| 251 | 3300025972 | Ga0207668_10010018 | Ga0207668_100100184 | 281 |
| 252 | 3300025986 | Ga0207658_10069660 | Ga0207658_100696602 | 281 |
| 253 | 3300026023 | Ga0207677_10184347 | Ga0207677_101843472 | 281 |
| 254 | 3300026035 | Ga0207703_10005289 | Ga0207703_100052894 | 281 |
| 255 | 3300026067 | Ga0207678_10035571 | Ga0207678_100355713 | 281 |
| 256 | 3300026088 | Ga0207641_10011024 | Ga0207641_100110247 | 281 |
| 257 | 3300026089 | Ga0207648_10066618 | Ga0207648_100666182 | 281 |
| 258 | 3300026121 | Ga0207683_10025332 | Ga0207683_100253324 | 281 |
| 259 | 3300026121 | Ga0207683_10071748 | Ga0207683_100717483 | 281 |
| 260 | 3300027876 | Ga0209974_10001465 | Ga0209974_100014658 | 281 |
| 261 | 3300028381 | Ga0268264_10009546 | Ga0268264_100095467 | 281 |
| 262 | 3300028794 | Ga0307515_10003433 | Ga0307515_1000343326 | 281 |
| 263 | 3300028794 | Ga0307515_10007780 | Ga0307515_1000778015 | 281 |
| 264 | 3300030522 | Ga0307512_10026236 | Ga0307512_100262363 | 281 |
| 265 | 3300031456 | Ga0307513_10010890 | Ga0307513_1001089010 | 281 |
| 266 | 3300031616 | Ga0307508_10001204 | Ga0307508_100012045 | 281 |
| 267 | 3300031649 | Ga0307514_10024322 | Ga0307514_100243225 | 281 |
| 268 | 3300031852 | Ga0307410_10127505 | Ga0307410_101275052 | 281 |
| 269 | 3300033179 | Ga0307507_10070098 | Ga0307507_100700984 | 281 |
| 270 | 3300044656 | Ga0466969_0002962 | Ga0466969_0002962_6965_7819 | 281 |
| 271 | 3300044658 | Ga0466972_0049068 | Ga0466972_0049068_852_1697 | 281 |
| 272 | 3300044684 | Ga0466966_0032885 | Ga0466966_0032885_1562_2416 | 281 |
| 273 | 3300044719 | Ga0466971_0101331 | Ga0466971_0101331_379_1233 | 281 |
| 274 | 3300044765 | Ga0466970_0052008 | Ga0466970_0052008_1270_2124 | 281 |
| 275 | 3300044901 | Ga0466960_0059170 | Ga0466960_0059170_199_1044 | 281 |
| 276 | 3300046512 | Ga0495610_0018904 | Ga0495610_0018904_2165_3016 | 281 |
| 277 | 3300046519 | Ga0495632_0040420 | Ga0495632_0040420_413_1264 | 281 |
| 278 | 3300046681 | Ga0495647_0012684 | Ga0495647_0012684_492_1343 | 281 |
| 279 | 3300046683 | Ga0495658_0053960 | Ga0495658_0053960_1391_2242 | 281 |
| 280 | 3300053117 | Ga0500593_000589 | Ga0500593_000589_9724_10581 | 281 |
| 281 | 3300053739 | Ga0500587_008478 | Ga0500587_008478_88_939 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p3q-assembly3.cif.gz_A | crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m | 0.7302 | 28 | 276 |
| 3p3q-assembly3.cif.gz_A | crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m | 0.7117 | 28 | 276 |
| 3p3q-assembly3.cif.gz_B | crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m | 0.7115 | 25 | 276 |
| 3p3q-assembly3.cif.gz_B | crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m | 0.7019 | 25 | 276 |
| 3ljx-assembly1.cif.gz_A | crystal structure of mmoq response regulator (fragment 20-298) from methylococcus capsulatus str. bath, northeast structural genomics consortium target mcr175g | 0.7012 | 28 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ljvB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7328 | 28 | 268 | 1.10.3210.10 |
| 3p3qA00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7292 | 28 | 276 | 1.10.3210.10 |
| 3p3qA00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7131 | 28 | 276 | 1.10.3210.10 |
| 3ljvB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7069 | 28 | 268 | 1.10.3210.10 |
| 1vqrD00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6241 | 19 | 266 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G8ZIK5-F1-model_v4 | HD-like signal output (HDOD) domain, no enzymatic activity | 0.9686 | 17 | 277 |
|
| AF-A0A1R1I1L7-F1-model_v4 | HDOD domain-containing protein | 0.9676 | 10 | 277 |
|
| AF-A0A5C7JYG3-F1-model_v4 | HDOD domain-containing protein | 0.9652 | 10 | 277 |
|
| AF-A0A3D1WFR5-F1-model_v4 | Histidine kinase | 0.9646 | 7 | 280 |
GO:0016301
|
| AF-A0A1G3HQ63-F1-model_v4 | HDOD domain-containing protein | 0.9642 | 10 | 276 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar