F384162

General Info

Members Datasets Scaffolds Average Seq Length
281 196 281 135

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100003426|Ga0070665_10000342610
Length 141
Sequence MCVDSAMAYVVADPCVKCKYTDCVAVCPVDCFYEGKNSIAIHPDECIDCGACEPECPTTAIFEESELPTKWAVYKDINALVTGAKKASEVDTASWPAHLKAAAPTADTWPNITEQKKALAGADDAAKEDNKIGALTLEGGG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
137 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
138 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
139 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
140 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
152 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
153 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
157 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
168 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
171 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
172 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
173 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
174 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
175 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
176 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
177 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
182 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
183 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
187 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
188 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
189 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
191 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
192 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
193 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.52
Nodule 0
Rhizoplane 1.42
Rhizosphere 78.65
Stem 0
Stem Tuber 0
Unclassified 6.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10708967 3300005327 Bacteria 873
2 Ga0070683_100611755 3300005329 Bacteria 1043
3 Ga0070683_100939030 3300005329 Bacteria 830
4 Ga0070683_101864499 3300005329 Bacteria 578
5 Ga0070683_101928117 3300005329 Bacteria 568
6 Ga0070690_100798740 3300005330 Bacteria 732
7 Ga0068869_100031835 3300005334 Bacteria 3713
8 Ga0068869_100376120 3300005334 Bacteria 1163
9 Ga0068869_100882973 3300005334 Bacteria 773
10 Ga0070682_100486534 3300005337 Bacteria 953
11 Ga0068868_101101185 3300005338 Bacteria 731
12 Ga0070689_100017533 3300005340 Bacteria 5262
13 Ga0070689_100646081 3300005340 Bacteria 920
14 Ga0070689_101844249 3300005340 Bacteria 552
15 Ga0070688_100394516 3300005365 Bacteria 1023
16 Ga0070667_101500567 3300005367 Bacteria 633
17 Ga0070703_10202441 3300005406 Bacteria 780
18 Ga0070701_10860069 3300005438 Bacteria 623
19 Ga0070705_100104249 3300005440 Bacteria 1798
20 Ga0070700_100100590 3300005441 Bacteria 1904
21 Ga0070700_100380107 3300005441 Bacteria 1056
22 Ga0070708_100861724 3300005445 Bacteria 851
23 Ga0070678_100003131 3300005456 Bacteria 9159
24 Ga0070706_100011700 3300005467 Bacteria 8144
25 Ga0070706_100346532 3300005467 Bacteria 1385
26 Ga0070698_100002254 3300005471 Bacteria 21335
27 Ga0070698_100070287 3300005471 Bacteria 3513
28 Ga0070699_100245774 3300005518 Bacteria 1598
29 Ga0070679_100019515 3300005530 Bacteria 6594
30 Ga0070679_101031521 3300005530 Bacteria 767
31 Ga0070684_100091088 3300005535 Bacteria 2712
32 Ga0070684_100595059 3300005535 Bacteria 1028
33 Ga0070686_101058548 3300005544 Bacteria 668
34 Ga0070695_100678654 3300005545 Bacteria 816
35 Ga0070665_100003426 3300005548 Bacteria 16940
36 Ga0070665_102167949 3300005548 Bacteria 560
37 Ga0070704_100058776 3300005549 Bacteria 2740
38 Ga0070704_100704189 3300005549 Bacteria 896
39 Ga0068855_100242565 3300005563 Bacteria 2013
40 Ga0068855_100261617 3300005563 Bacteria 1927
41 Ga0068855_101021167 3300005563 Bacteria 868
42 Ga0068857_100200094 3300005577 Bacteria 1821
43 Ga0068857_101832874 3300005577 Bacteria 594
44 Ga0068856_100022541 3300005614 Bacteria 6123
45 Ga0070702_100408077 3300005615 Bacteria 974
46 Ga0068859_100579516 3300005617 Bacteria 1216
47 Ga0068859_100820837 3300005617 Bacteria 1017
48 Ga0068864_100253153 3300005618 Bacteria 1636
49 Ga0068864_100355141 3300005618 Bacteria 1384
50 Ga0068864_100503968 3300005618 Bacteria 1165
51 Ga0068870_10306076 3300005840 Bacteria 1005
52 Ga0068863_100019655 3300005841 Bacteria 6461
53 Ga0068863_100502811 3300005841 Bacteria 1194
54 Ga0068858_101645211 3300005842 Bacteria 634
55 Ga0068860_100254521 3300005843 Bacteria 1711
56 Ga0081455_10325047 3300005937 Bacteria 1094
57 Ga0070717_10009185 3300006028 Bacteria 7430
58 Ga0097621_100179702 3300006237 Bacteria 1828
59 Ga0068871_100496942 3300006358 Bacteria 1099
60 Ga0068871_100789266 3300006358 Bacteria 875
61 Ga0068871_101103610 3300006358 Bacteria 742
62 Ga0075430_100058238 3300006846 Bacteria 3248
63 Ga0075431_100057819 3300006847 Bacteria 4000
64 Ga0075433_10315633 3300006852 Bacteria 1383
65 Ga0075434_101802272 3300006871 Bacteria 619
66 Ga0075429_100013339 3300006880 Bacteria 7126
67 Ga0075429_100438524 3300006880 Bacteria 1145
68 Ga0097620_100579444 3300006931 Bacteria 1216
69 Ga0097620_100820816 3300006931 Bacteria 1017
70 Ga0075435_100096731 3300007076 Bacteria 2442
71 Ga0111539_10012894 3300009094 Bacteria 10457
72 Ga0105245_10000011 3300009098 Bacteria 271829
73 Ga0105245_10777802 3300009098 Bacteria 994
74 Ga0105245_12075044 3300009098 Bacteria 622
75 Ga0105247_11329618 3300009101 Bacteria 578
76 Ga0114129_10713933 3300009147 Bacteria 1287
77 Ga0114129_10789183 3300009147 Bacteria 1213
78 Ga0105243_10074562 3300009148 Bacteria 2752
79 Ga0105241_11249047 3300009174 Bacteria 705
80 Ga0105242_12212063 3300009176 Bacteria 595
81 Ga0105248_11005675 3300009177 Bacteria 942
82 Ga0105248_11298182 3300009177 Bacteria 823
83 Ga0105248_11388745 3300009177 Bacteria 795
84 Ga0105248_11765590 3300009177 Bacteria 701
85 Ga0105238_12068723 3300009551 Bacteria 603
86 Ga0105249_10159050 3300009553 Bacteria 2181
87 Ga0105239_10193701 3300010375 Bacteria 2276
88 Ga0157374_10193081 3300013296 Bacteria 1992
89 Ga0157374_10350947 3300013296 Bacteria 1466
90 Ga0157378_10441370 3300013297 Bacteria 1290
91 Ga0157378_12395702 3300013297 Bacteria 580
92 Ga0163163_11544628 3300014325 Bacteria 725
93 Ga0163163_13146014 3300014325 Bacteria 515
94 Ga0157376_10084467 3300014969 Bacteria 2734
95 Ga0157376_10405627 3300014969 Bacteria 1319
96 Ga0207642_10308875 3300025899 Bacteria 919
97 Ga0207643_10156906 3300025908 Bacteria 1367
98 Ga0207705_10792961 3300025909 Bacteria 735
99 Ga0207684_10050305 3300025910 Bacteria 3535
100 Ga0207684_10476487 3300025910 Bacteria 1071
101 Ga0207660_10239007 3300025917 Bacteria 1430
102 Ga0207662_10201652 3300025918 Bacteria 1288
103 Ga0207649_10597271 3300025920 Bacteria 849
104 Ga0207652_10058150 3300025921 Bacteria 3331
105 Ga0207646_11090702 3300025922 Bacteria 703
106 Ga0207687_10000016 3300025927 Bacteria 250284
107 Ga0207686_10906112 3300025934 Bacteria 712
108 Ga0207686_10965997 3300025934 Bacteria 690
109 Ga0207709_10060537 3300025935 Bacteria 2361
110 Ga0207711_11851461 3300025941 Bacteria 546
111 Ga0207689_10011700 3300025942 Bacteria 7519
112 Ga0207689_10491898 3300025942 Bacteria 1027
113 Ga0207689_10517507 3300025942 Bacteria 1000
114 Ga0207661_10597088 3300025944 Bacteria 1013
115 Ga0207667_10260757 3300025949 Bacteria 1772
116 Ga0207667_10272845 3300025949 Bacteria 1729
117 Ga0207658_11481809 3300025986 Bacteria 621
118 Ga0207708_10343096 3300026075 Bacteria 1224
119 Ga0207641_10095684 3300026088 Bacteria 2607
120 Ga0207676_10214273 3300026095 Bacteria 1711
121 Ga0207676_10330672 3300026095 Bacteria 1402
122 Ga0207674_10094460 3300026116 Bacteria 2977
123 Ga0207675_101513525 3300026118 Bacteria 692
124 Ga0207683_11650874 3300026121 Bacteria 590
125 Ga0207428_10006592 3300027907 Bacteria 10689
126 Ga0268266_10007841 3300028379 Bacteria 9567
127 Ga0268264_10060730 3300028381 Bacteria 3169
128 Ga0268264_10174837 3300028381 Bacteria 1945
129 Ga0265319_1066142 3300028563 Bacteria 1165
130 Ga0307515_10046651 3300028794 Bacteria 6616
131 Ga0265338_10088186 3300028800 Bacteria 2575
132 Ga0265338_10121265 3300028800 Bacteria 2084
133 Ga0307513_10027886 3300031456 Bacteria 6472
134 Ga0307513_10081117 3300031456 Bacteria 3344
135 Ga0307509_10001401 3300031507 Bacteria 40802
136 Ga0307509_10001656 3300031507 Bacteria 37312
137 Ga0307509_10028398 3300031507 Bacteria 6220
138 Ga0307509_10257728 3300031507 Bacteria 1522
139 Ga0307508_10022704 3300031616 Bacteria 5703
140 Ga0307508_10123731 3300031616 Bacteria 2189
141 Ga0265314_10490041 3300031711 Bacteria 648
142 Ga0307516_10008957 3300031730 Bacteria 11219
143 Ga0307516_10021105 3300031730 Bacteria 6714
144 Ga0307406_10204727 3300031901 Bacteria 1455
145 Ga0307406_10543307 3300031901 Bacteria 949
146 Ga0307416_100704430 3300032002 Bacteria 1099
147 Ga0307415_100012253 3300032126 Bacteria 4951
148 Ga0307415_100373846 3300032126 Bacteria 1208
149 Ga0307415_101221292 3300032126 Bacteria 709
150 Ga0307507_10326616 3300033179 Bacteria 919
151 Ga0373958_0159485 3300034819 Bacteria 570
152 Ga0373934_0057409 3300035086 Bacteria 1549
153 Ga0373944_0032824 3300035089 Bacteria 1570
154 Ga0373949_0000429 3300035090 Bacteria 14560
155 Ga0373951_0153393 3300035091 Bacteria 647
156 Ga0373936_0000017 3300035113 Bacteria 165713
157 Ga0373939_0067373 3300035114 Bacteria 1156
158 Ga0373941_0013680 3300035115 Bacteria 2151
159 Ga0373945_0452178 3300035116 Bacteria 568
160 Ga0373954_0103585 3300035118 Bacteria 1374
161 Ga0373960_0102291 3300035121 Bacteria 930
162 Ga0373942_0119288 3300035207 Bacteria 823
163 Ga0373925_1365529 3300037068 Bacteria 581
164 Ga0395899_0016792 3300037312 Bacteria 5580
165 Ga0395899_0055080 3300037312 Bacteria 2942
166 Ga0395900_0361652 3300037418 Bacteria 1422
167 Ga0395900_1125248 3300037418 Bacteria 702
168 Ga0395898_0118587 3300037466 Bacteria 2535
169 Ga0395905_0037901 3300037471 Bacteria 4524
170 Ga0395905_0685067 3300037471 Bacteria 927
171 Ga0395905_0889125 3300037471 Bacteria 794
172 Ga0395901_0122381 3300038443 Bacteria 2734
173 Ga0395901_0955855 3300038443 Bacteria 835
174 Ga0395901_1185097 3300038443 Bacteria 730
175 Ga0436365_1645578 3300039437 Bacteria 1432
176 Ga0436365_1681371 3300039437 Bacteria 1287
177 Ga0436365_1917130 3300039437 Bacteria 1232
178 Ga0436363_0437131 3300039450 Bacteria 1564
179 Ga0451793_1022419 3300041452 Bacteria 1015
180 Ga0451807_1929699 3300041486 Bacteria 512
181 Ga0451839_0670562 3300041496 Bacteria 762
182 Ga0451855_1411873 3300041511 Bacteria 571
183 Ga0451576_1322030 3300045051 Bacteria 751
184 Ga0466967_1143663 3300045976 Bacteria 776
185 Ga0495590_0242688 3300046457 Bacteria 669
186 Ga0495650_0016417 3300046471 Bacteria 3752
187 Ga0495664_0343739 3300046477 Bacteria 899
188 Ga0495630_0565382 3300046517 Bacteria 872
189 Ga0495632_0245700 3300046519 Bacteria 804
190 Ga0495643_0290534 3300046522 Bacteria 748
191 Ga0495666_0193784 3300046526 Bacteria 936
192 Ga0495658_0266575 3300046683 Bacteria 1079
193 Ga0495686_0006062 3300047472 Bacteria 9373
194 Ga0495686_0105514 3300047472 Bacteria 1695
195 Ga0496105_0200757 3300048908 Bacteria 1628
196 Ga0496115_0201504 3300048918 Bacteria 1644
197 Ga0501292_000664 3300049515 Bacteria 4208
198 Ga0501292_014708 3300049515 Bacteria 1217
199 Ga0501297_056486 3300049520 Bacteria 590
200 Ga0501298_022086 3300049521 Bacteria 1196
201 Ga0501299_029235 3300049522 Bacteria 1055
202 Ga0501299_109973 3300049522 Bacteria 651
203 Ga0501311_088033 3300049527 Bacteria 536
204 Ga0501034_0139147 3300049571 Bacteria 2408
205 Ga0501034_0151691 3300049571 Bacteria 2293
206 Ga0501036_0297976 3300049572 Bacteria 1349
207 Ga0501039_1571628 3300049575 Bacteria 505
208 Ga0501047_0020410 3300049581 Bacteria 6363
209 Ga0501047_0021394 3300049581 Bacteria 6208
210 Ga0501047_0478438 3300049581 Bacteria 1073
211 Ga0501068_0025738 3300049584 Bacteria 3463
212 Ga0501069_0064808 3300049585 Bacteria 2042
213 Ga0501069_0854454 3300049585 Bacteria 553
214 Ga0501070_0032612 3300049586 Bacteria 4359
215 Ga0501070_0153387 3300049586 Bacteria 1900
216 Ga0501070_0481988 3300049586 Bacteria 997
217 Ga0501070_1158665 3300049586 Bacteria 594
218 Ga0501073_0093964 3300049589 Bacteria 2083
219 Ga0501073_0290260 3300049589 Bacteria 1129
220 Ga0501074_0119292 3300049590 Bacteria 1886
221 Ga0501217_014230 3300049661 Bacteria 1794
222 Ga0501227_000933 3300049665 Bacteria 6397
223 Ga0501227_017752 3300049665 Bacteria 1609
224 Ga0501228_007091 3300049666 Bacteria 1040
225 Ga0501221_023952 3300049704 Bacteria 1221
226 Ga0501080_0936360 3300049742 Bacteria 754
227 Ga0501080_1585446 3300049742 Bacteria 555
228 Ga0501083_0138115 3300049744 Bacteria 1596
229 Ga0501267_012614 3300049764 Bacteria 873
230 Ga0501273_096774 3300049770 Bacteria 508
231 Ga0501044_0071100 3300049823 Bacteria 3538
232 Ga0501044_0800130 3300049823 Bacteria 822
233 Ga0501204_085090 3300049850 Bacteria 543
234 nmdc:mga09592_62905_c1 3300050508 Bacteria 3140
235 nmdc:mga09592_724176_c1 3300050508 Bacteria 845
236 nmdc:mga0qj67_62450_c1 3300050509 Bacteria 2960
237 nmdc:mga06r32_1646311_c1 3300050510 Bacteria 580
238 nmdc:mga08y16_5186_c1 3300050511 Bacteria 13609
239 nmdc:mga0n895_2209159_c1 3300050512 Bacteria 506
240 nmdc:mga0rr50_200592_c1 3300050513 Bacteria 1639
241 nmdc:mga0rr50_265855_c1 3300050513 Bacteria 1428
242 nmdc:mga0a205_359654_c1 3300050515 Bacteria 1322
243 Ga0500635_0258537 3300053080 Bacteria 684
244 Ga0500578_0150806 3300053086 Bacteria 1448
245 Ga0500578_0423220 3300053086 Bacteria 763
246 Ga0500646_0001384 3300053090 Bacteria 6435
247 Ga0500647_0131640 3300053091 Bacteria 1179
248 Ga0500583_0045963 3300053092 Bacteria 2007
249 Ga0500566_0007057 3300053094 Bacteria 6652
250 Ga0500566_0020239 3300053094 Bacteria 3909
251 Ga0500566_0026919 3300053094 Bacteria 3366
252 Ga0500640_001507 3300053095 Bacteria 7130
253 Ga0500654_204345 3300053099 Bacteria 589
254 Ga0500554_000020 3300053102 Bacteria 27205
255 Ga0500554_177848 3300053102 Bacteria 716
256 Ga0500562_056235 3300053108 Bacteria 1055
257 Ga0500572_019222 3300053111 Bacteria 1781
258 Ga0500595_000074 3300053119 Bacteria 69645
259 Ga0500597_014512 3300053120 Bacteria 2957
260 Ga0500608_219901 3300053122 Bacteria 768
261 Ga0500614_000166 3300053123 Bacteria 16723
262 Ga0500614_003963 3300053123 Bacteria 3159
263 Ga0500614_159650 3300053123 Bacteria 682
264 Ga0500617_180366 3300053124 Bacteria 799
265 Ga0500642_0048294 3300053130 Bacteria 1869
266 Ga0500642_0091270 3300053130 Bacteria 1408
267 Ga0500559_0002521 3300053136 Bacteria 9409
268 Ga0500559_0183645 3300053136 Bacteria 985
269 Ga0500568_0137225 3300053139 Bacteria 907
270 Ga0500585_124073 3300053144 Bacteria 919
271 Ga0500590_129807 3300053148 Bacteria 1168
272 Ga0500603_002249 3300053150 Bacteria 4241
273 Ga0500603_004061 3300053150 Bacteria 3130
274 Ga0500619_051917 3300053154 Bacteria 1329
275 Ga0500622_0144867 3300053156 Bacteria 1129
276 Ga0500630_007381 3300053159 Bacteria 5393
277 Ga0500638_248500 3300053162 Bacteria 718
278 Ga0500639_216079 3300053163 Bacteria 806
279 Ga0500636_0190791 3300053177 Bacteria 1092
280 Ga0500637_0193543 3300053178 Bacteria 1161
281 Ga0501084_1185622 3300054114 Bacteria 641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0343739 Ga0495664_0343739_538_888 116
2 3300049522 Ga0501299_109973 Ga0501299_109973_276_626 116
3 3300049823 Ga0501044_0800130 Ga0501044_0800130_25_375 116
4 3300050508 nmdc:mga09592_724176_c1 nmdc:mga09592_724176_c1_453_803 116
5 3300053124 Ga0500617_180366 Ga0500617_180366_409_786 125
6 3300007076 Ga0075435_100096731 Ga0075435_1000967313 126
7 3300025942 Ga0207689_10517507 Ga0207689_105175072 126
8 3300037068 Ga0373925_1365529 Ga0373925_1365529_188_568 126
9 3300049527 Ga0501311_088033 Ga0501311_088033_143_523 126
10 3300049742 Ga0501080_0936360 Ga0501080_0936360_129_509 126
11 3300049764 Ga0501267_012614 Ga0501267_012614_44_424 126
12 3300035114 Ga0373939_0067373 Ga0373939_0067373_182_565 127
13 3300037418 Ga0395900_1125248 Ga0395900_1125248_17_400 127
14 3300009098 Ga0105245_12075044 Ga0105245_120750441 133
15 3300009551 Ga0105238_12068723 Ga0105238_120687231 133
16 3300014325 Ga0163163_11544628 Ga0163163_115446281 133
17 3300031901 Ga0307406_10543307 Ga0307406_105433071 133
18 3300032002 Ga0307416_100704430 Ga0307416_1007044302 133
19 3300032126 Ga0307415_101221292 Ga0307415_1012212922 133
20 3300005329 Ga0070683_100611755 Ga0070683_1006117551 134
21 3300005337 Ga0070682_100486534 Ga0070682_1004865342 134
22 3300005467 Ga0070706_100011700 Ga0070706_1000117005 134
23 3300005467 Ga0070706_100346532 Ga0070706_1003465321 134
24 3300005530 Ga0070679_100019515 Ga0070679_1000195154 134
25 3300005535 Ga0070684_100091088 Ga0070684_1000910883 134
26 3300005548 Ga0070665_102167949 Ga0070665_1021679492 134
27 3300005563 Ga0068855_100261617 Ga0068855_1002616173 134
28 3300005577 Ga0068857_100200094 Ga0068857_1002000943 134
29 3300005614 Ga0068856_100022541 Ga0068856_1000225414 134
30 3300005618 Ga0068864_100253153 Ga0068864_1002531532 134
31 3300009098 Ga0105245_10000011 Ga0105245_10000011218 134
32 3300009174 Ga0105241_11249047 Ga0105241_112490472 134
33 3300010375 Ga0105239_10193701 Ga0105239_101937012 134
34 3300013296 Ga0157374_10350947 Ga0157374_103509473 134
35 3300013297 Ga0157378_10441370 Ga0157378_104413702 134
36 3300025910 Ga0207684_10050305 Ga0207684_100503053 134
37 3300025910 Ga0207684_10476487 Ga0207684_104764872 134
38 3300025920 Ga0207649_10597271 Ga0207649_105972711 134
39 3300025921 Ga0207652_10058150 Ga0207652_100581502 134
40 3300025922 Ga0207646_11090702 Ga0207646_110907022 134
41 3300025927 Ga0207687_10000016 Ga0207687_1000001652 134
42 3300025949 Ga0207667_10272845 Ga0207667_102728451 134
43 3300026095 Ga0207676_10214273 Ga0207676_102142732 134
44 3300026116 Ga0207674_10094460 Ga0207674_100944604 134
45 3300031507 Ga0307509_10001401 Ga0307509_1000140131 134
46 3300031616 Ga0307508_10123731 Ga0307508_101237313 134
47 3300031730 Ga0307516_10021105 Ga0307516_100211053 134
48 3300037471 Ga0395905_0685067 Ga0395905_0685067_255_659 134
49 3300039437 Ga0436365_1645578 Ga0436365_1645578_359_763 134
50 3300041452 Ga0451793_1022419 Ga0451793_1022419_223_627 134
51 3300046457 Ga0495590_0242688 Ga0495590_0242688_19_423 134
52 3300053086 Ga0500578_0150806 Ga0500578_0150806_329_733 134
53 3300053086 Ga0500578_0423220 Ga0500578_0423220_220_624 134
54 3300053090 Ga0500646_0001384 Ga0500646_0001384_3260_3664 134
55 3300053094 Ga0500566_0020239 Ga0500566_0020239_1476_1880 134
56 3300053099 Ga0500654_204345 Ga0500654_204345_25_429 134
57 3300053108 Ga0500562_056235 Ga0500562_056235_625_1029 134
58 3300053136 Ga0500559_0183645 Ga0500559_0183645_514_918 134
59 3300053139 Ga0500568_0137225 Ga0500568_0137225_448_852 134
60 3300053150 Ga0500603_002249 Ga0500603_002249_2440_2844 134
61 3300053156 Ga0500622_0144867 Ga0500622_0144867_597_1001 134
62 3300005334 Ga0068869_100376120 Ga0068869_1003761202 135
63 3300005334 Ga0068869_100882973 Ga0068869_1008829732 135
64 3300005340 Ga0070689_100017533 Ga0070689_1000175335 135
65 3300005340 Ga0070689_100646081 Ga0070689_1006460812 135
66 3300005340 Ga0070689_101844249 Ga0070689_1018442491 135
67 3300005365 Ga0070688_100394516 Ga0070688_1003945162 135
68 3300005367 Ga0070667_101500567 Ga0070667_1015005671 135
69 3300005438 Ga0070701_10860069 Ga0070701_108600691 135
70 3300005445 Ga0070708_100861724 Ga0070708_1008617242 135
71 3300005471 Ga0070698_100002254 Ga0070698_1000022544 135
72 3300005471 Ga0070698_100070287 Ga0070698_1000702871 135
73 3300005518 Ga0070699_100245774 Ga0070699_1002457742 135
74 3300005544 Ga0070686_101058548 Ga0070686_1010585482 135
75 3300005548 Ga0070665_100003426 Ga0070665_10000342610 135
76 3300005549 Ga0070704_100058776 Ga0070704_1000587763 135
77 3300005563 Ga0068855_100242565 Ga0068855_1002425652 135
78 3300005577 Ga0068857_101832874 Ga0068857_1018328742 135
79 3300005615 Ga0070702_100408077 Ga0070702_1004080772 135
80 3300005617 Ga0068859_100579516 Ga0068859_1005795162 135
81 3300005617 Ga0068859_100820837 Ga0068859_1008208372 135
82 3300005618 Ga0068864_100355141 Ga0068864_1003551412 135
83 3300005618 Ga0068864_100503968 Ga0068864_1005039682 135
84 3300005840 Ga0068870_10306076 Ga0068870_103060762 135
85 3300005841 Ga0068863_100019655 Ga0068863_1000196552 135
86 3300005843 Ga0068860_100254521 Ga0068860_1002545212 135
87 3300006028 Ga0070717_10009185 Ga0070717_100091855 135
88 3300006237 Ga0097621_100179702 Ga0097621_1001797022 135
89 3300006358 Ga0068871_101103610 Ga0068871_1011036102 135
90 3300006846 Ga0075430_100058238 Ga0075430_1000582384 135
91 3300006847 Ga0075431_100057819 Ga0075431_1000578194 135
92 3300006852 Ga0075433_10315633 Ga0075433_103156332 135
93 3300006871 Ga0075434_101802272 Ga0075434_1018022721 135
94 3300006880 Ga0075429_100013339 Ga0075429_1000133397 135
95 3300006880 Ga0075429_100438524 Ga0075429_1004385242 135
96 3300006931 Ga0097620_100579444 Ga0097620_1005794442 135
97 3300006931 Ga0097620_100820816 Ga0097620_1008208162 135
98 3300009094 Ga0111539_10012894 Ga0111539_100128947 135
99 3300009098 Ga0105245_10777802 Ga0105245_107778022 135
100 3300009147 Ga0114129_10713933 Ga0114129_107139332 135
101 3300009147 Ga0114129_10789183 Ga0114129_107891832 135
102 3300009148 Ga0105243_10074562 Ga0105243_100745622 135
103 3300009177 Ga0105248_11005675 Ga0105248_110056752 135
104 3300009177 Ga0105248_11765590 Ga0105248_117655902 135
105 3300009553 Ga0105249_10159050 Ga0105249_101590502 135
106 3300013297 Ga0157378_12395702 Ga0157378_123957021 135
107 3300014969 Ga0157376_10084467 Ga0157376_100844673 135
108 3300014969 Ga0157376_10405627 Ga0157376_104056272 135
109 3300025899 Ga0207642_10308875 Ga0207642_103088751 135
110 3300025908 Ga0207643_10156906 Ga0207643_101569062 135
111 3300025934 Ga0207686_10906112 Ga0207686_109061122 135
112 3300025934 Ga0207686_10965997 Ga0207686_109659972 135
113 3300025935 Ga0207709_10060537 Ga0207709_100605372 135
114 3300025941 Ga0207711_11851461 Ga0207711_118514611 135
115 3300025942 Ga0207689_10491898 Ga0207689_104918982 135
116 3300025949 Ga0207667_10260757 Ga0207667_102607572 135
117 3300025986 Ga0207658_11481809 Ga0207658_114818091 135
118 3300026088 Ga0207641_10095684 Ga0207641_100956843 135
119 3300026095 Ga0207676_10330672 Ga0207676_103306722 135
120 3300026121 Ga0207683_11650874 Ga0207683_116508741 135
121 3300027907 Ga0207428_10006592 Ga0207428_100065926 135
122 3300028379 Ga0268266_10007841 Ga0268266_100078417 135
123 3300028381 Ga0268264_10060730 Ga0268264_100607302 135
124 3300028381 Ga0268264_10174837 Ga0268264_101748372 135
125 3300028800 Ga0265338_10121265 Ga0265338_101212654 135
126 3300031456 Ga0307513_10027886 Ga0307513_100278862 135
127 3300031456 Ga0307513_10081117 Ga0307513_100811173 135
128 3300031507 Ga0307509_10001656 Ga0307509_100016568 135
129 3300031507 Ga0307509_10028398 Ga0307509_100283984 135
130 3300031616 Ga0307508_10022704 Ga0307508_100227043 135
131 3300031730 Ga0307516_10008957 Ga0307516_100089578 135
132 3300031901 Ga0307406_10204727 Ga0307406_102047272 135
133 3300032126 Ga0307415_100012253 Ga0307415_1000122535 135
134 3300033179 Ga0307507_10326616 Ga0307507_103266162 135
135 3300035086 Ga0373934_0057409 Ga0373934_0057409_945_1352 135
136 3300035091 Ga0373951_0153393 Ga0373951_0153393_106_513 135
137 3300035113 Ga0373936_0000017 Ga0373936_0000017_39370_39777 135
138 3300035115 Ga0373941_0013680 Ga0373941_0013680_514_921 135
139 3300035116 Ga0373945_0452178 Ga0373945_0452178_28_435 135
140 3300035118 Ga0373954_0103585 Ga0373954_0103585_154_561 135
141 3300037471 Ga0395905_0889125 Ga0395905_0889125_28_435 135
142 3300039437 Ga0436365_1917130 Ga0436365_1917130_600_1007 135
143 3300039450 Ga0436363_0437131 Ga0436363_0437131_430_837 135
144 3300041486 Ga0451807_1929699 Ga0451807_1929699_62_469 135
145 3300041511 Ga0451855_1411873 Ga0451855_1411873_89_496 135
146 3300045051 Ga0451576_1322030 Ga0451576_1322030_210_617 135
147 3300045976 Ga0466967_1143663 Ga0466967_1143663_106_513 135
148 3300046471 Ga0495650_0016417 Ga0495650_0016417_2348_2755 135
149 3300046517 Ga0495630_0565382 Ga0495630_0565382_45_452 135
150 3300046519 Ga0495632_0245700 Ga0495632_0245700_10_417 135
151 3300046683 Ga0495658_0266575 Ga0495658_0266575_558_965 135
152 3300047472 Ga0495686_0006062 Ga0495686_0006062_3359_3766 135
153 3300047472 Ga0495686_0105514 Ga0495686_0105514_250_657 135
154 3300048908 Ga0496105_0200757 Ga0496105_0200757_957_1364 135
155 3300048918 Ga0496115_0201504 Ga0496115_0201504_680_1087 135
156 3300049515 Ga0501292_014708 Ga0501292_014708_372_779 135
157 3300049571 Ga0501034_0139147 Ga0501034_0139147_729_1136 135
158 3300049571 Ga0501034_0151691 Ga0501034_0151691_424_831 135
159 3300049572 Ga0501036_0297976 Ga0501036_0297976_519_926 135
160 3300049575 Ga0501039_1571628 Ga0501039_1571628_88_495 135
161 3300049581 Ga0501047_0020410 Ga0501047_0020410_5151_5558 135
162 3300049581 Ga0501047_0021394 Ga0501047_0021394_4302_4709 135
163 3300049581 Ga0501047_0478438 Ga0501047_0478438_588_995 135
164 3300049584 Ga0501068_0025738 Ga0501068_0025738_752_1159 135
165 3300049585 Ga0501069_0064808 Ga0501069_0064808_1022_1429 135
166 3300049585 Ga0501069_0854454 Ga0501069_0854454_114_521 135
167 3300049586 Ga0501070_0032612 Ga0501070_0032612_3074_3481 135
168 3300049586 Ga0501070_0153387 Ga0501070_0153387_914_1321 135
169 3300049586 Ga0501070_0481988 Ga0501070_0481988_123_530 135
170 3300049586 Ga0501070_1158665 Ga0501070_1158665_177_584 135
171 3300049589 Ga0501073_0093964 Ga0501073_0093964_1239_1646 135
172 3300049589 Ga0501073_0290260 Ga0501073_0290260_630_1037 135
173 3300049590 Ga0501074_0119292 Ga0501074_0119292_681_1088 135
174 3300049665 Ga0501227_017752 Ga0501227_017752_546_953 135
175 3300049666 Ga0501228_007091 Ga0501228_007091_613_1020 135
176 3300049742 Ga0501080_1585446 Ga0501080_1585446_109_516 135
177 3300049744 Ga0501083_0138115 Ga0501083_0138115_267_674 135
178 3300049823 Ga0501044_0071100 Ga0501044_0071100_2681_3088 135
179 3300050508 nmdc:mga09592_62905_c1 nmdc:mga09592_62905_c1_968_1375 135
180 3300050509 nmdc:mga0qj67_62450_c1 nmdc:mga0qj67_62450_c1_711_1118 135
181 3300050510 nmdc:mga06r32_1646311_c1 nmdc:mga06r32_1646311_c1_86_493 135
182 3300050511 nmdc:mga08y16_5186_c1 nmdc:mga08y16_5186_c1_6478_6891 135
183 3300050512 nmdc:mga0n895_2209159_c1 nmdc:mga0n895_2209159_c1_75_488 135
184 3300050513 nmdc:mga0rr50_200592_c1 nmdc:mga0rr50_200592_c1_20_433 135
185 3300050513 nmdc:mga0rr50_265855_c1 nmdc:mga0rr50_265855_c1_692_1099 135
186 3300050515 nmdc:mga0a205_359654_c1 nmdc:mga0a205_359654_c1_239_646 135
187 3300053091 Ga0500647_0131640 Ga0500647_0131640_274_681 135
188 3300053094 Ga0500566_0007057 Ga0500566_0007057_4269_4676 135
189 3300053094 Ga0500566_0026919 Ga0500566_0026919_2259_2666 135
190 3300053095 Ga0500640_001507 Ga0500640_001507_5034_5441 135
191 3300053102 Ga0500554_000020 Ga0500554_000020_24275_24682 135
192 3300053102 Ga0500554_177848 Ga0500554_177848_60_467 135
193 3300053111 Ga0500572_019222 Ga0500572_019222_62_469 135
194 3300053119 Ga0500595_000074 Ga0500595_000074_50027_50434 135
195 3300053122 Ga0500608_219901 Ga0500608_219901_253_660 135
196 3300053123 Ga0500614_000166 Ga0500614_000166_2460_2867 135
197 3300053123 Ga0500614_159650 Ga0500614_159650_22_429 135
198 3300053130 Ga0500642_0048294 Ga0500642_0048294_386_793 135
199 3300053136 Ga0500559_0002521 Ga0500559_0002521_8578_8985 135
200 3300053144 Ga0500585_124073 Ga0500585_124073_75_482 135
201 3300053148 Ga0500590_129807 Ga0500590_129807_127_534 135
202 3300053154 Ga0500619_051917 Ga0500619_051917_562_969 135
203 3300053159 Ga0500630_007381 Ga0500630_007381_3756_4163 135
204 3300053163 Ga0500639_216079 Ga0500639_216079_184_591 135
205 3300005327 Ga0070658_10708967 Ga0070658_107089672 136
206 3300005329 Ga0070683_100939030 Ga0070683_1009390302 136
207 3300005329 Ga0070683_101864499 Ga0070683_1018644991 136
208 3300005329 Ga0070683_101928117 Ga0070683_1019281171 136
209 3300005330 Ga0070690_100798740 Ga0070690_1007987401 136
210 3300005334 Ga0068869_100031835 Ga0068869_1000318355 136
211 3300005338 Ga0068868_101101185 Ga0068868_1011011852 136
212 3300005406 Ga0070703_10202441 Ga0070703_102024412 136
213 3300005440 Ga0070705_100104249 Ga0070705_1001042492 136
214 3300005441 Ga0070700_100100590 Ga0070700_1001005902 136
215 3300005441 Ga0070700_100380107 Ga0070700_1003801073 136
216 3300005456 Ga0070678_100003131 Ga0070678_1000031317 136
217 3300005530 Ga0070679_101031521 Ga0070679_1010315212 136
218 3300005535 Ga0070684_100595059 Ga0070684_1005950592 136
219 3300005545 Ga0070695_100678654 Ga0070695_1006786542 136
220 3300005549 Ga0070704_100704189 Ga0070704_1007041892 136
221 3300005563 Ga0068855_101021167 Ga0068855_1010211672 136
222 3300005841 Ga0068863_100502811 Ga0068863_1005028111 136
223 3300005842 Ga0068858_101645211 Ga0068858_1016452111 136
224 3300005937 Ga0081455_10325047 Ga0081455_103250471 136
225 3300006358 Ga0068871_100496942 Ga0068871_1004969422 136
226 3300006358 Ga0068871_100789266 Ga0068871_1007892662 136
227 3300009101 Ga0105247_11329618 Ga0105247_113296182 136
228 3300009176 Ga0105242_12212063 Ga0105242_122120632 136
229 3300009177 Ga0105248_11298182 Ga0105248_112981821 136
230 3300009177 Ga0105248_11388745 Ga0105248_113887452 136
231 3300013296 Ga0157374_10193081 Ga0157374_101930812 136
232 3300014325 Ga0163163_13146014 Ga0163163_131460141 136
233 3300025909 Ga0207705_10792961 Ga0207705_107929611 136
234 3300025917 Ga0207660_10239007 Ga0207660_102390072 136
235 3300025918 Ga0207662_10201652 Ga0207662_102016522 136
236 3300025942 Ga0207689_10011700 Ga0207689_100117005 136
237 3300025944 Ga0207661_10597088 Ga0207661_105970881 136
238 3300026075 Ga0207708_10343096 Ga0207708_103430963 136
239 3300026118 Ga0207675_101513525 Ga0207675_1015135252 136
240 3300028563 Ga0265319_1066142 Ga0265319_10661422 136
241 3300028794 Ga0307515_10046651 Ga0307515_1004665110 136
242 3300028800 Ga0265338_10088186 Ga0265338_100881862 136
243 3300031507 Ga0307509_10257728 Ga0307509_102577282 136
244 3300031711 Ga0265314_10490041 Ga0265314_104900411 136
245 3300032126 Ga0307415_100373846 Ga0307415_1003738462 136
246 3300034819 Ga0373958_0159485 Ga0373958_0159485_100_510 136
247 3300035089 Ga0373944_0032824 Ga0373944_0032824_902_1312 136
248 3300035090 Ga0373949_0000429 Ga0373949_0000429_10902_11312 136
249 3300035121 Ga0373960_0102291 Ga0373960_0102291_344_754 136
250 3300035207 Ga0373942_0119288 Ga0373942_0119288_74_484 136
251 3300037312 Ga0395899_0016792 Ga0395899_0016792_354_764 136
252 3300037312 Ga0395899_0055080 Ga0395899_0055080_633_1043 136
253 3300037418 Ga0395900_0361652 Ga0395900_0361652_728_1138 136
254 3300037466 Ga0395898_0118587 Ga0395898_0118587_1494_1904 136
255 3300037471 Ga0395905_0037901 Ga0395905_0037901_365_775 136
256 3300038443 Ga0395901_0122381 Ga0395901_0122381_2017_2427 136
257 3300038443 Ga0395901_0955855 Ga0395901_0955855_55_465 136
258 3300038443 Ga0395901_1185097 Ga0395901_1185097_281_691 136
259 3300039437 Ga0436365_1681371 Ga0436365_1681371_436_846 136
260 3300041496 Ga0451839_0670562 Ga0451839_0670562_224_634 136
261 3300046522 Ga0495643_0290534 Ga0495643_0290534_234_644 136
262 3300046526 Ga0495666_0193784 Ga0495666_0193784_353_766 136
263 3300049515 Ga0501292_000664 Ga0501292_000664_3214_3627 136
264 3300049520 Ga0501297_056486 Ga0501297_056486_32_445 136
265 3300049521 Ga0501298_022086 Ga0501298_022086_563_976 136
266 3300049522 Ga0501299_029235 Ga0501299_029235_502_915 136
267 3300049661 Ga0501217_014230 Ga0501217_014230_954_1367 136
268 3300049665 Ga0501227_000933 Ga0501227_000933_2482_2895 136
269 3300049704 Ga0501221_023952 Ga0501221_023952_204_617 136
270 3300049770 Ga0501273_096774 Ga0501273_096774_30_440 136
271 3300049850 Ga0501204_085090 Ga0501204_085090_105_518 136
272 3300053080 Ga0500635_0258537 Ga0500635_0258537_40_453 136
273 3300053092 Ga0500583_0045963 Ga0500583_0045963_125_535 136
274 3300053120 Ga0500597_014512 Ga0500597_014512_704_1117 136
275 3300053123 Ga0500614_003963 Ga0500614_003963_2010_2423 136
276 3300053130 Ga0500642_0091270 Ga0500642_0091270_106_516 136
277 3300053150 Ga0500603_004061 Ga0500603_004061_931_1344 136
278 3300053162 Ga0500638_248500 Ga0500638_248500_113_526 136
279 3300053177 Ga0500636_0190791 Ga0500636_0190791_372_785 136
280 3300053178 Ga0500637_0193543 Ga0500637_0193543_369_782 136
281 3300054114 Ga0501084_1185622 Ga0501084_1185622_54_464 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13237

Fer4_10

4Fe-4S dicluster domain

7

57

0.93

PF00037

Fer4

4Fe-4S binding domain

39

62

0.92

PF11953

DUF3470

Domain of unknown function (DUF3470)

103

136

0.92

Feature Viewer

pLDDT pTM Quality
56.14 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map