F384165

General Info

Members Datasets Scaffolds Average Seq Length
281 172 266 318

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000817|Ga0068855_10000081731
Length 378
Sequence MRTPLSGPEVCGASGEGQAVVGSVTGESILGSANFSGDFARADAVTLQATKSTNRMEELPMASRHLVDPDFLHLLDALPTFDLTAEALPQIRAGLAERAASLAPEPDDSVTVTEQVVPGRDGKPDVRVMVYRPADAVGELPAMLHLHPGGFIMGGPFMRDPRNRYLAKAVGCVIVSVVYRLAPEHPYPAALEDAYTALTWLHAEGATIGADTTRIAISGDSAGGGLAAALAQMAHDKGEVPILFQALTYPMLDNRSGATVDRGAFVGQYMWSADANRFAWQALLGENHHEQDQPPYAVPAHRADLAGLPPTFIAVGALDLFVEEDIDYARRLIHAGVPTELHVYPGAFHGFDSTPQAWSTENYVAQLVSSLKRALHPR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
5 2619618881 Frankia sp. ACN1ag Isolate Unclassified
6 2619619003 Frankia sp. CpI1-P Isolate Nodule
7 2626541554 Frankia sp. AvcI.1 Isolate Nodule
8 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
9 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
147 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
148 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
149 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
150 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
164 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
165 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
169 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
172 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.39
Nodule 1.42
Rhizoplane 10.68
Rhizosphere 58.72
Stem 0
Stem Tuber 0
Unclassified 17.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_234738 2162886007 Bacteria 74037
2 SwRhRL2b_contig_3367114 2162886007 Bacteria 9630
3 JGI24751J29686_10000187 3300002459 Bacteria 27852
4 JGI25165J46597_1000156 3300003214 Bacteria 109696
5 rootH2_10332287 3300003320 Bacteria 1186
6 rootL2_10213738 3300003322 Unclassified 1521
7 Ga0055530_10009530 3300003791 Bacteria 3716
8 Ga0065704_10000463 3300005289 Bacteria 20938
9 Ga0065704_10006773 3300005289 Bacteria 2650
10 Ga0065704_10070166 3300005289 Bacteria 176609
11 Ga0065707_10085431 3300005295 Bacteria 6158
12 Ga0070658_10268611 3300005327 Bacteria 1450
13 Ga0070690_100182562 3300005330 Bacteria 1450
14 Ga0070670_100077040 3300005331 Bacteria 2865
15 Ga0070670_100515011 3300005331 Bacteria 1065
16 Ga0070666_10069937 3300005335 Bacteria 2387
17 Ga0070689_100079093 3300005340 Bacteria 2578
18 Ga0070689_100247180 3300005340 Bacteria 1471
19 Ga0070668_100016713 3300005347 Bacteria 5484
20 Ga0070668_100166412 3300005347 Bacteria 1792
21 Ga0070668_100284109 3300005347 Bacteria 1383
22 Ga0070669_100081454 3300005353 Bacteria 2411
23 Ga0070669_100242217 3300005353 Bacteria 1433
24 Ga0070671_100000062 3300005355 Bacteria 73417
25 Ga0070671_100010782 3300005355 Bacteria 7332
26 Ga0070671_100029082 3300005355 Bacteria 4556
27 Ga0070671_100039242 3300005355 Bacteria 3930
28 Ga0070667_100050003 3300005367 Bacteria 3521
29 Ga0070713_100212312 3300005436 Bacteria 1753
30 Ga0070679_100105262 3300005530 Bacteria 2808
31 Ga0068853_100147278 3300005539 Bacteria 2117
32 Ga0070665_100065700 3300005548 Bacteria 3638
33 Ga0070665_100070755 3300005548 Bacteria 3495
34 Ga0068855_100000641 3300005563 Bacteria 42804
35 Ga0068855_100000817 3300005563 Bacteria 38486
36 Ga0068855_100010641 3300005563 Bacteria 11095
37 Ga0068855_100011732 3300005563 Bacteria 10593
38 Ga0068855_100268613 3300005563 Bacteria 1897
39 Ga0068856_100095624 3300005614 Bacteria 2959
40 Ga0068852_100194111 3300005616 Bacteria 1918
41 Ga0068852_100215299 3300005616 Bacteria 1825
42 Ga0068864_100000038 3300005618 Bacteria 181005
43 Ga0068864_100019822 3300005618 Bacteria 5623
44 Ga0068863_100000026 3300005841 Bacteria 185590
45 Ga0068863_100059417 3300005841 Bacteria 3617
46 Ga0068863_100098737 3300005841 Bacteria 2773
47 Ga0068858_100000810 3300005842 Bacteria 32726
48 Ga0068858_100005132 3300005842 Bacteria 12834
49 Ga0068858_100027759 3300005842 Bacteria 5259
50 Ga0068858_100036171 3300005842 Bacteria 4578
51 Ga0068860_100051995 3300005843 Bacteria 3897
52 Ga0068862_100373689 3300005844 Bacteria 1328
53 Ga0081455_10000940 3300005937 Bacteria 37224
54 Ga0081455_10045432 3300005937 Bacteria 3821
55 Ga0081539_10068716 3300005985 Unclassified 1910
56 Ga0075365_10036281 3300006038 Bacteria 3194
57 Ga0075368_10000249 3300006042 Bacteria 15296
58 Ga0075363_100000182 3300006048 Bacteria 16597
59 Ga0075367_10000340 3300006178 Bacteria 16605
60 Ga0075367_10000393 3300006178 Bacteria 15951
61 Ga0075369_10022869 3300006186 Bacteria 2580
62 Ga0097621_100266543 3300006237 Bacteria 1504
63 Ga0075370_10007210 3300006353 Bacteria 5651
64 Ga0075370_10040023 3300006353 Bacteria 2643
65 Ga0105250_10000013 3300009092 Bacteria 271050
66 Ga0105240_10045833 3300009093 Bacteria 5545
67 Ga0105240_10090728 3300009093 Bacteria 3734
68 Ga0105247_10034056 3300009101 Bacteria 3102
69 Ga0105248_10002260 3300009177 Bacteria 21349
70 Ga0105248_10003031 3300009177 Bacteria 18634
71 Ga0105248_10147746 3300009177 Bacteria 2652
72 Ga0105248_10300851 3300009177 Bacteria 1806
73 Ga0105238_10011940 3300009551 Bacteria 8752
74 Ga0105249_10029794 3300009553 Bacteria 4931
75 Ga0105148_100205 3300009978 Bacteria 8684
76 Ga0105239_10050474 3300010375 Bacteria 4563
77 Ga0163162_10072546 3300013306 Bacteria 3498
78 Ga0157380_10054402 3300014326 Bacteria 3176
79 Ga0157380_10133899 3300014326 Bacteria 2118
80 Ga0157379_10001585 3300014968 Bacteria 18743
81 Ga0163161_10001170 3300017792 Bacteria 19695
82 Ga0163161_10111447 3300017792 Bacteria 2046
83 Ga0213875_10000135 3300021388 Bacteria 82147
84 Ga0209233_1000213 3300025261 Bacteria 109881
85 Ga0209050_1000504 3300025298 Bacteria 66436
86 Ga0207426_1000662 3300025302 Bacteria 42226
87 Ga0207696_1000072 3300025711 Bacteria 224214
88 Ga0207710_10061345 3300025900 Bacteria 1706
89 Ga0207695_10007037 3300025913 Bacteria 14434
90 Ga0207695_10032422 3300025913 Bacteria 5716
91 Ga0207652_10118164 3300025921 Bacteria 2356
92 Ga0207681_10000536 3300025923 Bacteria 26182
93 Ga0207650_10061349 3300025925 Bacteria 2807
94 Ga0207650_10243520 3300025925 Bacteria 1454
95 Ga0207644_10000005 3300025931 Bacteria 441948
96 Ga0207670_10195781 3300025936 Bacteria 1532
97 Ga0207711_10005039 3300025941 Bacteria 11200
98 Ga0207711_10014022 3300025941 Bacteria 6658
99 Ga0207711_10329591 3300025941 Bacteria 1412
100 Ga0207667_10005169 3300025949 Bacteria 15940
101 Ga0207667_10010733 3300025949 Bacteria 10684
102 Ga0207667_10023972 3300025949 Bacteria 6712
103 Ga0207667_10061578 3300025949 Unclassified 3925
104 Ga0207667_10138130 3300025949 Bacteria 2510
105 Ga0207668_10093632 3300025972 Bacteria 2214
106 Ga0207658_10026751 3300025986 Bacteria 4048
107 Ga0207703_10000716 3300026035 Bacteria 32692
108 Ga0207703_10002633 3300026035 Bacteria 15470
109 Ga0207703_10026177 3300026035 Bacteria 4590
110 Ga0207703_10041481 3300026035 Bacteria 3687
111 Ga0207639_10092888 3300026041 Bacteria 2419
112 Ga0207641_10000005 3300026088 Bacteria 470841
113 Ga0207676_10000049 3300026095 Bacteria 133695
114 Ga0207676_10051897 3300026095 Bacteria 3204
115 Ga0207676_10112038 3300026095 Bacteria 2285
116 Ga0207698_10399858 3300026142 Bacteria 1312
117 Ga0209813_10000010 3300027866 Bacteria 97592
118 Ga0268266_10104399 3300028379 Bacteria 2502
119 Ga0268266_10349593 3300028379 Bacteria 1389
120 Ga0307515_10077088 3300028794 Bacteria 4408
121 Ga0265338_10043148 3300028800 Bacteria 4188
122 Ga0265320_10105423 3300031240 Bacteria 1296
123 Ga0265327_10056034 3300031251 Bacteria 2033
124 Ga0307513_10063950 3300031456 Bacteria 3881
125 Ga0307413_10014037 3300031824 Bacteria 4052
126 Ga0307415_100288159 3300032126 Bacteria 1354
127 Ga0307510_10032242 3300033180 Bacteria 5904
128 Ga0373956_0004876 3300035119 Bacteria 5372
129 Ga0373931_0000027 3300035691 Bacteria 123672
130 Ga0436364_0567527 3300037853 Bacteria 8075
131 Ga0436364_1211536 3300037853 Bacteria 67143
132 Ga0400483_160331 3300039062 Bacteria 13915
133 Ga0495638_0091590 3300046460 Bacteria 1831
134 Ga0495650_0000163 3300046471 Bacteria 148569
135 Ga0495583_0000333 3300046506 Bacteria 74698
136 Ga0495583_0021131 3300046506 Bacteria 3353
137 Ga0495610_0021165 3300046512 Bacteria 3583
138 Ga0495654_0034413 3300046530 Bacteria 2556
139 Ga0495633_0048417 3300046558 Bacteria 2007
140 Ga0495668_0018295 3300046616 Bacteria 4049
141 Ga0495625_0011794 3300046660 Bacteria 7100
142 Ga0495588_0198947 3300046674 Bacteria 1058
143 Ga0495600_0010175 3300046809 Bacteria 5828
144 Ga0495675_0016538 3300047444 Bacteria 4666
145 Ga0495677_0003835 3300047445 Bacteria 5819
146 Ga0495677_0007508 3300047445 Bacteria 4070
147 Ga0495686_0044355 3300047472 Bacteria 2816
148 Ga0496100_0129876 3300048903 Bacteria 1773
149 Ga0496101_0018259 3300048904 Bacteria 4767
150 Ga0496102_0000178 3300048905 Bacteria 86174
151 Ga0496103_0000119 3300048906 Bacteria 86194
152 Ga0496103_0040875 3300048906 Bacteria 2850
153 Ga0496104_0004286 3300048907 Bacteria 12405
154 Ga0496105_0059230 3300048908 Bacteria 3160
155 Ga0496105_0070685 3300048908 Bacteria 2885
156 Ga0496106_0003563 3300048909 Bacteria 11595
157 Ga0496107_0013029 3300048910 Bacteria 5808
158 Ga0496108_0004245 3300048911 Bacteria 11539
159 Ga0496108_0029161 3300048911 Bacteria 4569
160 Ga0496108_0224600 3300048911 Bacteria 1632
161 Ga0496108_0302879 3300048911 Bacteria 1392
162 Ga0496109_0036486 3300048912 Bacteria 4437
163 Ga0496109_0200628 3300048912 Bacteria 1875
164 Ga0496110_0007686 3300048913 Bacteria 8626
165 Ga0496110_0041772 3300048913 Bacteria 4002
166 Ga0496110_0111835 3300048913 Bacteria 2455
167 Ga0496110_0313509 3300048913 Bacteria 1428
168 Ga0496111_0008169 3300048914 Bacteria 6917
169 Ga0496111_0051398 3300048914 Bacteria 2975
170 Ga0496111_0094780 3300048914 Bacteria 2189
171 Ga0496112_0171992 3300048915 Bacteria 2131
172 Ga0496113_0001455 3300048916 Bacteria 13176
173 Ga0496113_0050349 3300048916 Bacteria 3105
174 Ga0496114_0006234 3300048917 Bacteria 9386
175 Ga0496114_0095000 3300048917 Bacteria 2536
176 Ga0496115_0000740 3300048918 Bacteria 24162
177 Ga0496116_0019188 3300048919 Bacteria 5242
178 Ga0496116_0033723 3300048919 Bacteria 3627
179 Ga0496116_0084807 3300048919 Bacteria 1950
180 Ga0496117_0000318 3300048920 Bacteria 84351
181 Ga0496117_0005453 3300048920 Bacteria 13347
182 Ga0496117_0174822 3300048920 Bacteria 1242
183 Ga0496118_0000186 3300048921 Bacteria 108940
184 Ga0496118_0028402 3300048921 Bacteria 4711
185 Ga0496119_0000399 3300048922 Bacteria 59637
186 Ga0496119_0055946 3300048922 Bacteria 2393
187 Ga0496120_0000074 3300048923 Bacteria 164098
188 Ga0496120_0044122 3300048923 Bacteria 2592
189 Ga0496121_0001102 3300048924 Bacteria 47573
190 Ga0496121_0018638 3300048924 Bacteria 6987
191 Ga0496121_0031716 3300048924 Bacteria 4821
192 Ga0496122_0003669 3300048925 Bacteria 19924
193 Ga0496122_0013754 3300048925 Bacteria 7890
194 Ga0496122_0051456 3300048925 Bacteria 3129
195 Ga0496122_0085235 3300048925 Bacteria 2181
196 Ga0496122_0152790 3300048925 Bacteria 1422
197 Ga0496123_0002385 3300048926 Bacteria 23545
198 Ga0496123_0008795 3300048926 Bacteria 9207
199 Ga0496124_0000324 3300048927 Bacteria 88327
200 Ga0496124_0001086 3300048927 Bacteria 42885
201 Ga0496124_0013882 3300048927 Bacteria 7832
202 Ga0496124_0039358 3300048927 Bacteria 4099
203 Ga0496125_0001890 3300048928 Bacteria 28768
204 Ga0496125_0006075 3300048928 Bacteria 13184
205 Ga0496125_0008335 3300048928 Bacteria 10874
206 Ga0496125_0031545 3300048928 Bacteria 4721
207 Ga0496125_0040990 3300048928 Bacteria 3964
208 Ga0496126_0000452 3300048929 Bacteria 81928
209 Ga0496126_0001180 3300048929 Bacteria 42930
210 Ga0496126_0003102 3300048929 Bacteria 21478
211 Ga0496126_0016407 3300048929 Bacteria 7408
212 Ga0496126_0026416 3300048929 Bacteria 5568
213 Ga0496126_0039241 3300048929 Bacteria 4396
214 Ga0501032_0004258 3300049569 Bacteria 10810
215 Ga0501032_0024560 3300049569 Bacteria 4159
216 Ga0501033_0050063 3300049570 Bacteria 3100
217 Ga0501034_0075082 3300049571 Bacteria 3388
218 Ga0501036_0004817 3300049572 Bacteria 10909
219 Ga0501036_0389430 3300049572 Bacteria 1163
220 Ga0501037_0053035 3300049573 Bacteria 2965
221 Ga0501038_0121215 3300049574 Bacteria 2156
222 Ga0501039_0131489 3300049575 Bacteria 1964
223 Ga0501043_0030086 3300049579 Bacteria 4265
224 Ga0501047_0004550 3300049581 Bacteria 13042
225 Ga0501047_0052601 3300049581 Bacteria 3936
226 Ga0501047_0062301 3300049581 Bacteria 3598
227 Ga0501070_0011365 3300049586 Bacteria 7524
228 Ga0501070_0038855 3300049586 Bacteria 3971
229 Ga0501070_0086596 3300049586 Bacteria 2593
230 Ga0501073_0160112 3300049589 Bacteria 1560
231 Ga0501074_0084724 3300049590 Bacteria 2272
232 Ga0501223_000024 3300049663 Bacteria 59339
233 Ga0501223_000031 3300049663 Bacteria 51024
234 Ga0501224_000001 3300049664 Bacteria 308131
235 Ga0501233_000788 3300049668 Bacteria 5299
236 Ga0501235_000599 3300049669 Bacteria 7271
237 Ga0501235_000931 3300049669 Bacteria 6044
238 Ga0501225_0000093 3300049705 Bacteria 28572
239 Ga0501225_0000504 3300049705 Bacteria 12155
240 Ga0501225_0006237 3300049705 Bacteria 3484
241 Ga0501080_0070930 3300049742 Bacteria 3240
242 Ga0501035_0003631 3300049822 Bacteria 14718
243 Ga0501035_0027264 3300049822 Bacteria 5221
244 Ga0501044_0006132 3300049823 Bacteria 13272
245 Ga0501044_0006969 3300049823 Bacteria 12433
246 Ga0501044_0049082 3300049823 Bacteria 4356
247 Ga0501045_0082533 3300049824 Bacteria 2370
248 Ga0501226_000029 3300049853 Bacteria 82723
249 nmdc:mga03n38_1453_c1 3300050490 Bacteria 6800
250 nmdc:mga0yw44_9309_c1 3300050492 Bacteria 4955
251 nmdc:mga06z11_68_c1 3300050494 Bacteria 42759
252 nmdc:mga06z11_83528_c1 3300050494 Bacteria 1719
253 nmdc:mga04h51_36_c1 3300050495 Bacteria 45993
254 nmdc:mga07m45_3125_c1 3300050496 Bacteria 7932
255 nmdc:mga07m45_37867_c1 3300050496 Bacteria 2691
256 nmdc:mga0sz30_64861_c1 3300050516 Bacteria 1565
257 Ga0500643_002234 3300053087 Bacteria 10215
258 Ga0500569_053894 3300053109 Bacteria 1222
259 Ga0500592_000002 3300053116 Bacteria 141670
260 Ga0500595_000774 3300053119 Bacteria 18727
261 Ga0500559_0011051 3300053136 Bacteria 3866
262 Ga0500559_0056066 3300053136 Bacteria 1749
263 Ga0500616_0090193 3300053153 Bacteria 1520
264 Ga0500619_011232 3300053154 Bacteria 2296
265 Ga0500627_0000026 3300053158 Bacteria 100362
266 Ga0500636_0000577 3300053177 Bacteria 20072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0011794 Ga0495625_0011794_14_877 281
2 3300035119 Ga0373956_0004876 Ga0373956_0004876_3484_4485 288
3 3300053087 Ga0500643_002234 Ga0500643_002234_6254_7150 290
4 3300039062 Ga0400483_160331 Ga0400483_160331_1488_2444 296
5 3300006186 Ga0075369_10022869 Ga0075369_100228692 298
6 3300031240 Ga0265320_10105423 Ga0265320_101054232 298
7 3300048922 Ga0496119_0055946 Ga0496119_0055946_1121_2020 298
8 3300048927 Ga0496124_0013882 Ga0496124_0013882_445_1344 298
9 3300050516 nmdc:mga0sz30_64861_c1 nmdc:mga0sz30_64861_c1_68_1018 298
10 3300047445 Ga0495677_0003835 Ga0495677_0003835_743_1714 299
11 3300005330 Ga0070690_100182562 Ga0070690_1001825621 300
12 3300005355 Ga0070671_100000062 Ga0070671_10000006218 300
13 3300005841 Ga0068863_100098737 Ga0068863_1000987371 300
14 3300005843 Ga0068860_100051995 Ga0068860_1000519953 300
15 3300009177 Ga0105248_10300851 Ga0105248_103008512 300
16 3300025931 Ga0207644_10000005 Ga0207644_1000000543 300
17 3300035691 Ga0373931_0000027 Ga0373931_0000027_61978_62898 300
18 3300048908 Ga0496105_0059230 Ga0496105_0059230_298_1284 300
19 3300048911 Ga0496108_0302879 Ga0496108_0302879_212_1198 300
20 3300048914 Ga0496111_0094780 Ga0496111_0094780_329_1315 300
21 3300048915 Ga0496112_0171992 Ga0496112_0171992_914_1900 300
22 3300048916 Ga0496113_0001455 Ga0496113_0001455_719_1705 300
23 iso_pu_bacteria 2558860280 2559431055 300
24 3300005355 Ga0070671_100010782 Ga0070671_1000107826 302
25 3300005842 Ga0068858_100027759 Ga0068858_1000277593 302
26 3300026035 Ga0207703_10041481 Ga0207703_100414813 302
27 iso_pu_bacteria 2863067949 2863068507 303
28 3300048922 Ga0496119_0000399 Ga0496119_0000399_29663_30613 304
29 3300048923 Ga0496120_0000074 Ga0496120_0000074_29033_29983 304
30 3300048929 Ga0496126_0026416 Ga0496126_0026416_2442_3443 304
31 3300005340 Ga0070689_100247180 Ga0070689_1002471801 305
32 3300005548 Ga0070665_100070755 Ga0070665_1000707555 305
33 3300005618 Ga0068864_100000038 Ga0068864_10000003848 305
34 3300005841 Ga0068863_100000026 Ga0068863_10000002647 305
35 3300005841 Ga0068863_100059417 Ga0068863_1000594172 305
36 3300005842 Ga0068858_100000810 Ga0068858_1000008102 305
37 3300006038 Ga0075365_10036281 Ga0075365_100362813 305
38 3300006048 Ga0075363_100000182 Ga0075363_1000001824 305
39 3300006178 Ga0075367_10000393 Ga0075367_100003932 305
40 3300006353 Ga0075370_10007210 Ga0075370_100072102 305
41 3300009101 Ga0105247_10034056 Ga0105247_100340562 305
42 3300009177 Ga0105248_10003031 Ga0105248_100030319 305
43 3300013306 Ga0163162_10072546 Ga0163162_100725462 305
44 3300014326 Ga0157380_10133899 Ga0157380_101338992 305
45 3300025900 Ga0207710_10061345 Ga0207710_100613452 305
46 3300025936 Ga0207670_10195781 Ga0207670_101957812 305
47 3300025941 Ga0207711_10014022 Ga0207711_100140224 305
48 3300025941 Ga0207711_10329591 Ga0207711_103295912 305
49 3300026035 Ga0207703_10000716 Ga0207703_100007162 305
50 3300026088 Ga0207641_10000005 Ga0207641_10000005259 305
51 3300026095 Ga0207676_10000049 Ga0207676_10000049119 305
52 3300028800 Ga0265338_10043148 Ga0265338_100431483 305
53 3300031824 Ga0307413_10014037 Ga0307413_100140372 305
54 3300032126 Ga0307415_100288159 Ga0307415_1002881592 305
55 3300048912 Ga0496109_0200628 Ga0496109_0200628_577_1557 305
56 3300050490 nmdc:mga03n38_1453_c1 nmdc:mga03n38_1453_c1_4093_5043 305
57 3300050492 nmdc:mga0yw44_9309_c1 nmdc:mga0yw44_9309_c1_1464_2414 305
58 3300050494 nmdc:mga06z11_83528_c1 nmdc:mga06z11_83528_c1_713_1663 305
59 3300050496 nmdc:mga07m45_3125_c1 nmdc:mga07m45_3125_c1_3025_3975 305
60 3300053109 Ga0500569_053894 Ga0500569_053894_98_1048 305
61 3300053153 Ga0500616_0090193 Ga0500616_0090193_552_1502 305
62 3300048905 Ga0496102_0000178 Ga0496102_0000178_32760_33692 306
63 3300048906 Ga0496103_0000119 Ga0496103_0000119_72942_73874 306
64 3300048907 Ga0496104_0004286 Ga0496104_0004286_8374_9306 306
65 3300048908 Ga0496105_0070685 Ga0496105_0070685_1567_2499 306
66 3300048914 Ga0496111_0008169 Ga0496111_0008169_4147_5079 306
67 3300048917 Ga0496114_0006234 Ga0496114_0006234_2934_3866 306
68 3300048918 Ga0496115_0000740 Ga0496115_0000740_10784_11716 306
69 3300048920 Ga0496117_0000318 Ga0496117_0000318_70979_71911 306
70 3300048921 Ga0496118_0000186 Ga0496118_0000186_32771_33703 306
71 3300048923 Ga0496120_0044122 Ga0496120_0044122_989_1921 306
72 3300048924 Ga0496121_0018638 Ga0496121_0018638_2960_3892 306
73 3300048925 Ga0496122_0051456 Ga0496122_0051456_1974_2906 306
74 3300048927 Ga0496124_0000324 Ga0496124_0000324_12432_13364 306
75 3300048928 Ga0496125_0001890 Ga0496125_0001890_12450_13382 306
76 3300048929 Ga0496126_0001180 Ga0496126_0001180_12433_13365 306
77 iso_pu_bacteria 2579778521 2579856765 306
78 iso_pu_bacteria 2619618881 2619857719 306
79 iso_pu_bacteria 2619619003 2620352078 306
80 iso_pu_bacteria 2626541554 2626639683 306
81 iso_pu_bacteria 8054913762 8054919842 306
82 iso_pu_bacteria 8054920844 8054923191 306
83 3300002459 JGI24751J29686_10000187 JGI24751J29686_1000018713 307
84 3300037853 Ga0436364_0567527 Ga0436364_0567527_6658_7617 307
85 3300005327 Ga0070658_10268611 Ga0070658_102686112 308
86 3300005530 Ga0070679_100105262 Ga0070679_1001052623 308
87 3300005539 Ga0068853_100147278 Ga0068853_1001472782 308
88 3300005563 Ga0068855_100000641 Ga0068855_10000064136 308
89 3300006237 Ga0097621_100266543 Ga0097621_1002665431 308
90 3300010375 Ga0105239_10050474 Ga0105239_100504744 308
91 3300025913 Ga0207695_10032422 Ga0207695_100324223 308
92 3300025921 Ga0207652_10118164 Ga0207652_101181642 308
93 3300025949 Ga0207667_10005169 Ga0207667_100051698 308
94 3300026041 Ga0207639_10092888 Ga0207639_100928883 308
95 3300046512 Ga0495610_0021165 Ga0495610_0021165_2242_3183 309
96 3300047444 Ga0495675_0016538 Ga0495675_0016538_3513_4463 309
97 3300049586 Ga0501070_0038855 Ga0501070_0038855_2746_3723 309
98 iso_pu_bacteria 2643221605 2644038359 309
99 3300005563 Ga0068855_100010641 Ga0068855_1000106412 310
100 3300005985 Ga0081539_10068716 Ga0081539_100687162 310
101 3300009093 Ga0105240_10045833 Ga0105240_100458338 310
102 3300009551 Ga0105238_10011940 Ga0105238_100119407 310
103 3300025949 Ga0207667_10061578 Ga0207667_100615782 310
104 3300003791 Ga0055530_10009530 Ga0055530_100095303 311
105 3300005335 Ga0070666_10069937 Ga0070666_100699372 311
106 3300005340 Ga0070689_100079093 Ga0070689_1000790931 311
107 3300005347 Ga0070668_100016713 Ga0070668_1000167131 311
108 3300005355 Ga0070671_100000062 Ga0070671_10000006219 311
109 3300005548 Ga0070665_100070755 Ga0070665_1000707554 311
110 3300005843 Ga0068860_100051995 Ga0068860_1000519952 311
111 3300005844 Ga0068862_100373689 Ga0068862_1003736892 311
112 3300009177 Ga0105248_10147746 Ga0105248_101477463 311
113 3300021388 Ga0213875_10000135 Ga0213875_1000013543 311
114 3300025298 Ga0209050_1000504 Ga0209050_100050444 311
115 3300025302 Ga0207426_1000662 Ga0207426_100066220 311
116 3300025923 Ga0207681_10000536 Ga0207681_1000053624 311
117 3300025931 Ga0207644_10000005 Ga0207644_1000000544 311
118 3300026095 Ga0207676_10112038 Ga0207676_101120382 311
119 3300028379 Ga0268266_10349593 Ga0268266_103495932 311
120 3300037853 Ga0436364_1211536 Ga0436364_1211536_48953_49924 311
121 3300046674 Ga0495588_0198947 Ga0495588_0198947_25_969 311
122 3300048903 Ga0496100_0129876 Ga0496100_0129876_351_1310 311
123 3300048904 Ga0496101_0018259 Ga0496101_0018259_139_1098 311
124 3300048906 Ga0496103_0040875 Ga0496103_0040875_594_1553 311
125 3300048908 Ga0496105_0059230 Ga0496105_0059230_1478_2437 311
126 3300048909 Ga0496106_0003563 Ga0496106_0003563_71_1030 311
127 3300048910 Ga0496107_0013029 Ga0496107_0013029_2675_3634 311
128 3300048913 Ga0496110_0313509 Ga0496110_0313509_17_976 311
129 3300048929 Ga0496126_0000452 Ga0496126_0000452_60199_61146 311
130 3300049569 Ga0501032_0004258 Ga0501032_0004258_2172_3134 311
131 3300049569 Ga0501032_0024560 Ga0501032_0024560_2122_3084 311
132 3300049570 Ga0501033_0050063 Ga0501033_0050063_510_1472 311
133 3300049571 Ga0501034_0075082 Ga0501034_0075082_1176_2138 311
134 3300049572 Ga0501036_0004817 Ga0501036_0004817_310_1272 311
135 3300049573 Ga0501037_0053035 Ga0501037_0053035_1500_2462 311
136 3300049574 Ga0501038_0121215 Ga0501038_0121215_760_1722 311
137 3300049575 Ga0501039_0131489 Ga0501039_0131489_653_1615 311
138 3300049579 Ga0501043_0030086 Ga0501043_0030086_2124_3086 311
139 3300049581 Ga0501047_0052601 Ga0501047_0052601_2682_3644 311
140 3300049581 Ga0501047_0062301 Ga0501047_0062301_2060_3022 311
141 3300049586 Ga0501070_0086596 Ga0501070_0086596_1266_2228 311
142 3300049822 Ga0501035_0003631 Ga0501035_0003631_11455_12417 311
143 3300049822 Ga0501035_0027264 Ga0501035_0027264_3146_4108 311
144 3300049823 Ga0501044_0006969 Ga0501044_0006969_2197_3159 311
145 3300049823 Ga0501044_0049082 Ga0501044_0049082_1894_2856 311
146 3300049824 Ga0501045_0082533 Ga0501045_0082533_1327_2289 311
147 3300005295 Ga0065707_10085431 Ga0065707_100854313 312
148 3300005347 Ga0070668_100166412 Ga0070668_1001664122 312
149 3300005367 Ga0070667_100050003 Ga0070667_1000500033 312
150 3300005436 Ga0070713_100212312 Ga0070713_1002123122 312
151 3300005563 Ga0068855_100011732 Ga0068855_1000117325 312
152 3300005563 Ga0068855_100268613 Ga0068855_1002686132 312
153 3300005614 Ga0068856_100095624 Ga0068856_1000956243 312
154 3300005616 Ga0068852_100194111 Ga0068852_1001941113 312
155 3300005842 Ga0068858_100005132 Ga0068858_1000051325 312
156 3300005937 Ga0081455_10000940 Ga0081455_1000094018 312
157 3300005937 Ga0081455_10045432 Ga0081455_100454323 312
158 3300009093 Ga0105240_10090728 Ga0105240_100907284 312
159 3300025913 Ga0207695_10007037 Ga0207695_100070378 312
160 3300025949 Ga0207667_10023972 Ga0207667_100239725 312
161 3300025949 Ga0207667_10138130 Ga0207667_101381302 312
162 3300025986 Ga0207658_10026751 Ga0207658_100267514 312
163 3300026035 Ga0207703_10002633 Ga0207703_1000263316 312
164 3300026142 Ga0207698_10399858 Ga0207698_103998581 312
165 3300028794 Ga0307515_10077088 Ga0307515_100770883 312
166 3300031251 Ga0265327_10056034 Ga0265327_100560342 312
167 3300031456 Ga0307513_10063950 Ga0307513_100639502 312
168 3300033180 Ga0307510_10032242 Ga0307510_100322425 312
169 3300046460 Ga0495638_0091590 Ga0495638_0091590_467_1429 312
170 3300046506 Ga0495583_0021131 Ga0495583_0021131_369_1331 312
171 3300046530 Ga0495654_0034413 Ga0495654_0034413_935_1993 312
172 3300046616 Ga0495668_0018295 Ga0495668_0018295_2803_3765 312
173 3300047445 Ga0495677_0007508 Ga0495677_0007508_251_1210 312
174 3300047472 Ga0495686_0044355 Ga0495686_0044355_1170_2117 312
175 3300048911 Ga0496108_0224600 Ga0496108_0224600_637_1596 312
176 3300048913 Ga0496110_0041772 Ga0496110_0041772_2925_3884 312
177 3300048914 Ga0496111_0051398 Ga0496111_0051398_11_970 312
178 3300048917 Ga0496114_0095000 Ga0496114_0095000_1561_2520 312
179 3300048925 Ga0496122_0003669 Ga0496122_0003669_4119_5144 312
180 3300048926 Ga0496123_0002385 Ga0496123_0002385_5130_6155 312
181 3300048929 Ga0496126_0003102 Ga0496126_0003102_1800_2759 312
182 3300053116 Ga0500592_000002 Ga0500592_000002_106440_107498 312
183 3300053136 Ga0500559_0056066 Ga0500559_0056066_12_977 312
184 3300053158 Ga0500627_0000026 Ga0500627_0000026_34139_35197 312
185 iso_pu_bacteria 2512564014 2512644871 312
186 2162886007 SwRhRL2b_contig_234738 SwRhRL2b_0427.00002470 313
187 2162886007 SwRhRL2b_contig_3367114 SwRhRL2b_0645.00008370 313
188 3300003214 JGI25165J46597_1000156 JGI25165J46597_100015695 313
189 3300003320 rootH2_10332287 rootH2_103322871 313
190 3300003322 rootL2_10213738 rootL2_102137382 313
191 3300005289 Ga0065704_10000463 Ga0065704_1000046317 313
192 3300005289 Ga0065704_10006773 Ga0065704_100067733 313
193 3300005289 Ga0065704_10070166 Ga0065704_1007016680 313
194 3300005331 Ga0070670_100077040 Ga0070670_1000770402 313
195 3300005331 Ga0070670_100515011 Ga0070670_1005150111 313
196 3300005347 Ga0070668_100284109 Ga0070668_1002841091 313
197 3300005353 Ga0070669_100081454 Ga0070669_1000814542 313
198 3300005353 Ga0070669_100242217 Ga0070669_1002422172 313
199 3300005355 Ga0070671_100029082 Ga0070671_1000290823 313
200 3300005355 Ga0070671_100039242 Ga0070671_1000392423 313
201 3300005548 Ga0070665_100065700 Ga0070665_1000657003 313
202 3300005563 Ga0068855_100000817 Ga0068855_10000081731 313
203 3300005616 Ga0068852_100215299 Ga0068852_1002152992 313
204 3300005618 Ga0068864_100019822 Ga0068864_1000198225 313
205 3300005842 Ga0068858_100036171 Ga0068858_1000361712 313
206 3300006042 Ga0075368_10000249 Ga0075368_100002497 313
207 3300006178 Ga0075367_10000340 Ga0075367_1000034011 313
208 3300006353 Ga0075370_10040023 Ga0075370_100400233 313
209 3300009092 Ga0105250_10000013 Ga0105250_10000013134 313
210 3300009177 Ga0105248_10002260 Ga0105248_1000226012 313
211 3300009553 Ga0105249_10029794 Ga0105249_100297942 313
212 3300009978 Ga0105148_100205 Ga0105148_10020511 313
213 3300014326 Ga0157380_10054402 Ga0157380_100544025 313
214 3300014968 Ga0157379_10001585 Ga0157379_1000158510 313
215 3300017792 Ga0163161_10001170 Ga0163161_1000117016 313
216 3300017792 Ga0163161_10111447 Ga0163161_101114472 313
217 3300025261 Ga0209233_1000213 Ga0209233_100021316 313
218 3300025711 Ga0207696_1000072 Ga0207696_10000727 313
219 3300025925 Ga0207650_10061349 Ga0207650_100613492 313
220 3300025925 Ga0207650_10243520 Ga0207650_102435202 313
221 3300025941 Ga0207711_10005039 Ga0207711_100050392 313
222 3300025949 Ga0207667_10010733 Ga0207667_100107336 313
223 3300025972 Ga0207668_10093632 Ga0207668_100936322 313
224 3300026035 Ga0207703_10026177 Ga0207703_100261774 313
225 3300026095 Ga0207676_10051897 Ga0207676_100518974 313
226 3300027866 Ga0209813_10000010 Ga0209813_1000001083 313
227 3300028379 Ga0268266_10104399 Ga0268266_101043992 313
228 3300046471 Ga0495650_0000163 Ga0495650_0000163_110185_111150 313
229 3300046506 Ga0495583_0000333 Ga0495583_0000333_67530_68495 313
230 3300046558 Ga0495633_0048417 Ga0495633_0048417_927_1892 313
231 3300046809 Ga0495600_0010175 Ga0495600_0010175_3321_4286 313
232 3300048911 Ga0496108_0004245 Ga0496108_0004245_930_1883 313
233 3300048911 Ga0496108_0029161 Ga0496108_0029161_3479_4432 313
234 3300048912 Ga0496109_0036486 Ga0496109_0036486_1237_2190 313
235 3300048913 Ga0496110_0007686 Ga0496110_0007686_2020_3000 313
236 3300048913 Ga0496110_0111835 Ga0496110_0111835_1154_2107 313
237 3300048916 Ga0496113_0050349 Ga0496113_0050349_1191_2144 313
238 3300048919 Ga0496116_0019188 Ga0496116_0019188_2870_3814 313
239 3300048919 Ga0496116_0033723 Ga0496116_0033723_1068_2021 313
240 3300048919 Ga0496116_0084807 Ga0496116_0084807_670_1623 313
241 3300048920 Ga0496117_0005453 Ga0496117_0005453_9361_10305 313
242 3300048920 Ga0496117_0174822 Ga0496117_0174822_252_1205 313
243 3300048921 Ga0496118_0028402 Ga0496118_0028402_3004_3948 313
244 3300048924 Ga0496121_0001102 Ga0496121_0001102_29594_30547 313
245 3300048924 Ga0496121_0031716 Ga0496121_0031716_2836_3840 313
246 3300048925 Ga0496122_0013754 Ga0496122_0013754_2327_3307 313
247 3300048925 Ga0496122_0085235 Ga0496122_0085235_249_1202 313
248 3300048925 Ga0496122_0152790 Ga0496122_0152790_60_1013 313
249 3300048926 Ga0496123_0008795 Ga0496123_0008795_7570_8550 313
250 3300048927 Ga0496124_0001086 Ga0496124_0001086_18268_19275 313
251 3300048927 Ga0496124_0039358 Ga0496124_0039358_2203_3180 313
252 3300048928 Ga0496125_0006075 Ga0496125_0006075_8001_9008 313
253 3300048928 Ga0496125_0008335 Ga0496125_0008335_5701_6681 313
254 3300048928 Ga0496125_0031545 Ga0496125_0031545_1594_2571 313
255 3300048928 Ga0496125_0040990 Ga0496125_0040990_1261_2214 313
256 3300048929 Ga0496126_0016407 Ga0496126_0016407_57_1010 313
257 3300048929 Ga0496126_0039241 Ga0496126_0039241_1057_2034 313
258 3300049572 Ga0501036_0389430 Ga0501036_0389430_39_1013 313
259 3300049581 Ga0501047_0004550 Ga0501047_0004550_2774_3748 313
260 3300049586 Ga0501070_0011365 Ga0501070_0011365_4042_5010 313
261 3300049589 Ga0501073_0160112 Ga0501073_0160112_130_1098 313
262 3300049590 Ga0501074_0084724 Ga0501074_0084724_129_1103 313
263 3300049663 Ga0501223_000024 Ga0501223_000024_53278_54231 313
264 3300049663 Ga0501223_000031 Ga0501223_000031_165_1112 313
265 3300049664 Ga0501224_000001 Ga0501224_000001_76431_77384 313
266 3300049668 Ga0501233_000788 Ga0501233_000788_824_1777 313
267 3300049669 Ga0501235_000599 Ga0501235_000599_4055_5056 313
268 3300049669 Ga0501235_000931 Ga0501235_000931_2425_3378 313
269 3300049705 Ga0501225_0000093 Ga0501225_0000093_165_1112 313
270 3300049705 Ga0501225_0000504 Ga0501225_0000504_10103_11056 313
271 3300049705 Ga0501225_0006237 Ga0501225_0006237_2378_3328 313
272 3300049742 Ga0501080_0070930 Ga0501080_0070930_1189_2163 313
273 3300049823 Ga0501044_0006132 Ga0501044_0006132_2368_3342 313
274 3300049853 Ga0501226_000029 Ga0501226_000029_76395_77348 313
275 3300050494 nmdc:mga06z11_68_c1 nmdc:mga06z11_68_c1_32761_33726 313
276 3300050495 nmdc:mga04h51_36_c1 nmdc:mga04h51_36_c1_32740_33705 313
277 3300050496 nmdc:mga07m45_37867_c1 nmdc:mga07m45_37867_c1_835_1800 313
278 3300053119 Ga0500595_000774 Ga0500595_000774_14984_15949 313
279 3300053136 Ga0500559_0011051 Ga0500559_0011051_1952_2902 313
280 3300053154 Ga0500619_011232 Ga0500619_011232_614_1579 313
281 3300053177 Ga0500636_0000577 Ga0500636_0000577_4990_5955 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

143

353

0.92

PF00135

COesterase

Carboxylesterase family

126

247

0.88

PF00326

Peptidase_S9

Prolyl oligopeptidase family

188

366

0.75

PF20434

BD-FAE

BD-FAE

128

326

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b4q-assembly1.cif.gz_B structure of a cold active hsl family esterase reveals mechanisms of low temperature adaptation and substrate specificity 0.9447 1 313
7b4q-assembly1.cif.gz_B structure of a cold active hsl family esterase reveals mechanisms of low temperature adaptation and substrate specificity 0.9417 1 313
7wol-assembly1.cif.gz_B crystal structure of lipase trlipb from thermomocrobium roseum 0.9333 2 313
7wol-assembly1.cif.gz_A crystal structure of lipase trlipb from thermomocrobium roseum 0.9315 2 313
7wol-assembly1.cif.gz_B crystal structure of lipase trlipb from thermomocrobium roseum 0.9275 2 313
ID Description Score Start End Superfamily
af_P96399_42_298_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9274 40 313 3.40.50.1820
af_P96399_42_298_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9239 40 313 3.40.50.1820
1lzlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9169 3 313 3.40.50.1820
3qh4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9148 2 313 3.40.50.1820
1lzlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9084 3 313 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0N1BWL3-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9706 2 313 GO:0016787
AF-A0A376WC37-F1-model_v4 Lipase (EC 3.1.1.-) 0.9631 65 190 GO:0016787
AF-A0A0N1BWL3-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9582 2 313 GO:0016787
AF-A0A1R3UP43-F1-model_v4 Esterase LipW 0.9535 4 311 GO:0016787
AF-A0A254R087-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9516 21 311 GO:0016787

Feature Viewer

pLDDT pTM Quality
96 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map