F384166

General Info

Members Datasets Scaffolds Average Seq Length
281 170 277 279

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100047687|Ga0068855_1000476877
Length 332
Sequence MGLAHPSGMRRRSIGDCRPGLKSHDVPADKNETSITVVSDAMNTTTTPATPSPALDFQPLRSPLPSLDAWTAHFFKAEIPILADTAANLEAMRAHEDDMDANLIGEMVADDPLMTLKILAYSATHRSERRVTDVETVTAAVVVLGISPFFSAFGPEQPVVEDRLAQVEGAPQGLADVLRRAHRAARFAFAFAVHRMDLDAAVIHEAALLHDFAEMLLWCHAPTLALQVRQALEATPGLRSSAAQQGVLGIQLPDLQQALMRAWRLPDLLIRITDDSHADHPSVRNVVLAIRLARHSSHGWENPAIPDDIEELAALLNLSRQATLELVRKVDI

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
163 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.52
Nodule 0
Rhizoplane 1.07
Rhizosphere 73.31
Stem 0
Stem Tuber 0
Unclassified 12.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10200810 3300003320 Bacteria 1798
2 rootL2_10276934 3300003322 Bacteria 3506
3 Ga0055524_1000177 3300003775 Bacteria 72445
4 Ga0070658_10104881 3300005327 Bacteria 2339
5 Ga0070676_10004416 3300005328 Bacteria 7397
6 Ga0070690_100010771 3300005330 Bacteria 5332
7 Ga0070670_100015843 3300005331 Bacteria 6469
8 Ga0070670_100109396 3300005331 Bacteria 2381
9 Ga0070670_100241212 3300005331 Bacteria 1574
10 Ga0070670_100319028 3300005331 Bacteria 1361
11 Ga0070677_10033434 3300005333 Bacteria 1980
12 Ga0070677_10089543 3300005333 Bacteria 1335
13 Ga0068869_100004127 3300005334 Bacteria 9008
14 Ga0070666_10040034 3300005335 Bacteria 3126
15 Ga0068868_100069276 3300005338 Bacteria 2811
16 Ga0068868_100174278 3300005338 Bacteria 1782
17 Ga0070687_100039509 3300005343 Bacteria 2371
18 Ga0070668_100006518 3300005347 Bacteria 8653
19 Ga0070669_100016694 3300005353 Bacteria 5240
20 Ga0070675_100020218 3300005354 Bacteria 5312
21 Ga0070675_100037488 3300005354 Bacteria 3949
22 Ga0070675_100048285 3300005354 Bacteria 3489
23 Ga0070675_100096256 3300005354 Bacteria 2487
24 Ga0070675_100121806 3300005354 Bacteria 2216
25 Ga0070675_100236334 3300005354 Bacteria 1596
26 Ga0070671_100020884 3300005355 Bacteria 5342
27 Ga0070674_100014252 3300005356 Bacteria 4939
28 Ga0070674_100030364 3300005356 Bacteria 3570
29 Ga0070674_100170913 3300005356 Bacteria 1657
30 Ga0070673_100120817 3300005364 Bacteria 2185
31 Ga0070673_100264851 3300005364 Bacteria 1503
32 Ga0070673_100673808 3300005364 Bacteria 948
33 Ga0070667_100000975 3300005367 Bacteria 26309
34 Ga0070667_100004171 3300005367 Bacteria 12205
35 Ga0070667_100044133 3300005367 Bacteria 3743
36 Ga0070667_100091689 3300005367 Bacteria 2613
37 Ga0070667_100350093 3300005367 Bacteria 1337
38 Ga0070663_100068571 3300005455 Bacteria 2575
39 Ga0070663_100282445 3300005455 Bacteria 1323
40 Ga0070678_100032118 3300005456 Bacteria 3630
41 Ga0070678_100045618 3300005456 Bacteria 3137
42 Ga0070678_100171815 3300005456 Bacteria 1766
43 Ga0070662_100036590 3300005457 Bacteria 3473
44 Ga0070662_100072231 3300005457 Bacteria 2547
45 Ga0070662_100097745 3300005457 Bacteria 2216
46 Ga0068867_100001985 3300005459 Bacteria 14269
47 Ga0068867_100039424 3300005459 Bacteria 3444
48 Ga0070706_100044257 3300005467 Bacteria 4112
49 Ga0068853_100105748 3300005539 Bacteria 2493
50 Ga0070672_100029210 3300005543 Bacteria 4133
51 Ga0070672_100052960 3300005543 Bacteria 3171
52 Ga0070672_100107415 3300005543 Bacteria 2271
53 Ga0070672_100421461 3300005543 Bacteria 1146
54 Ga0070686_100046209 3300005544 Bacteria 2746
55 Ga0070665_100005903 3300005548 Bacteria 12544
56 Ga0068855_100047687 3300005563 Bacteria 5061
57 Ga0068857_100021440 3300005577 Bacteria 5687
58 Ga0068852_100068908 3300005616 Bacteria 3098
59 Ga0068852_100073982 3300005616 Bacteria 2999
60 Ga0068859_100073069 3300005617 Bacteria 3467
61 Ga0068864_100002874 3300005618 Bacteria 14233
62 Ga0068866_10009957 3300005718 Bacteria 4057
63 Ga0068863_100076295 3300005841 Bacteria 3171
64 Ga0068858_100015233 3300005842 Bacteria 7232
65 Ga0068860_100003706 3300005843 Bacteria 15722
66 Ga0068860_100081664 3300005843 Bacteria 3074
67 Ga0075362_10016699 3300006177 Bacteria 3010
68 Ga0075362_10017426 3300006177 Bacteria 2959
69 Ga0075367_10005112 3300006178 Bacteria 6474
70 Ga0075366_10007365 3300006195 Bacteria 6075
71 Ga0075366_10008687 3300006195 Bacteria 5657
72 Ga0075366_10076449 3300006195 Bacteria 1998
73 Ga0075366_10087911 3300006195 Bacteria 1861
74 Ga0075366_10120264 3300006195 Bacteria 1583
75 Ga0075366_10239416 3300006195 Bacteria 1106
76 Ga0075366_10246066 3300006195 Bacteria 1090
77 Ga0075370_10011071 3300006353 Bacteria 4730
78 Ga0075370_10012199 3300006353 Bacteria 4535
79 Ga0075370_10060422 3300006353 Bacteria 2159
80 Ga0075429_100005450 3300006880 Bacteria 10959
81 Ga0068865_100040344 3300006881 Bacteria 3171
82 Ga0097620_100073059 3300006931 Bacteria 3467
83 Ga0105245_10085840 3300009098 Bacteria 2886
84 Ga0114129_10038970 3300009147 Bacteria 6699
85 Ga0105243_10006936 3300009148 Bacteria 8723
86 Ga0105243_10044534 3300009148 Bacteria 3482
87 Ga0105242_10426001 3300009176 Bacteria 1245
88 Ga0105248_10094328 3300009177 Bacteria 3370
89 Ga0105248_10371048 3300009177 Bacteria 1611
90 Ga0105249_10038415 3300009553 Bacteria 4344
91 Ga0105246_10371369 3300011119 Bacteria 1179
92 Ga0163162_10036592 3300013306 Bacteria 4894
93 Ga0157375_10007862 3300013308 Bacteria 9332
94 Ga0157375_10087254 3300013308 Bacteria 3172
95 Ga0157375_10393605 3300013308 Bacteria 1552
96 Ga0157380_10002399 3300014326 Bacteria 12601
97 Ga0157377_10000021 3300014745 Bacteria 147105
98 Ga0157379_10037880 3300014968 Bacteria 4301
99 Ga0157376_10860723 3300014969 Bacteria 922
100 Ga0163161_10020214 3300017792 Bacteria 4671
101 Ga0209675_1024798 3300025291 Bacteria 1525
102 Ga0207682_10005552 3300025893 Bacteria 5134
103 Ga0207642_10004712 3300025899 Bacteria 4407
104 Ga0207680_10048205 3300025903 Bacteria 2529
105 Ga0207645_10014853 3300025907 Bacteria 5196
106 Ga0207645_10045289 3300025907 Bacteria 2812
107 Ga0207645_10090254 3300025907 Bacteria 1970
108 Ga0207645_10113123 3300025907 Bacteria 1758
109 Ga0207705_10212149 3300025909 Bacteria 1469
110 Ga0207684_10033416 3300025910 Bacteria 4374
111 Ga0207662_10065583 3300025918 Bacteria 2186
112 Ga0207681_10008284 3300025923 Bacteria 6356
113 Ga0207681_10287720 3300025923 Bacteria 1296
114 Ga0207650_10003035 3300025925 Bacteria 11563
115 Ga0207650_10084728 3300025925 Bacteria 2410
116 Ga0207650_10105535 3300025925 Bacteria 2175
117 Ga0207659_10016769 3300025926 Bacteria 4774
118 Ga0207659_10021453 3300025926 Bacteria 4287
119 Ga0207659_10066675 3300025926 Bacteria 2613
120 Ga0207659_10143457 3300025926 Bacteria 1856
121 Ga0207659_10319213 3300025926 Bacteria 1281
122 Ga0207644_10114821 3300025931 Bacteria 2041
123 Ga0207706_10037340 3300025933 Bacteria 4314
124 Ga0207706_10301338 3300025933 Bacteria 1396
125 Ga0207709_10002256 3300025935 Bacteria 12257
126 Ga0207709_10030306 3300025935 Bacteria 3146
127 Ga0207669_10041683 3300025937 Bacteria 2674
128 Ga0207691_10004162 3300025940 Bacteria 14056
129 Ga0207691_10071435 3300025940 Bacteria 3132
130 Ga0207691_10074458 3300025940 Bacteria 3062
131 Ga0207691_10137810 3300025940 Bacteria 2152
132 Ga0207711_10225300 3300025941 Bacteria 1716
133 Ga0207689_10024283 3300025942 Bacteria 5087
134 Ga0207679_10291196 3300025945 Bacteria 1404
135 Ga0207651_10020525 3300025960 Bacteria 3990
136 Ga0207712_10027752 3300025961 Bacteria 3782
137 Ga0207668_10010018 3300025972 Bacteria 5704
138 Ga0207640_10276983 3300025981 Bacteria 1316
139 Ga0207658_10004344 3300025986 Bacteria 9860
140 Ga0207658_10069660 3300025986 Bacteria 2658
141 Ga0207677_10018601 3300026023 Bacteria 4173
142 Ga0207677_10065032 3300026023 Bacteria 2543
143 Ga0207677_10184347 3300026023 Bacteria 1645
144 Ga0207703_10005289 3300026035 Bacteria 10407
145 Ga0207678_10035571 3300026067 Bacteria 4336
146 Ga0207641_10011024 3300026088 Bacteria 7413
147 Ga0207648_10002131 3300026089 Bacteria 21529
148 Ga0207648_10007595 3300026089 Bacteria 10633
149 Ga0207648_10066618 3300026089 Bacteria 3141
150 Ga0207676_10078901 3300026095 Bacteria 2668
151 Ga0207674_10015349 3300026116 Bacteria 8417
152 Ga0207683_10025332 3300026121 Bacteria 5117
153 Ga0207683_10071748 3300026121 Bacteria 3062
154 Ga0207683_10089419 3300026121 Bacteria 2741
155 Ga0207683_10101861 3300026121 Bacteria 2564
156 Ga0209974_10001465 3300027876 Bacteria 8559
157 Ga0268266_10032674 3300028379 Bacteria 4421
158 Ga0268264_10009546 3300028381 Bacteria 8038
159 Ga0307517_10006619 3300028786 Bacteria 17080
160 Ga0307515_10002435 3300028794 Bacteria 40544
161 Ga0307515_10003433 3300028794 Bacteria 33339
162 Ga0307515_10007780 3300028794 Bacteria 21086
163 Ga0307515_10022234 3300028794 Bacteria 11185
164 Ga0307515_10117256 3300028794 Bacteria 3049
165 Ga0307515_10220504 3300028794 Bacteria 1716
166 Ga0307515_10231039 3300028794 Bacteria 1642
167 Ga0307512_10009073 3300030522 Bacteria 9621
168 Ga0307512_10026236 3300030522 Bacteria 5148
169 Ga0265332_10000006 3300031238 Bacteria 327963
170 Ga0307513_10008816 3300031456 Bacteria 12841
171 Ga0307513_10009449 3300031456 Bacteria 12333
172 Ga0307513_10010890 3300031456 Bacteria 11357
173 Ga0307513_10132515 3300031456 Bacteria 2435
174 Ga0307509_10006623 3300031507 Bacteria 15481
175 Ga0307509_10010275 3300031507 Bacteria 11503
176 Ga0307509_10024131 3300031507 Bacteria 6815
177 Ga0307509_10119111 3300031507 Bacteria 2622
178 Ga0307408_100090608 3300031548 Bacteria 2308
179 Ga0307508_10000296 3300031616 Bacteria 60826
180 Ga0307508_10001204 3300031616 Bacteria 29689
181 Ga0307508_10061029 3300031616 Bacteria 3332
182 Ga0307514_10024322 3300031649 Bacteria 4906
183 Ga0307514_10058742 3300031649 Bacteria 2941
184 Ga0307516_10001808 3300031730 Bacteria 29384
185 Ga0307516_10005185 3300031730 Bacteria 15701
186 Ga0307405_10252045 3300031731 Bacteria 1314
187 Ga0307410_10127505 3300031852 Bacteria 1865
188 Ga0307412_10114159 3300031911 Bacteria 1934
189 Ga0307412_10377934 3300031911 Bacteria 1146
190 Ga0307411_10374632 3300032005 Bacteria 1169
191 Ga0307507_10024690 3300033179 Bacteria 6540
192 Ga0307507_10070098 3300033179 Bacteria 3183
193 Ga0307510_10020555 3300033180 Bacteria 7713
194 Ga0307510_10047358 3300033180 Bacteria 4608
195 Ga0307510_10113493 3300033180 Bacteria 2443
196 Ga0373937_0271958 3300036401 Bacteria 1599
197 Ga0395900_0001686 3300037418 Bacteria 25712
198 Ga0395898_0002642 3300037466 Bacteria 20848
199 Ga0451787_015381 3300041441 Bacteria 1026
200 Ga0451853_4053387 3300041512 Bacteria 1396
201 Ga0466969_0002962 3300044656 Bacteria 9066
202 Ga0466969_0016300 3300044656 Bacteria 3892
203 Ga0466969_0045932 3300044656 Bacteria 2166
204 Ga0466972_0049068 3300044658 Bacteria 2039
205 Ga0466965_0139751 3300044683 Bacteria 1260
206 Ga0466966_0028110 3300044684 Bacteria 3664
207 Ga0466966_0032885 3300044684 Bacteria 3357
208 Ga0466966_0123574 3300044684 Bacteria 1588
209 Ga0466961_0016026 3300044693 Bacteria 4811
210 Ga0466961_0024950 3300044693 Bacteria 3846
211 Ga0466963_0005488 3300044694 Bacteria 7424
212 Ga0466964_0022430 3300044706 Bacteria 2449
213 Ga0453684_0009499 3300044712 Bacteria 17005
214 Ga0466971_0013249 3300044719 Bacteria 3618
215 Ga0466971_0048965 3300044719 Bacteria 1900
216 Ga0466971_0101331 3300044719 Bacteria 1324
217 Ga0466970_0039370 3300044765 Bacteria 2508
218 Ga0466970_0052008 3300044765 Bacteria 2187
219 Ga0466970_0149075 3300044765 Bacteria 1291
220 Ga0466957_0056678 3300044842 Bacteria 2396
221 Ga0466960_0059170 3300044901 Bacteria 1873
222 Ga0466959_0001418 3300045049 Bacteria 14666
223 Ga0466959_0043459 3300045049 Bacteria 3312
224 Ga0466959_0144435 3300045049 Bacteria 1679
225 Ga0451576_0165387 3300045051 Bacteria 2308
226 Ga0451576_0271505 3300045051 Bacteria 1773
227 Ga0466958_0155240 3300045836 Bacteria 1444
228 Ga0466967_0056175 3300045976 Bacteria 3470
229 Ga0466967_0327806 3300045976 Bacteria 1478
230 Ga0495592_0002694 3300046454 Bacteria 12565
231 Ga0495610_0018904 3300046512 Bacteria 3874
232 Ga0495610_0044852 3300046512 Bacteria 2192
233 Ga0495620_0088415 3300046515 Bacteria 1245
234 Ga0495632_0040420 3300046519 Bacteria 2349
235 Ga0495643_0026737 3300046522 Bacteria 3251
236 Ga0495625_0014620 3300046660 Bacteria 6254
237 Ga0495647_0012684 3300046681 Bacteria 2907
238 Ga0495658_0053960 3300046683 Bacteria 2285
239 Ga0495658_0105704 3300046683 Bacteria 1686
240 Ga0495686_0009871 3300047472 Bacteria 6840
241 Ga0496106_0111760 3300048909 Bacteria 2128
242 Ga0496112_0323349 3300048915 Bacteria 1487
243 Ga0501298_028408 3300049521 Bacteria 1085
244 Ga0501043_0000572 3300049579 Bacteria 32900
245 Ga0501046_0000843 3300049580 Bacteria 29885
246 Ga0501047_0000906 3300049581 Bacteria 30269
247 Ga0501048_0001003 3300049582 Bacteria 21059
248 Ga0501265_001463 3300049762 Bacteria 2661
249 Ga0501045_0007135 3300049824 Bacteria 7752
250 nmdc:mga03683_194992_c1 3300050489 Bacteria 928
251 nmdc:mga0k408_117900_c1 3300050493 Bacteria 1571
252 nmdc:mga0k408_183836_c1 3300050493 Bacteria 1247
253 nmdc:mga0k408_20983_c1 3300050493 Bacteria 3666
254 nmdc:mga0k408_233_c1 3300050493 Bacteria 29837
255 nmdc:mga0k408_27439_c1 3300050493 Bacteria 3234
256 nmdc:mga0k408_7434_c1 3300050493 Bacteria 1861
257 nmdc:mga06z11_226840_c1 3300050494 Bacteria 1093
258 nmdc:mga07m45_22415_c1 3300050496 Bacteria 3448
259 nmdc:mga07m45_36911_c1 3300050496 Bacteria 2724
260 nmdc:mga07m45_56109_c1 3300050496 Bacteria 2226
261 nmdc:mga05p37_96190_c1 3300050507 Bacteria 3648
262 nmdc:mga09592_8600_c1 3300050508 Bacteria 8305
263 Ga0495612_0109575 3300053078 Bacteria 1181
264 Ga0500644_0003125 3300053088 Bacteria 4099
265 Ga0500651_0078854 3300053093 Bacteria 2042
266 Ga0500593_000589 3300053117 Bacteria 13970
267 Ga0500607_051038 3300053121 Bacteria 2201
268 Ga0500559_0000176 3300053136 Bacteria 50699
269 Ga0500559_0127854 3300053136 Unclassified 1186
270 Ga0500619_000342 3300053154 Bacteria 8851
271 Ga0500622_0003533 3300053156 Bacteria 10355
272 Ga0500636_0032308 3300053177 Bacteria 3098
273 Ga0500645_019513 3300053730 Bacteria 2108
274 Ga0500587_001383 3300053739 Bacteria 3423
275 Ga0500587_008478 3300053739 Bacteria 1321
276 Ga0466962_0003825 3300061719 Bacteria 7195
277 Ga0466962_0017795 3300061719 Bacteria 3420

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049521 Ga0501298_028408 Ga0501298_028408_23_757 243
2 3300028794 Ga0307515_10002435 Ga0307515_1000243543 250
3 3300045049 Ga0466959_0144435 Ga0466959_0144435_878_1651 250
4 3300006195 Ga0075366_10087911 Ga0075366_100879112 256
5 3300006353 Ga0075370_10060422 Ga0075370_100604222 256
6 3300025907 Ga0207645_10045289 Ga0207645_100452892 256
7 3300025923 Ga0207681_10287720 Ga0207681_102877202 256
8 3300025925 Ga0207650_10084728 Ga0207650_100847283 256
9 3300025926 Ga0207659_10016769 Ga0207659_100167692 256
10 3300025931 Ga0207644_10114821 Ga0207644_101148212 256
11 3300025935 Ga0207709_10030306 Ga0207709_100303063 256
12 3300026023 Ga0207677_10018601 Ga0207677_100186012 256
13 3300026089 Ga0207648_10007595 Ga0207648_100075958 256
14 3300026116 Ga0207674_10015349 Ga0207674_100153498 256
15 3300044683 Ga0466965_0139751 Ga0466965_0139751_301_1074 257
16 3300031548 Ga0307408_100090608 Ga0307408_1000906081 261
17 3300050494 nmdc:mga06z11_226840_c1 nmdc:mga06z11_226840_c1_15_800 261
18 3300025981 Ga0207640_10276983 Ga0207640_102769832 266
19 3300041441 Ga0451787_015381 Ga0451787_015381_165_1010 266
20 3300003322 rootL2_10276934 rootL2_102769344 268
21 3300045049 Ga0466959_0043459 Ga0466959_0043459_1242_2051 268
22 3300046515 Ga0495620_0088415 Ga0495620_0088415_415_1221 268
23 3300005328 Ga0070676_10004416 Ga0070676_100044163 269
24 3300005331 Ga0070670_100015843 Ga0070670_1000158437 269
25 3300005338 Ga0068868_100069276 Ga0068868_1000692762 269
26 3300005354 Ga0070675_100236334 Ga0070675_1002363341 269
27 3300005355 Ga0070671_100020884 Ga0070671_1000208847 269
28 3300005367 Ga0070667_100350093 Ga0070667_1003500931 269
29 3300005456 Ga0070678_100171815 Ga0070678_1001718151 269
30 3300005457 Ga0070662_100097745 Ga0070662_1000977452 269
31 3300005459 Ga0068867_100001985 Ga0068867_1000019856 269
32 3300005577 Ga0068857_100021440 Ga0068857_1000214405 269
33 3300009098 Ga0105245_10085840 Ga0105245_100858402 269
34 3300009148 Ga0105243_10044534 Ga0105243_100445343 269
35 3300013308 Ga0157375_10007862 Ga0157375_100078627 269
36 3300050493 nmdc:mga0k408_7434_c1 nmdc:mga0k408_7434_c1_819_1664 269
37 3300050496 nmdc:mga07m45_56109_c1 nmdc:mga07m45_56109_c1_647_1492 269
38 3300031911 Ga0307412_10377934 Ga0307412_103779341 270
39 3300006177 Ga0075362_10016699 Ga0075362_100166993 271
40 3300006195 Ga0075366_10008687 Ga0075366_100086875 271
41 3300037418 Ga0395900_0001686 Ga0395900_0001686_17201_18049 271
42 3300037466 Ga0395898_0002642 Ga0395898_0002642_7170_8018 271
43 3300050489 nmdc:mga03683_194992_c1 nmdc:mga03683_194992_c1_14_853 271
44 3300050493 nmdc:mga0k408_233_c1 nmdc:mga0k408_233_c1_10549_11388 271
45 3300053136 Ga0500559_0127854 Ga0500559_0127854_251_1108 271
46 3300053154 Ga0500619_000342 Ga0500619_000342_1230_2087 271
47 3300005333 Ga0070677_10033434 Ga0070677_100334341 273
48 3300005354 Ga0070675_100048285 Ga0070675_1000482855 273
49 3300005543 Ga0070672_100029210 Ga0070672_1000292101 273
50 3300025907 Ga0207645_10113123 Ga0207645_101131233 273
51 3300025940 Ga0207691_10004162 Ga0207691_100041623 273
52 3300026121 Ga0207683_10101861 Ga0207683_101018613 273
53 3300031507 Ga0307509_10119111 Ga0307509_101191113 273
54 3300031730 Ga0307516_10001808 Ga0307516_1000180824 273
55 3300041512 Ga0451853_4053387 Ga0451853_4053387_211_1059 273
56 iso_pu_bacteria 2585428057 2587727973 273
57 3300005843 Ga0068860_100081664 Ga0068860_1000816642 274
58 3300044656 Ga0466969_0016300 Ga0466969_0016300_1060_1908 274
59 3300044684 Ga0466966_0028110 Ga0466966_0028110_1596_2444 274
60 3300044693 Ga0466961_0016026 Ga0466961_0016026_1033_1881 274
61 3300044719 Ga0466971_0013249 Ga0466971_0013249_2310_3158 274
62 3300044765 Ga0466970_0149075 Ga0466970_0149075_328_1176 274
63 3300045976 Ga0466967_0327806 Ga0466967_0327806_254_1102 274
64 3300047472 Ga0495686_0009871 Ga0495686_0009871_2098_2922 274
65 3300061719 Ga0466962_0003825 Ga0466962_0003825_551_1399 274
66 3300006178 Ga0075367_10005112 Ga0075367_100051127 275
67 3300006353 Ga0075370_10012199 Ga0075370_100121994 275
68 iso_pu_bacteria 2643221654 2644303463 275
69 3300005467 Ga0070706_100044257 Ga0070706_1000442573 276
70 3300009148 Ga0105243_10006936 Ga0105243_1000693610 276
71 3300014745 Ga0157377_10000021 Ga0157377_10000021137 276
72 3300025910 Ga0207684_10033416 Ga0207684_100334162 276
73 3300025935 Ga0207709_10002256 Ga0207709_1000225610 276
74 3300026089 Ga0207648_10002131 Ga0207648_1000213113 276
75 3300026121 Ga0207683_10089419 Ga0207683_100894194 276
76 3300031911 Ga0307412_10114159 Ga0307412_101141592 276
77 3300049579 Ga0501043_0000572 Ga0501043_0000572_9734_10567 276
78 3300049580 Ga0501046_0000843 Ga0501046_0000843_23447_24280 276
79 3300049581 Ga0501047_0000906 Ga0501047_0000906_22384_23217 276
80 3300049582 Ga0501048_0001003 Ga0501048_0001003_19518_20351 276
81 3300049762 Ga0501265_001463 Ga0501265_001463_765_1601 276
82 3300049824 Ga0501045_0007135 Ga0501045_0007135_3689_4522 276
83 3300053078 Ga0495612_0109575 Ga0495612_0109575_252_1085 276
84 3300005455 Ga0070663_100282445 Ga0070663_1002824451 277
85 3300031649 Ga0307514_10058742 Ga0307514_100587422 277
86 3300050508 nmdc:mga09592_8600_c1 nmdc:mga09592_8600_c1_1308_2141 277
87 iso_pu_bacteria 2585428062 2587758901 277
88 3300005364 Ga0070673_100673808 Ga0070673_1006738081 278
89 3300005367 Ga0070667_100091689 Ga0070667_1000916892 278
90 3300006195 Ga0075366_10007365 Ga0075366_100073653 278
91 3300006195 Ga0075366_10076449 Ga0075366_100764492 278
92 3300006353 Ga0075370_10011071 Ga0075370_100110716 278
93 3300030522 Ga0307512_10009073 Ga0307512_100090733 278
94 3300031507 Ga0307509_10006623 Ga0307509_1000662310 278
95 3300033180 Ga0307510_10020555 Ga0307510_100205557 278
96 3300036401 Ga0373937_0271958 Ga0373937_0271958_96_935 278
97 3300044656 Ga0466969_0045932 Ga0466969_0045932_846_1691 278
98 3300044684 Ga0466966_0123574 Ga0466966_0123574_34_879 278
99 3300044693 Ga0466961_0024950 Ga0466961_0024950_2319_3164 278
100 3300044694 Ga0466963_0005488 Ga0466963_0005488_3112_3957 278
101 3300044706 Ga0466964_0022430 Ga0466964_0022430_161_1006 278
102 3300044712 Ga0453684_0009499 Ga0453684_0009499_9725_10567 278
103 3300044719 Ga0466971_0048965 Ga0466971_0048965_364_1209 278
104 3300044765 Ga0466970_0039370 Ga0466970_0039370_337_1182 278
105 3300044842 Ga0466957_0056678 Ga0466957_0056678_599_1444 278
106 3300045049 Ga0466959_0001418 Ga0466959_0001418_8650_9495 278
107 3300045051 Ga0451576_0271505 Ga0451576_0271505_701_1540 278
108 3300045836 Ga0466958_0155240 Ga0466958_0155240_189_1034 278
109 3300045976 Ga0466967_0056175 Ga0466967_0056175_1207_2052 278
110 3300046454 Ga0495592_0002694 Ga0495592_0002694_7676_8518 278
111 3300048915 Ga0496112_0323349 Ga0496112_0323349_300_1142 278
112 3300050493 nmdc:mga0k408_27439_c1 nmdc:mga0k408_27439_c1_257_1102 278
113 3300050496 nmdc:mga07m45_36911_c1 nmdc:mga07m45_36911_c1_1672_2538 278
114 3300061719 Ga0466962_0017795 Ga0466962_0017795_2536_3381 278
115 3300005327 Ga0070658_10104881 Ga0070658_101048812 279
116 3300005331 Ga0070670_100241212 Ga0070670_1002412121 279
117 3300005331 Ga0070670_100319028 Ga0070670_1003190282 279
118 3300005338 Ga0068868_100174278 Ga0068868_1001742782 279
119 3300005354 Ga0070675_100121806 Ga0070675_1001218062 279
120 3300005364 Ga0070673_100264851 Ga0070673_1002648512 279
121 3300005367 Ga0070667_100000975 Ga0070667_1000009754 279
122 3300005367 Ga0070667_100044133 Ga0070667_1000441332 279
123 3300005457 Ga0070662_100072231 Ga0070662_1000722312 279
124 3300005548 Ga0070665_100005903 Ga0070665_1000059033 279
125 3300005618 Ga0068864_100002874 Ga0068864_1000028744 279
126 3300006177 Ga0075362_10017426 Ga0075362_100174263 279
127 3300006195 Ga0075366_10120264 Ga0075366_101202642 279
128 3300006195 Ga0075366_10239416 Ga0075366_102394161 279
129 3300006195 Ga0075366_10246066 Ga0075366_102460662 279
130 3300009147 Ga0114129_10038970 Ga0114129_100389707 279
131 3300011119 Ga0105246_10371369 Ga0105246_103713692 279
132 3300013308 Ga0157375_10393605 Ga0157375_103936052 279
133 3300025909 Ga0207705_10212149 Ga0207705_102121491 279
134 3300025925 Ga0207650_10105535 Ga0207650_101055351 279
135 3300025926 Ga0207659_10319213 Ga0207659_103192131 279
136 3300025933 Ga0207706_10301338 Ga0207706_103013382 279
137 3300025940 Ga0207691_10137810 Ga0207691_101378102 279
138 3300025945 Ga0207679_10291196 Ga0207679_102911961 279
139 3300025986 Ga0207658_10004344 Ga0207658_100043447 279
140 3300026023 Ga0207677_10065032 Ga0207677_100650322 279
141 3300026095 Ga0207676_10078901 Ga0207676_100789012 279
142 3300028379 Ga0268266_10032674 Ga0268266_100326744 279
143 3300028786 Ga0307517_10006619 Ga0307517_1000661911 279
144 3300028794 Ga0307515_10022234 Ga0307515_100222343 279
145 3300028794 Ga0307515_10117256 Ga0307515_101172562 279
146 3300028794 Ga0307515_10220504 Ga0307515_102205042 279
147 3300028794 Ga0307515_10231039 Ga0307515_102310391 279
148 3300031456 Ga0307513_10008816 Ga0307513_100088163 279
149 3300031456 Ga0307513_10009449 Ga0307513_100094493 279
150 3300031456 Ga0307513_10132515 Ga0307513_101325152 279
151 3300031507 Ga0307509_10010275 Ga0307509_100102757 279
152 3300031507 Ga0307509_10024131 Ga0307509_100241317 279
153 3300031616 Ga0307508_10000296 Ga0307508_1000029649 279
154 3300031616 Ga0307508_10061029 Ga0307508_100610292 279
155 3300031730 Ga0307516_10005185 Ga0307516_100051859 279
156 3300031731 Ga0307405_10252045 Ga0307405_102520452 279
157 3300032005 Ga0307411_10374632 Ga0307411_103746321 279
158 3300033179 Ga0307507_10024690 Ga0307507_100246908 279
159 3300033180 Ga0307510_10047358 Ga0307510_100473585 279
160 3300033180 Ga0307510_10113493 Ga0307510_101134932 279
161 3300045051 Ga0451576_0165387 Ga0451576_0165387_51_917 279
162 3300046512 Ga0495610_0044852 Ga0495610_0044852_671_1537 279
163 3300046522 Ga0495643_0026737 Ga0495643_0026737_2232_3077 279
164 3300046660 Ga0495625_0014620 Ga0495625_0014620_3733_4578 279
165 3300046683 Ga0495658_0105704 Ga0495658_0105704_289_1134 279
166 3300048909 Ga0496106_0111760 Ga0496106_0111760_33_878 279
167 3300050493 nmdc:mga0k408_117900_c1 nmdc:mga0k408_117900_c1_592_1443 279
168 3300050493 nmdc:mga0k408_183836_c1 nmdc:mga0k408_183836_c1_143_988 279
169 3300050493 nmdc:mga0k408_20983_c1 nmdc:mga0k408_20983_c1_757_1638 279
170 3300050496 nmdc:mga07m45_22415_c1 nmdc:mga07m45_22415_c1_2450_3295 279
171 3300050507 nmdc:mga05p37_96190_c1 nmdc:mga05p37_96190_c1_1001_1846 279
172 3300053088 Ga0500644_0003125 Ga0500644_0003125_230_1096 279
173 3300053093 Ga0500651_0078854 Ga0500651_0078854_951_1817 279
174 3300053121 Ga0500607_051038 Ga0500607_051038_139_1008 279
175 3300053136 Ga0500559_0000176 Ga0500559_0000176_7550_8416 279
176 3300053156 Ga0500622_0003533 Ga0500622_0003533_7631_8497 279
177 3300053177 Ga0500636_0032308 Ga0500636_0032308_257_1123 279
178 3300053730 Ga0500645_019513 Ga0500645_019513_951_1796 279
179 3300053739 Ga0500587_001383 Ga0500587_001383_714_1580 279
180 iso_pu_bacteria 2585428058 2587731036 279
181 3300031238 Ga0265332_10000006 Ga0265332_10000006156 280
182 3300003320 rootH2_10200810 rootH2_102008104 281
183 3300003775 Ga0055524_1000177 Ga0055524_10001778 281
184 3300005330 Ga0070690_100010771 Ga0070690_1000107714 281
185 3300005331 Ga0070670_100109396 Ga0070670_1001093963 281
186 3300005333 Ga0070677_10089543 Ga0070677_100895431 281
187 3300005334 Ga0068869_100004127 Ga0068869_1000041272 281
188 3300005335 Ga0070666_10040034 Ga0070666_100400342 281
189 3300005343 Ga0070687_100039509 Ga0070687_1000395094 281
190 3300005347 Ga0070668_100006518 Ga0070668_1000065187 281
191 3300005353 Ga0070669_100016694 Ga0070669_1000166944 281
192 3300005354 Ga0070675_100020218 Ga0070675_1000202184 281
193 3300005354 Ga0070675_100037488 Ga0070675_1000374884 281
194 3300005354 Ga0070675_100096256 Ga0070675_1000962561 281
195 3300005356 Ga0070674_100014252 Ga0070674_1000142523 281
196 3300005356 Ga0070674_100030364 Ga0070674_1000303644 281
197 3300005356 Ga0070674_100170913 Ga0070674_1001709131 281
198 3300005364 Ga0070673_100120817 Ga0070673_1001208172 281
199 3300005367 Ga0070667_100004171 Ga0070667_1000041714 281
200 3300005455 Ga0070663_100068571 Ga0070663_1000685713 281
201 3300005456 Ga0070678_100032118 Ga0070678_1000321183 281
202 3300005456 Ga0070678_100045618 Ga0070678_1000456182 281
203 3300005457 Ga0070662_100036590 Ga0070662_1000365904 281
204 3300005459 Ga0068867_100039424 Ga0068867_1000394244 281
205 3300005539 Ga0068853_100105748 Ga0068853_1001057483 281
206 3300005543 Ga0070672_100052960 Ga0070672_1000529603 281
207 3300005543 Ga0070672_100107415 Ga0070672_1001074152 281
208 3300005543 Ga0070672_100421461 Ga0070672_1004214612 281
209 3300005544 Ga0070686_100046209 Ga0070686_1000462092 281
210 3300005563 Ga0068855_100047687 Ga0068855_1000476877 281
211 3300005616 Ga0068852_100068908 Ga0068852_1000689082 281
212 3300005616 Ga0068852_100073982 Ga0068852_1000739822 281
213 3300005617 Ga0068859_100073069 Ga0068859_1000730694 281
214 3300005718 Ga0068866_10009957 Ga0068866_100099572 281
215 3300005841 Ga0068863_100076295 Ga0068863_1000762952 281
216 3300005842 Ga0068858_100015233 Ga0068858_1000152337 281
217 3300005843 Ga0068860_100003706 Ga0068860_1000037062 281
218 3300006880 Ga0075429_100005450 Ga0075429_10000545013 281
219 3300006881 Ga0068865_100040344 Ga0068865_1000403442 281
220 3300006931 Ga0097620_100073059 Ga0097620_1000730594 281
221 3300009176 Ga0105242_10426001 Ga0105242_104260011 281
222 3300009177 Ga0105248_10094328 Ga0105248_100943283 281
223 3300009177 Ga0105248_10371048 Ga0105248_103710482 281
224 3300009553 Ga0105249_10038415 Ga0105249_100384153 281
225 3300013306 Ga0163162_10036592 Ga0163162_100365924 281
226 3300013308 Ga0157375_10087254 Ga0157375_100872543 281
227 3300014326 Ga0157380_10002399 Ga0157380_100023994 281
228 3300014968 Ga0157379_10037880 Ga0157379_100378804 281
229 3300014969 Ga0157376_10860723 Ga0157376_108607231 281
230 3300017792 Ga0163161_10020214 Ga0163161_100202143 281
231 3300025291 Ga0209675_1024798 Ga0209675_10247982 281
232 3300025893 Ga0207682_10005552 Ga0207682_100055524 281
233 3300025899 Ga0207642_10004712 Ga0207642_100047124 281
234 3300025903 Ga0207680_10048205 Ga0207680_100482052 281
235 3300025907 Ga0207645_10014853 Ga0207645_100148534 281
236 3300025907 Ga0207645_10090254 Ga0207645_100902542 281
237 3300025918 Ga0207662_10065583 Ga0207662_100655831 281
238 3300025923 Ga0207681_10008284 Ga0207681_100082846 281
239 3300025925 Ga0207650_10003035 Ga0207650_1000303510 281
240 3300025926 Ga0207659_10021453 Ga0207659_100214533 281
241 3300025926 Ga0207659_10066675 Ga0207659_100666753 281
242 3300025926 Ga0207659_10143457 Ga0207659_101434572 281
243 3300025933 Ga0207706_10037340 Ga0207706_100373403 281
244 3300025937 Ga0207669_10041683 Ga0207669_100416832 281
245 3300025940 Ga0207691_10071435 Ga0207691_100714353 281
246 3300025940 Ga0207691_10074458 Ga0207691_100744582 281
247 3300025941 Ga0207711_10225300 Ga0207711_102253002 281
248 3300025942 Ga0207689_10024283 Ga0207689_100242833 281
249 3300025960 Ga0207651_10020525 Ga0207651_100205254 281
250 3300025961 Ga0207712_10027752 Ga0207712_100277522 281
251 3300025972 Ga0207668_10010018 Ga0207668_100100184 281
252 3300025986 Ga0207658_10069660 Ga0207658_100696602 281
253 3300026023 Ga0207677_10184347 Ga0207677_101843472 281
254 3300026035 Ga0207703_10005289 Ga0207703_100052894 281
255 3300026067 Ga0207678_10035571 Ga0207678_100355713 281
256 3300026088 Ga0207641_10011024 Ga0207641_100110247 281
257 3300026089 Ga0207648_10066618 Ga0207648_100666182 281
258 3300026121 Ga0207683_10025332 Ga0207683_100253324 281
259 3300026121 Ga0207683_10071748 Ga0207683_100717483 281
260 3300027876 Ga0209974_10001465 Ga0209974_100014658 281
261 3300028381 Ga0268264_10009546 Ga0268264_100095467 281
262 3300028794 Ga0307515_10003433 Ga0307515_1000343326 281
263 3300028794 Ga0307515_10007780 Ga0307515_1000778015 281
264 3300030522 Ga0307512_10026236 Ga0307512_100262363 281
265 3300031456 Ga0307513_10010890 Ga0307513_1001089010 281
266 3300031616 Ga0307508_10001204 Ga0307508_100012045 281
267 3300031649 Ga0307514_10024322 Ga0307514_100243225 281
268 3300031852 Ga0307410_10127505 Ga0307410_101275052 281
269 3300033179 Ga0307507_10070098 Ga0307507_100700984 281
270 3300044656 Ga0466969_0002962 Ga0466969_0002962_6965_7819 281
271 3300044658 Ga0466972_0049068 Ga0466972_0049068_852_1697 281
272 3300044684 Ga0466966_0032885 Ga0466966_0032885_1562_2416 281
273 3300044719 Ga0466971_0101331 Ga0466971_0101331_379_1233 281
274 3300044765 Ga0466970_0052008 Ga0466970_0052008_1270_2124 281
275 3300044901 Ga0466960_0059170 Ga0466960_0059170_199_1044 281
276 3300046512 Ga0495610_0018904 Ga0495610_0018904_2165_3016 281
277 3300046519 Ga0495632_0040420 Ga0495632_0040420_413_1264 281
278 3300046681 Ga0495647_0012684 Ga0495647_0012684_492_1343 281
279 3300046683 Ga0495658_0053960 Ga0495658_0053960_1391_2242 281
280 3300053117 Ga0500593_000589 Ga0500593_000589_9724_10581 281
281 3300053739 Ga0500587_008478 Ga0500587_008478_88_939 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08668

HDOD

HDOD domain

79

279

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p3q-assembly3.cif.gz_A crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.7302 28 276
3p3q-assembly3.cif.gz_A crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.7117 28 276
3p3q-assembly3.cif.gz_B crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.7115 25 276
3p3q-assembly3.cif.gz_B crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.7019 25 276
3ljx-assembly1.cif.gz_A crystal structure of mmoq response regulator (fragment 20-298) from methylococcus capsulatus str. bath, northeast structural genomics consortium target mcr175g 0.7012 28 268
ID Description Score Start End Superfamily
3ljvB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7328 28 268 1.10.3210.10
3p3qA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7292 28 276 1.10.3210.10
3p3qA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7131 28 276 1.10.3210.10
3ljvB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7069 28 268 1.10.3210.10
1vqrD00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6241 19 266 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1G8ZIK5-F1-model_v4 HD-like signal output (HDOD) domain, no enzymatic activity 0.9686 17 277
AF-A0A1R1I1L7-F1-model_v4 HDOD domain-containing protein 0.9676 10 277
AF-A0A5C7JYG3-F1-model_v4 HDOD domain-containing protein 0.9652 10 277
AF-A0A3D1WFR5-F1-model_v4 Histidine kinase 0.9646 7 280 GO:0016301
AF-A0A1G3HQ63-F1-model_v4 HDOD domain-containing protein 0.9642 10 276

Feature Viewer

pLDDT pTM Quality
91.87 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map