F384158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 160 | 281 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100023210|Ga0068853_1000232108 |
| Length | 184 |
| Sequence | MTVINTVIFIYGTGFRKLPAVKDCYMSIEKENFLRTKLVQYLQRLDPATPPRWGKMNVQQMVEHYAGDAVRNASGRLKIEKIITPPEALERMREFMMSEKPFKENTKNPLMGEEPTPLRYKTVQAAIGALQQELIYFFEAFEKDPQLITRNPFFGDLNFEQCVQLLYKHALHHLRQFGVEPLTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 124 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 129 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 130 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 131 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 133 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 134 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 135 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 136 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 137 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 138 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 139 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 140 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 159 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 160 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.14 |
| Nodule | 0 |
| Rhizoplane | 2.14 |
| Rhizosphere | 93.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10040363 | 3300002077 | Bacteria | 874 |
| 2 | rootH2_10311920 | 3300003320 | Bacteria | 1858 |
| 3 | rootL2_10051861 | 3300003322 | Bacteria | 1302 |
| 4 | rootL2_10309718 | 3300003322 | Bacteria | 2289 |
| 5 | Ga0065712_10017913 | 3300005290 | Unclassified | 2708 |
| 6 | Ga0065715_10131423 | 3300005293 | Bacteria | 2008 |
| 7 | Ga0070676_10103215 | 3300005328 | Bacteria | 1765 |
| 8 | Ga0070676_11006582 | 3300005328 | Bacteria | 626 |
| 9 | Ga0070683_100455042 | 3300005329 | Bacteria | 1221 |
| 10 | Ga0070690_100067926 | 3300005330 | Bacteria | 2311 |
| 11 | Ga0070690_100754358 | 3300005330 | Bacteria | 751 |
| 12 | Ga0070670_100029758 | 3300005331 | Bacteria | 4704 |
| 13 | Ga0070670_100123344 | 3300005331 | Bacteria | 2235 |
| 14 | Ga0070670_100944059 | 3300005331 | Unclassified | 783 |
| 15 | Ga0068869_100066213 | 3300005334 | Unclassified | 2661 |
| 16 | Ga0068869_100171348 | 3300005334 | Unclassified | 1696 |
| 17 | Ga0068869_100255285 | 3300005334 | Bacteria | 1402 |
| 18 | Ga0068869_101205296 | 3300005334 | Bacteria | 665 |
| 19 | Ga0070680_100119428 | 3300005336 | Bacteria | 2199 |
| 20 | Ga0070682_100696113 | 3300005337 | Bacteria | 814 |
| 21 | Ga0068868_100141948 | 3300005338 | Unclassified | 1972 |
| 22 | Ga0068868_100462416 | 3300005338 | Bacteria | 1105 |
| 23 | Ga0070689_101493074 | 3300005340 | Unclassified | 612 |
| 24 | Ga0070687_100035571 | 3300005343 | Unclassified | 2474 |
| 25 | Ga0070687_100048473 | 3300005343 | Bacteria | 2184 |
| 26 | Ga0070687_100054536 | 3300005343 | Bacteria | 2083 |
| 27 | Ga0070687_100453089 | 3300005343 | Unclassified | 854 |
| 28 | Ga0070661_100478437 | 3300005344 | Unclassified | 994 |
| 29 | Ga0070661_101046429 | 3300005344 | Bacteria | 678 |
| 30 | Ga0070668_100009511 | 3300005347 | Bacteria | 7211 |
| 31 | Ga0070668_100066280 | 3300005347 | Bacteria | 2802 |
| 32 | Ga0070668_100248212 | 3300005347 | Bacteria | 1477 |
| 33 | Ga0070669_100006379 | 3300005353 | Bacteria | 8494 |
| 34 | Ga0070675_100016567 | 3300005354 | Bacteria | 5850 |
| 35 | Ga0070674_100005144 | 3300005356 | Bacteria | 7522 |
| 36 | Ga0070673_100004720 | 3300005364 | Bacteria | 8654 |
| 37 | Ga0070673_101240390 | 3300005364 | Unclassified | 699 |
| 38 | Ga0070673_101464678 | 3300005364 | Unclassified | 643 |
| 39 | Ga0070688_100004858 | 3300005365 | Bacteria | 7030 |
| 40 | Ga0070667_100144457 | 3300005367 | Bacteria | 2085 |
| 41 | Ga0070667_101065099 | 3300005367 | Bacteria | 755 |
| 42 | Ga0070711_100739816 | 3300005439 | Bacteria | 830 |
| 43 | Ga0070700_100048791 | 3300005441 | Bacteria | 2625 |
| 44 | Ga0070700_100742035 | 3300005441 | Unclassified | 785 |
| 45 | Ga0070678_100440512 | 3300005456 | Bacteria | 1139 |
| 46 | Ga0068867_100006143 | 3300005459 | Bacteria | 8502 |
| 47 | Ga0068867_100043323 | 3300005459 | Bacteria | 3295 |
| 48 | Ga0068867_100267562 | 3300005459 | Bacteria | 1396 |
| 49 | Ga0070679_100402528 | 3300005530 | Bacteria | 1314 |
| 50 | Ga0068853_100023210 | 3300005539 | Bacteria | 5190 |
| 51 | Ga0068853_100370725 | 3300005539 | Bacteria | 1335 |
| 52 | Ga0068853_100414611 | 3300005539 | Bacteria | 1262 |
| 53 | Ga0068853_101780632 | 3300005539 | Bacteria | 597 |
| 54 | Ga0070672_100673820 | 3300005543 | Bacteria | 904 |
| 55 | Ga0070695_100884740 | 3300005545 | Bacteria | 720 |
| 56 | Ga0070665_100392750 | 3300005548 | Unclassified | 1395 |
| 57 | Ga0068855_100299329 | 3300005563 | Bacteria | 1782 |
| 58 | Ga0068857_100206192 | 3300005577 | Bacteria | 1793 |
| 59 | Ga0068857_101117143 | 3300005577 | Bacteria | 761 |
| 60 | Ga0068857_101347636 | 3300005577 | Bacteria | 693 |
| 61 | Ga0068856_100272697 | 3300005614 | Bacteria | 1708 |
| 62 | Ga0068852_100151864 | 3300005616 | Bacteria | 2155 |
| 63 | Ga0068859_100186132 | 3300005617 | Bacteria | 2160 |
| 64 | Ga0068859_100271131 | 3300005617 | Bacteria | 1789 |
| 65 | Ga0068859_100344471 | 3300005617 | Bacteria | 1585 |
| 66 | Ga0068859_100957366 | 3300005617 | Bacteria | 939 |
| 67 | Ga0068859_101009157 | 3300005617 | Bacteria | 914 |
| 68 | Ga0068864_100089876 | 3300005618 | Bacteria | 2707 |
| 69 | Ga0068861_100030024 | 3300005719 | Bacteria | 3982 |
| 70 | Ga0068861_100266975 | 3300005719 | Bacteria | 1468 |
| 71 | Ga0068861_100274084 | 3300005719 | Bacteria | 1450 |
| 72 | Ga0068870_10047869 | 3300005840 | Bacteria | 2249 |
| 73 | Ga0068870_10288520 | 3300005840 | Bacteria | 1031 |
| 74 | Ga0068863_100202381 | 3300005841 | Bacteria | 1910 |
| 75 | Ga0068858_100314669 | 3300005842 | Bacteria | 1495 |
| 76 | Ga0068860_100007403 | 3300005843 | Bacteria | 10982 |
| 77 | Ga0068860_100046986 | 3300005843 | Bacteria | 4115 |
| 78 | Ga0068860_100125781 | 3300005843 | Unclassified | 2457 |
| 79 | Ga0068860_100580325 | 3300005843 | Bacteria | 1125 |
| 80 | Ga0068862_100012024 | 3300005844 | Bacteria | 7152 |
| 81 | Ga0068862_100015255 | 3300005844 | Bacteria | 6381 |
| 82 | Ga0068862_100199455 | 3300005844 | Bacteria | 1804 |
| 83 | Ga0068862_100707873 | 3300005844 | Bacteria | 976 |
| 84 | Ga0068862_101302242 | 3300005844 | Bacteria | 728 |
| 85 | Ga0075366_10224811 | 3300006195 | Bacteria | 1144 |
| 86 | Ga0097621_100024909 | 3300006237 | Bacteria | 4678 |
| 87 | Ga0097621_100329794 | 3300006237 | Unclassified | 1353 |
| 88 | Ga0068871_100004728 | 3300006358 | Bacteria | 9526 |
| 89 | Ga0075428_100056157 | 3300006844 | Bacteria | 4313 |
| 90 | Ga0075430_100058698 | 3300006846 | Bacteria | 3235 |
| 91 | Ga0075429_100007833 | 3300006880 | Bacteria | 9278 |
| 92 | Ga0068865_100207677 | 3300006881 | Bacteria | 1524 |
| 93 | Ga0068865_100481834 | 3300006881 | Bacteria | 1031 |
| 94 | Ga0068865_101272521 | 3300006881 | Bacteria | 653 |
| 95 | Ga0097620_100186128 | 3300006931 | Bacteria | 2160 |
| 96 | Ga0097620_100271109 | 3300006931 | Bacteria | 1789 |
| 97 | Ga0097620_100344479 | 3300006931 | Bacteria | 1585 |
| 98 | Ga0097620_100957283 | 3300006931 | Bacteria | 939 |
| 99 | Ga0097620_101009076 | 3300006931 | Bacteria | 914 |
| 100 | Ga0105240_10415476 | 3300009093 | Bacteria | 1513 |
| 101 | Ga0111539_10024931 | 3300009094 | Bacteria | 7332 |
| 102 | Ga0111539_10148781 | 3300009094 | Bacteria | 2741 |
| 103 | Ga0111539_11744241 | 3300009094 | Bacteria | 722 |
| 104 | Ga0105247_10001441 | 3300009101 | Bacteria | 17229 |
| 105 | Ga0114129_10083808 | 3300009147 | Bacteria | 4426 |
| 106 | Ga0105243_10704001 | 3300009148 | Bacteria | 985 |
| 107 | Ga0105241_10002042 | 3300009174 | Bacteria | 15268 |
| 108 | Ga0105242_10106055 | 3300009176 | Unclassified | 2387 |
| 109 | Ga0105242_10289706 | 3300009176 | Unclassified | 1490 |
| 110 | Ga0105242_11272005 | 3300009176 | Bacteria | 758 |
| 111 | Ga0105242_11560584 | 3300009176 | Unclassified | 693 |
| 112 | Ga0105248_10089248 | 3300009177 | Bacteria | 3470 |
| 113 | Ga0105237_10200200 | 3300009545 | Bacteria | 1997 |
| 114 | Ga0105249_10000816 | 3300009553 | Bacteria | 28088 |
| 115 | Ga0105249_10007888 | 3300009553 | Bacteria | 9277 |
| 116 | Ga0105249_10011001 | 3300009553 | Bacteria | 7950 |
| 117 | Ga0105249_10015813 | 3300009553 | Bacteria | 6686 |
| 118 | Ga0105249_10197506 | 3300009553 | Bacteria | 1967 |
| 119 | Ga0105249_10317277 | 3300009553 | Unclassified | 1569 |
| 120 | Ga0105249_12269233 | 3300009553 | Bacteria | 615 |
| 121 | Ga0105239_10106480 | 3300010375 | Bacteria | 3106 |
| 122 | Ga0105239_10179423 | 3300010375 | Bacteria | 2369 |
| 123 | Ga0105246_10580936 | 3300011119 | Bacteria | 965 |
| 124 | Ga0157373_10063517 | 3300013100 | Bacteria | 2614 |
| 125 | Ga0157371_10103225 | 3300013102 | Bacteria | 2023 |
| 126 | Ga0157370_10005549 | 3300013104 | Bacteria | 14145 |
| 127 | Ga0157369_10048639 | 3300013105 | Bacteria | 4601 |
| 128 | Ga0157378_10353885 | 3300013297 | Bacteria | 1435 |
| 129 | Ga0157378_10450569 | 3300013297 | Unclassified | 1277 |
| 130 | Ga0157378_10549528 | 3300013297 | Bacteria | 1160 |
| 131 | Ga0163162_10003143 | 3300013306 | Bacteria | 15770 |
| 132 | Ga0163162_10008479 | 3300013306 | Bacteria | 10029 |
| 133 | Ga0163162_10054675 | 3300013306 | Bacteria | 4016 |
| 134 | Ga0163162_10213033 | 3300013306 | Unclassified | 2062 |
| 135 | Ga0163162_10586465 | 3300013306 | Bacteria | 1241 |
| 136 | Ga0163162_10903221 | 3300013306 | Bacteria | 996 |
| 137 | Ga0163162_11421771 | 3300013306 | Bacteria | 789 |
| 138 | Ga0157372_10815115 | 3300013307 | Bacteria | 1084 |
| 139 | Ga0157375_10005625 | 3300013308 | Bacteria | 10911 |
| 140 | Ga0157375_12290666 | 3300013308 | Bacteria | 644 |
| 141 | Ga0163163_10001087 | 3300014325 | Bacteria | 23055 |
| 142 | Ga0163163_10074899 | 3300014325 | Bacteria | 3378 |
| 143 | Ga0163163_10157434 | 3300014325 | Unclassified | 2316 |
| 144 | Ga0163163_10528251 | 3300014325 | Bacteria | 1242 |
| 145 | Ga0157380_10014572 | 3300014326 | Bacteria | 5755 |
| 146 | Ga0157377_10007096 | 3300014745 | Bacteria | 5385 |
| 147 | Ga0157379_10008567 | 3300014968 | Bacteria | 8899 |
| 148 | Ga0157379_10440007 | 3300014968 | Bacteria | 1202 |
| 149 | Ga0157376_10920109 | 3300014969 | Bacteria | 893 |
| 150 | Ga0163161_10022285 | 3300017792 | Bacteria | 4459 |
| 151 | Ga0163161_10079823 | 3300017792 | Bacteria | 2407 |
| 152 | Ga0163161_10305140 | 3300017792 | Bacteria | 1255 |
| 153 | Ga0207697_10012652 | 3300025315 | Bacteria | 3533 |
| 154 | Ga0207682_10199906 | 3300025893 | Bacteria | 919 |
| 155 | Ga0207710_10000326 | 3300025900 | Bacteria | 36470 |
| 156 | Ga0207645_10019622 | 3300025907 | Bacteria | 4431 |
| 157 | Ga0207645_10083393 | 3300025907 | Unclassified | 2050 |
| 158 | Ga0207645_10803787 | 3300025907 | Bacteria | 639 |
| 159 | Ga0207643_10055382 | 3300025908 | Unclassified | 2255 |
| 160 | Ga0207695_10321949 | 3300025913 | Bacteria | 1436 |
| 161 | Ga0207671_10187204 | 3300025914 | Bacteria | 1613 |
| 162 | Ga0207662_10159134 | 3300025918 | Bacteria | 1442 |
| 163 | Ga0207652_10184201 | 3300025921 | Bacteria | 1877 |
| 164 | Ga0207681_10065146 | 3300025923 | Bacteria | 2518 |
| 165 | Ga0207681_10314281 | 3300025923 | Unclassified | 1243 |
| 166 | Ga0207650_10077274 | 3300025925 | Bacteria | 2516 |
| 167 | Ga0207650_10099479 | 3300025925 | Bacteria | 2236 |
| 168 | Ga0207659_10024161 | 3300025926 | Bacteria | 4068 |
| 169 | Ga0207644_11136433 | 3300025931 | Bacteria | 656 |
| 170 | Ga0207706_10041716 | 3300025933 | Bacteria | 4067 |
| 171 | Ga0207686_10030658 | 3300025934 | Unclassified | 3186 |
| 172 | Ga0207686_10419415 | 3300025934 | Bacteria | 1023 |
| 173 | Ga0207670_10252313 | 3300025936 | Bacteria | 1364 |
| 174 | Ga0207669_10020947 | 3300025937 | Unclassified | 3440 |
| 175 | Ga0207704_10062070 | 3300025938 | Unclassified | 2322 |
| 176 | Ga0207704_10432593 | 3300025938 | Bacteria | 1046 |
| 177 | Ga0207691_10047036 | 3300025940 | Bacteria | 3962 |
| 178 | Ga0207691_11072408 | 3300025940 | Bacteria | 671 |
| 179 | Ga0207689_10028252 | 3300025942 | Bacteria | 4692 |
| 180 | Ga0207689_10130462 | 3300025942 | Bacteria | 2069 |
| 181 | Ga0207689_10140615 | 3300025942 | Unclassified | 1988 |
| 182 | Ga0207661_10409555 | 3300025944 | Bacteria | 1230 |
| 183 | Ga0207667_10113880 | 3300025949 | Bacteria | 2788 |
| 184 | Ga0207651_10020295 | 3300025960 | Bacteria | 4008 |
| 185 | Ga0207651_10386644 | 3300025960 | Bacteria | 1187 |
| 186 | Ga0207651_11570763 | 3300025960 | Bacteria | 593 |
| 187 | Ga0207712_10000626 | 3300025961 | Bacteria | 27964 |
| 188 | Ga0207712_10027326 | 3300025961 | Unclassified | 3809 |
| 189 | Ga0207712_10040570 | 3300025961 | Bacteria | 3196 |
| 190 | Ga0207712_10091571 | 3300025961 | Bacteria | 2240 |
| 191 | Ga0207668_10047520 | 3300025972 | Unclassified | 2939 |
| 192 | Ga0207668_10253995 | 3300025972 | Unclassified | 1429 |
| 193 | Ga0207668_11539361 | 3300025972 | Bacteria | 600 |
| 194 | Ga0207640_10066520 | 3300025981 | Bacteria | 2408 |
| 195 | Ga0207640_10262984 | 3300025981 | Bacteria | 1346 |
| 196 | Ga0207640_10896211 | 3300025981 | Bacteria | 774 |
| 197 | Ga0207658_10226638 | 3300025986 | Bacteria | 1575 |
| 198 | Ga0207658_10254376 | 3300025986 | Bacteria | 1494 |
| 199 | Ga0207658_11014627 | 3300025986 | Bacteria | 757 |
| 200 | Ga0207639_10331954 | 3300026041 | Bacteria | 1353 |
| 201 | Ga0207639_10786960 | 3300026041 | Bacteria | 886 |
| 202 | Ga0207678_11413905 | 3300026067 | Unclassified | 615 |
| 203 | Ga0207708_10075985 | 3300026075 | Bacteria | 2576 |
| 204 | Ga0207708_10113919 | 3300026075 | Bacteria | 2102 |
| 205 | Ga0207708_10855153 | 3300026075 | Unclassified | 785 |
| 206 | Ga0207702_10319050 | 3300026078 | Bacteria | 1479 |
| 207 | Ga0207641_10048640 | 3300026088 | Bacteria | 3580 |
| 208 | Ga0207648_10032732 | 3300026089 | Bacteria | 4587 |
| 209 | Ga0207648_10037211 | 3300026089 | Bacteria | 4286 |
| 210 | Ga0207648_10055001 | 3300026089 | Bacteria | 3475 |
| 211 | Ga0207648_10189509 | 3300026089 | Bacteria | 1822 |
| 212 | Ga0207676_10038271 | 3300026095 | Bacteria | 3659 |
| 213 | Ga0207674_10011558 | 3300026116 | Bacteria | 9916 |
| 214 | Ga0207674_10101186 | 3300026116 | Unclassified | 2863 |
| 215 | Ga0207674_10107625 | 3300026116 | Bacteria | 2765 |
| 216 | Ga0207674_10120784 | 3300026116 | Bacteria | 2588 |
| 217 | Ga0207674_10321586 | 3300026116 | Bacteria | 1496 |
| 218 | Ga0207675_100000971 | 3300026118 | Bacteria | 28493 |
| 219 | Ga0207675_100005986 | 3300026118 | Bacteria | 11578 |
| 220 | Ga0207675_100165688 | 3300026118 | Bacteria | 2110 |
| 221 | Ga0207675_100193084 | 3300026118 | Bacteria | 1954 |
| 222 | Ga0207675_101400418 | 3300026118 | Bacteria | 720 |
| 223 | Ga0207683_10227300 | 3300026121 | Bacteria | 1701 |
| 224 | Ga0207698_10479041 | 3300026142 | Bacteria | 1207 |
| 225 | Ga0207428_10062418 | 3300027907 | Bacteria | 2946 |
| 226 | Ga0207428_10170885 | 3300027907 | Bacteria | 1646 |
| 227 | Ga0268266_10904009 | 3300028379 | Bacteria | 854 |
| 228 | Ga0268265_10012647 | 3300028380 | Bacteria | 5725 |
| 229 | Ga0268265_10078621 | 3300028380 | Unclassified | 2595 |
| 230 | Ga0268265_10089265 | 3300028380 | Unclassified | 2458 |
| 231 | Ga0268265_10130695 | 3300028380 | Bacteria | 2086 |
| 232 | Ga0268265_10648099 | 3300028380 | Bacteria | 1015 |
| 233 | Ga0268264_10077229 | 3300028381 | Bacteria | 2836 |
| 234 | Ga0268264_10645259 | 3300028381 | Bacteria | 1047 |
| 235 | Ga0268264_10687371 | 3300028381 | Bacteria | 1015 |
| 236 | Ga0307516_10085925 | 3300031730 | Bacteria | 2983 |
| 237 | Ga0307409_101423720 | 3300031995 | Bacteria | 720 |
| 238 | Ga0307414_10876357 | 3300032004 | Bacteria | 822 |
| 239 | Ga0395899_0836107 | 3300037312 | Unclassified | 566 |
| 240 | Ga0395900_0137552 | 3300037418 | Bacteria | 2503 |
| 241 | Ga0395898_1247597 | 3300037466 | Unclassified | 674 |
| 242 | Ga0395901_0540532 | 3300038443 | Bacteria | 1182 |
| 243 | Ga0439439_0014091 | 3300041406 | Bacteria | 1944 |
| 244 | Ga0439453_0053464 | 3300041408 | Bacteria | 821 |
| 245 | Ga0439465_0042844 | 3300041413 | Bacteria | 1468 |
| 246 | Ga0451798_0012509 | 3300041458 | Unclassified | 2106 |
| 247 | Ga0451849_1558981 | 3300041505 | Bacteria | 632 |
| 248 | Ga0451843_0775004 | 3300041509 | Bacteria | 2079 |
| 249 | Ga0439441_013234 | 3300042001 | Bacteria | 1429 |
| 250 | Ga0450897_001202 | 3300042128 | Bacteria | 1706 |
| 251 | Ga0450894_007145 | 3300042131 | Bacteria | 1440 |
| 252 | Ga0450898_005998 | 3300042134 | Bacteria | 1854 |
| 253 | Ga0450899_004045 | 3300042135 | Bacteria | 1570 |
| 254 | Ga0439434_0018942 | 3300042435 | Bacteria | 2063 |
| 255 | Ga0439444_0079457 | 3300042437 | Bacteria | 715 |
| 256 | Ga0453684_0129872 | 3300044712 | Bacteria | 3025 |
| 257 | Ga0453684_0206248 | 3300044712 | Bacteria | 2287 |
| 258 | Ga0495638_0313719 | 3300046460 | Bacteria | 840 |
| 259 | Ga0495638_0422909 | 3300046460 | Unclassified | 686 |
| 260 | Ga0495633_0082925 | 3300046558 | Bacteria | 1492 |
| 261 | Ga0495625_0027314 | 3300046660 | Bacteria | 4299 |
| 262 | Ga0495636_0294087 | 3300047318 | Bacteria | 759 |
| 263 | Ga0495672_0062244 | 3300047320 | Bacteria | 2147 |
| 264 | Ga0495672_0323581 | 3300047320 | Unclassified | 723 |
| 265 | Ga0495672_0487136 | 3300047320 | Unclassified | 550 |
| 266 | Ga0496100_0636871 | 3300048903 | Bacteria | 829 |
| 267 | Ga0496101_0472126 | 3300048904 | Bacteria | 990 |
| 268 | Ga0496102_0233202 | 3300048905 | Bacteria | 1735 |
| 269 | Ga0496104_0683886 | 3300048907 | Bacteria | 934 |
| 270 | Ga0496110_0568391 | 3300048913 | Bacteria | 1030 |
| 271 | Ga0501083_0331195 | 3300049744 | Bacteria | 990 |
| 272 | nmdc:mga0k408_29953_c1 | 3300050493 | Unclassified | 3101 |
| 273 | nmdc:mga0k408_50035_c1 | 3300050493 | Bacteria | 2419 |
| 274 | nmdc:mga05p37_42575_c1 | 3300050507 | Bacteria | 5580 |
| 275 | nmdc:mga09592_130837_c1 | 3300050508 | Bacteria | 2159 |
| 276 | nmdc:mga09592_4183_c1 | 3300050508 | Bacteria | 11657 |
| 277 | nmdc:mga0qj67_50886_c1 | 3300050509 | Bacteria | 3275 |
| 278 | nmdc:mga08y16_6499_c1 | 3300050511 | Bacteria | 12256 |
| 279 | Ga0500568_0000224 | 3300053139 | Bacteria | 48575 |
| 280 | Ga0500588_0007438 | 3300053146 | Unclassified | 2526 |
| 281 | Ga0500611_000001 | 3300053727 | Bacteria | 385744 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025893 | Ga0207682_10199906 | Ga0207682_101999062 | 140 |
| 2 | 3300025960 | Ga0207651_11570763 | Ga0207651_115707631 | 145 |
| 3 | 3300042131 | Ga0450894_007145 | Ga0450894_007145_781_1236 | 149 |
| 4 | 3300003320 | rootH2_10311920 | rootH2_103119202 | 152 |
| 5 | 3300003322 | rootL2_10309718 | rootL2_103097182 | 152 |
| 6 | 3300025961 | Ga0207712_10091571 | Ga0207712_100915712 | 152 |
| 7 | 3300026118 | Ga0207675_100193084 | Ga0207675_1001930842 | 152 |
| 8 | 3300005328 | Ga0070676_11006582 | Ga0070676_110065821 | 153 |
| 9 | 3300005329 | Ga0070683_100455042 | Ga0070683_1004550422 | 153 |
| 10 | 3300005330 | Ga0070690_100754358 | Ga0070690_1007543582 | 153 |
| 11 | 3300005334 | Ga0068869_100255285 | Ga0068869_1002552853 | 153 |
| 12 | 3300005336 | Ga0070680_100119428 | Ga0070680_1001194281 | 153 |
| 13 | 3300005337 | Ga0070682_100696113 | Ga0070682_1006961132 | 153 |
| 14 | 3300005338 | Ga0068868_100462416 | Ga0068868_1004624162 | 153 |
| 15 | 3300005344 | Ga0070661_101046429 | Ga0070661_1010464292 | 153 |
| 16 | 3300005347 | Ga0070668_100248212 | Ga0070668_1002482123 | 153 |
| 17 | 3300005367 | Ga0070667_100144457 | Ga0070667_1001444573 | 153 |
| 18 | 3300005439 | Ga0070711_100739816 | Ga0070711_1007398161 | 153 |
| 19 | 3300005456 | Ga0070678_100440512 | Ga0070678_1004405122 | 153 |
| 20 | 3300005530 | Ga0070679_100402528 | Ga0070679_1004025282 | 153 |
| 21 | 3300005539 | Ga0068853_100370725 | Ga0068853_1003707251 | 153 |
| 22 | 3300005539 | Ga0068853_100414611 | Ga0068853_1004146112 | 153 |
| 23 | 3300005539 | Ga0068853_101780632 | Ga0068853_1017806321 | 153 |
| 24 | 3300005543 | Ga0070672_100673820 | Ga0070672_1006738202 | 153 |
| 25 | 3300005548 | Ga0070665_100392750 | Ga0070665_1003927502 | 153 |
| 26 | 3300005577 | Ga0068857_101117143 | Ga0068857_1011171432 | 153 |
| 27 | 3300005614 | Ga0068856_100272697 | Ga0068856_1002726972 | 153 |
| 28 | 3300005616 | Ga0068852_100151864 | Ga0068852_1001518642 | 153 |
| 29 | 3300005617 | Ga0068859_100271131 | Ga0068859_1002711311 | 153 |
| 30 | 3300005617 | Ga0068859_100344471 | Ga0068859_1003444712 | 153 |
| 31 | 3300005618 | Ga0068864_100089876 | Ga0068864_1000898763 | 153 |
| 32 | 3300005719 | Ga0068861_100266975 | Ga0068861_1002669752 | 153 |
| 33 | 3300005842 | Ga0068858_100314669 | Ga0068858_1003146692 | 153 |
| 34 | 3300005843 | Ga0068860_100007403 | Ga0068860_1000074032 | 153 |
| 35 | 3300005843 | Ga0068860_100046986 | Ga0068860_1000469863 | 153 |
| 36 | 3300005843 | Ga0068860_100580325 | Ga0068860_1005803252 | 153 |
| 37 | 3300005844 | Ga0068862_100012024 | Ga0068862_1000120247 | 153 |
| 38 | 3300005844 | Ga0068862_100707873 | Ga0068862_1007078732 | 153 |
| 39 | 3300006237 | Ga0097621_100024909 | Ga0097621_1000249094 | 153 |
| 40 | 3300006237 | Ga0097621_100329794 | Ga0097621_1003297942 | 153 |
| 41 | 3300006358 | Ga0068871_100004728 | Ga0068871_1000047289 | 153 |
| 42 | 3300006881 | Ga0068865_100207677 | Ga0068865_1002076772 | 153 |
| 43 | 3300006931 | Ga0097620_100271109 | Ga0097620_1002711091 | 153 |
| 44 | 3300006931 | Ga0097620_100344479 | Ga0097620_1003444792 | 153 |
| 45 | 3300009101 | Ga0105247_10001441 | Ga0105247_100014417 | 153 |
| 46 | 3300009174 | Ga0105241_10002042 | Ga0105241_100020422 | 153 |
| 47 | 3300009176 | Ga0105242_10289706 | Ga0105242_102897062 | 153 |
| 48 | 3300009177 | Ga0105248_10089248 | Ga0105248_100892482 | 153 |
| 49 | 3300009545 | Ga0105237_10200200 | Ga0105237_102002004 | 153 |
| 50 | 3300009553 | Ga0105249_10000816 | Ga0105249_1000081624 | 153 |
| 51 | 3300009553 | Ga0105249_10011001 | Ga0105249_100110013 | 153 |
| 52 | 3300009553 | Ga0105249_10197506 | Ga0105249_101975062 | 153 |
| 53 | 3300010375 | Ga0105239_10106480 | Ga0105239_101064802 | 153 |
| 54 | 3300011119 | Ga0105246_10580936 | Ga0105246_105809363 | 153 |
| 55 | 3300013100 | Ga0157373_10063517 | Ga0157373_100635172 | 153 |
| 56 | 3300013102 | Ga0157371_10103225 | Ga0157371_101032254 | 153 |
| 57 | 3300013105 | Ga0157369_10048639 | Ga0157369_100486392 | 153 |
| 58 | 3300013297 | Ga0157378_10353885 | Ga0157378_103538852 | 153 |
| 59 | 3300013306 | Ga0163162_10003143 | Ga0163162_1000314313 | 153 |
| 60 | 3300013306 | Ga0163162_10008479 | Ga0163162_100084794 | 153 |
| 61 | 3300013306 | Ga0163162_10054675 | Ga0163162_100546753 | 153 |
| 62 | 3300013306 | Ga0163162_10586465 | Ga0163162_105864653 | 153 |
| 63 | 3300013306 | Ga0163162_10903221 | Ga0163162_109032211 | 153 |
| 64 | 3300013307 | Ga0157372_10815115 | Ga0157372_108151152 | 153 |
| 65 | 3300013308 | Ga0157375_12290666 | Ga0157375_122906661 | 153 |
| 66 | 3300014325 | Ga0163163_10001087 | Ga0163163_100010879 | 153 |
| 67 | 3300014325 | Ga0163163_10074899 | Ga0163163_100748992 | 153 |
| 68 | 3300014325 | Ga0163163_10157434 | Ga0163163_101574343 | 153 |
| 69 | 3300014325 | Ga0163163_10528251 | Ga0163163_105282512 | 153 |
| 70 | 3300014968 | Ga0157379_10008567 | Ga0157379_100085679 | 153 |
| 71 | 3300014968 | Ga0157379_10440007 | Ga0157379_104400072 | 153 |
| 72 | 3300014969 | Ga0157376_10920109 | Ga0157376_109201091 | 153 |
| 73 | 3300017792 | Ga0163161_10022285 | Ga0163161_100222852 | 153 |
| 74 | 3300017792 | Ga0163161_10079823 | Ga0163161_100798232 | 153 |
| 75 | 3300025900 | Ga0207710_10000326 | Ga0207710_100003266 | 153 |
| 76 | 3300025907 | Ga0207645_10803787 | Ga0207645_108037871 | 153 |
| 77 | 3300025913 | Ga0207695_10321949 | Ga0207695_103219492 | 153 |
| 78 | 3300025914 | Ga0207671_10187204 | Ga0207671_101872042 | 153 |
| 79 | 3300025921 | Ga0207652_10184201 | Ga0207652_101842013 | 153 |
| 80 | 3300025923 | Ga0207681_10065146 | Ga0207681_100651463 | 153 |
| 81 | 3300025931 | Ga0207644_11136433 | Ga0207644_111364331 | 153 |
| 82 | 3300025934 | Ga0207686_10419415 | Ga0207686_104194152 | 153 |
| 83 | 3300025938 | Ga0207704_10432593 | Ga0207704_104325932 | 153 |
| 84 | 3300025940 | Ga0207691_11072408 | Ga0207691_110724082 | 153 |
| 85 | 3300025942 | Ga0207689_10130462 | Ga0207689_101304623 | 153 |
| 86 | 3300025944 | Ga0207661_10409555 | Ga0207661_104095552 | 153 |
| 87 | 3300025949 | Ga0207667_10113880 | Ga0207667_101138802 | 153 |
| 88 | 3300025961 | Ga0207712_10000626 | Ga0207712_1000062625 | 153 |
| 89 | 3300025961 | Ga0207712_10027326 | Ga0207712_100273262 | 153 |
| 90 | 3300025972 | Ga0207668_11539361 | Ga0207668_115393611 | 153 |
| 91 | 3300025981 | Ga0207640_10896211 | Ga0207640_108962112 | 153 |
| 92 | 3300025986 | Ga0207658_10226638 | Ga0207658_102266381 | 153 |
| 93 | 3300025986 | Ga0207658_10254376 | Ga0207658_102543762 | 153 |
| 94 | 3300026041 | Ga0207639_10331954 | Ga0207639_103319542 | 153 |
| 95 | 3300026067 | Ga0207678_11413905 | Ga0207678_114139051 | 153 |
| 96 | 3300026078 | Ga0207702_10319050 | Ga0207702_103190502 | 153 |
| 97 | 3300026095 | Ga0207676_10038271 | Ga0207676_100382716 | 153 |
| 98 | 3300026116 | Ga0207674_10321586 | Ga0207674_103215862 | 153 |
| 99 | 3300026121 | Ga0207683_10227300 | Ga0207683_102273002 | 153 |
| 100 | 3300028379 | Ga0268266_10904009 | Ga0268266_109040091 | 153 |
| 101 | 3300028380 | Ga0268265_10089265 | Ga0268265_100892652 | 153 |
| 102 | 3300028380 | Ga0268265_10130695 | Ga0268265_101306952 | 153 |
| 103 | 3300028381 | Ga0268264_10077229 | Ga0268264_100772293 | 153 |
| 104 | 3300028381 | Ga0268264_10645259 | Ga0268264_106452592 | 153 |
| 105 | 3300028381 | Ga0268264_10687371 | Ga0268264_106873712 | 153 |
| 106 | 3300048903 | Ga0496100_0636871 | Ga0496100_0636871_142_603 | 153 |
| 107 | 3300048904 | Ga0496101_0472126 | Ga0496101_0472126_59_520 | 153 |
| 108 | 3300048905 | Ga0496102_0233202 | Ga0496102_0233202_256_717 | 153 |
| 109 | 3300048907 | Ga0496104_0683886 | Ga0496104_0683886_232_693 | 153 |
| 110 | 3300048913 | Ga0496110_0568391 | Ga0496110_0568391_137_598 | 153 |
| 111 | 3300005356 | Ga0070674_100005144 | Ga0070674_1000051447 | 154 |
| 112 | 3300005441 | Ga0070700_100742035 | Ga0070700_1007420351 | 154 |
| 113 | 3300005459 | Ga0068867_100267562 | Ga0068867_1002675622 | 154 |
| 114 | 3300006881 | Ga0068865_101272521 | Ga0068865_1012725211 | 154 |
| 115 | 3300009094 | Ga0111539_10148781 | Ga0111539_101487812 | 154 |
| 116 | 3300009176 | Ga0105242_11272005 | Ga0105242_112720051 | 154 |
| 117 | 3300010375 | Ga0105239_10179423 | Ga0105239_101794232 | 154 |
| 118 | 3300025981 | Ga0207640_10262984 | Ga0207640_102629842 | 154 |
| 119 | 3300026075 | Ga0207708_10855153 | Ga0207708_108551532 | 154 |
| 120 | 3300026089 | Ga0207648_10037211 | Ga0207648_100372112 | 154 |
| 121 | 3300026116 | Ga0207674_10107625 | Ga0207674_101076253 | 154 |
| 122 | 3300027907 | Ga0207428_10170885 | Ga0207428_101708852 | 154 |
| 123 | 3300044712 | Ga0453684_0129872 | Ga0453684_0129872_845_1315 | 154 |
| 124 | 3300046660 | Ga0495625_0027314 | Ga0495625_0027314_2929_3393 | 154 |
| 125 | 3300050508 | nmdc:mga09592_130837_c1 | nmdc:mga09592_130837_c1_1398_1874 | 154 |
| 126 | 3300053146 | Ga0500588_0007438 | Ga0500588_0007438_1044_1508 | 154 |
| 127 | 3300003322 | rootL2_10051861 | rootL2_100518612 | 155 |
| 128 | 3300005290 | Ga0065712_10017913 | Ga0065712_100179132 | 155 |
| 129 | 3300005293 | Ga0065715_10131423 | Ga0065715_101314233 | 155 |
| 130 | 3300005328 | Ga0070676_10103215 | Ga0070676_101032152 | 155 |
| 131 | 3300005330 | Ga0070690_100067926 | Ga0070690_1000679263 | 155 |
| 132 | 3300005331 | Ga0070670_100029758 | Ga0070670_1000297583 | 155 |
| 133 | 3300005331 | Ga0070670_100123344 | Ga0070670_1001233443 | 155 |
| 134 | 3300005331 | Ga0070670_100944059 | Ga0070670_1009440591 | 155 |
| 135 | 3300005334 | Ga0068869_100066213 | Ga0068869_1000662133 | 155 |
| 136 | 3300005334 | Ga0068869_100171348 | Ga0068869_1001713482 | 155 |
| 137 | 3300005334 | Ga0068869_101205296 | Ga0068869_1012052962 | 155 |
| 138 | 3300005338 | Ga0068868_100141948 | Ga0068868_1001419481 | 155 |
| 139 | 3300005340 | Ga0070689_101493074 | Ga0070689_1014930741 | 155 |
| 140 | 3300005343 | Ga0070687_100035571 | Ga0070687_1000355713 | 155 |
| 141 | 3300005343 | Ga0070687_100048473 | Ga0070687_1000484732 | 155 |
| 142 | 3300005343 | Ga0070687_100054536 | Ga0070687_1000545363 | 155 |
| 143 | 3300005344 | Ga0070661_100478437 | Ga0070661_1004784372 | 155 |
| 144 | 3300005347 | Ga0070668_100009511 | Ga0070668_1000095118 | 155 |
| 145 | 3300005347 | Ga0070668_100066280 | Ga0070668_1000662804 | 155 |
| 146 | 3300005353 | Ga0070669_100006379 | Ga0070669_1000063798 | 155 |
| 147 | 3300005354 | Ga0070675_100016567 | Ga0070675_1000165672 | 155 |
| 148 | 3300005364 | Ga0070673_100004720 | Ga0070673_1000047208 | 155 |
| 149 | 3300005364 | Ga0070673_101240390 | Ga0070673_1012403901 | 155 |
| 150 | 3300005364 | Ga0070673_101464678 | Ga0070673_1014646781 | 155 |
| 151 | 3300005365 | Ga0070688_100004858 | Ga0070688_1000048585 | 155 |
| 152 | 3300005367 | Ga0070667_101065099 | Ga0070667_1010650991 | 155 |
| 153 | 3300005441 | Ga0070700_100048791 | Ga0070700_1000487913 | 155 |
| 154 | 3300005459 | Ga0068867_100006143 | Ga0068867_1000061436 | 155 |
| 155 | 3300005459 | Ga0068867_100043323 | Ga0068867_1000433235 | 155 |
| 156 | 3300005539 | Ga0068853_100023210 | Ga0068853_1000232108 | 155 |
| 157 | 3300005545 | Ga0070695_100884740 | Ga0070695_1008847401 | 155 |
| 158 | 3300005563 | Ga0068855_100299329 | Ga0068855_1002993294 | 155 |
| 159 | 3300005577 | Ga0068857_100206192 | Ga0068857_1002061922 | 155 |
| 160 | 3300005577 | Ga0068857_101347636 | Ga0068857_1013476362 | 155 |
| 161 | 3300005617 | Ga0068859_100186132 | Ga0068859_1001861323 | 155 |
| 162 | 3300005617 | Ga0068859_101009157 | Ga0068859_1010091572 | 155 |
| 163 | 3300005719 | Ga0068861_100030024 | Ga0068861_1000300246 | 155 |
| 164 | 3300005719 | Ga0068861_100274084 | Ga0068861_1002740841 | 155 |
| 165 | 3300005840 | Ga0068870_10047869 | Ga0068870_100478693 | 155 |
| 166 | 3300005840 | Ga0068870_10288520 | Ga0068870_102885202 | 155 |
| 167 | 3300005841 | Ga0068863_100202381 | Ga0068863_1002023811 | 155 |
| 168 | 3300005843 | Ga0068860_100125781 | Ga0068860_1001257813 | 155 |
| 169 | 3300005844 | Ga0068862_100015255 | Ga0068862_1000152556 | 155 |
| 170 | 3300005844 | Ga0068862_100199455 | Ga0068862_1001994552 | 155 |
| 171 | 3300005844 | Ga0068862_101302242 | Ga0068862_1013022421 | 155 |
| 172 | 3300006195 | Ga0075366_10224811 | Ga0075366_102248112 | 155 |
| 173 | 3300006844 | Ga0075428_100056157 | Ga0075428_1000561572 | 155 |
| 174 | 3300006846 | Ga0075430_100058698 | Ga0075430_1000586982 | 155 |
| 175 | 3300006880 | Ga0075429_100007833 | Ga0075429_1000078334 | 155 |
| 176 | 3300006881 | Ga0068865_100481834 | Ga0068865_1004818342 | 155 |
| 177 | 3300006931 | Ga0097620_100186128 | Ga0097620_1001861283 | 155 |
| 178 | 3300006931 | Ga0097620_101009076 | Ga0097620_1010090762 | 155 |
| 179 | 3300009093 | Ga0105240_10415476 | Ga0105240_104154762 | 155 |
| 180 | 3300009094 | Ga0111539_10024931 | Ga0111539_100249312 | 155 |
| 181 | 3300009094 | Ga0111539_11744241 | Ga0111539_117442411 | 155 |
| 182 | 3300009147 | Ga0114129_10083808 | Ga0114129_100838082 | 155 |
| 183 | 3300009148 | Ga0105243_10704001 | Ga0105243_107040012 | 155 |
| 184 | 3300009176 | Ga0105242_10106055 | Ga0105242_101060554 | 155 |
| 185 | 3300009176 | Ga0105242_11560584 | Ga0105242_115605841 | 155 |
| 186 | 3300009553 | Ga0105249_10007888 | Ga0105249_100078883 | 155 |
| 187 | 3300009553 | Ga0105249_10015813 | Ga0105249_100158133 | 155 |
| 188 | 3300009553 | Ga0105249_10317277 | Ga0105249_103172772 | 155 |
| 189 | 3300009553 | Ga0105249_12269233 | Ga0105249_122692331 | 155 |
| 190 | 3300013297 | Ga0157378_10450569 | Ga0157378_104505691 | 155 |
| 191 | 3300013297 | Ga0157378_10549528 | Ga0157378_105495282 | 155 |
| 192 | 3300013306 | Ga0163162_10213033 | Ga0163162_102130333 | 155 |
| 193 | 3300013306 | Ga0163162_11421771 | Ga0163162_114217711 | 155 |
| 194 | 3300013308 | Ga0157375_10005625 | Ga0157375_100056253 | 155 |
| 195 | 3300014326 | Ga0157380_10014572 | Ga0157380_100145723 | 155 |
| 196 | 3300014745 | Ga0157377_10007096 | Ga0157377_100070963 | 155 |
| 197 | 3300017792 | Ga0163161_10305140 | Ga0163161_103051403 | 155 |
| 198 | 3300025315 | Ga0207697_10012652 | Ga0207697_100126522 | 155 |
| 199 | 3300025907 | Ga0207645_10019622 | Ga0207645_100196223 | 155 |
| 200 | 3300025907 | Ga0207645_10083393 | Ga0207645_100833934 | 155 |
| 201 | 3300025908 | Ga0207643_10055382 | Ga0207643_100553822 | 155 |
| 202 | 3300025918 | Ga0207662_10159134 | Ga0207662_101591342 | 155 |
| 203 | 3300025923 | Ga0207681_10314281 | Ga0207681_103142812 | 155 |
| 204 | 3300025925 | Ga0207650_10077274 | Ga0207650_100772742 | 155 |
| 205 | 3300025925 | Ga0207650_10099479 | Ga0207650_100994793 | 155 |
| 206 | 3300025926 | Ga0207659_10024161 | Ga0207659_100241612 | 155 |
| 207 | 3300025933 | Ga0207706_10041716 | Ga0207706_100417161 | 155 |
| 208 | 3300025934 | Ga0207686_10030658 | Ga0207686_100306583 | 155 |
| 209 | 3300025936 | Ga0207670_10252313 | Ga0207670_102523132 | 155 |
| 210 | 3300025937 | Ga0207669_10020947 | Ga0207669_100209474 | 155 |
| 211 | 3300025938 | Ga0207704_10062070 | Ga0207704_100620704 | 155 |
| 212 | 3300025940 | Ga0207691_10047036 | Ga0207691_100470364 | 155 |
| 213 | 3300025942 | Ga0207689_10028252 | Ga0207689_100282523 | 155 |
| 214 | 3300025942 | Ga0207689_10140615 | Ga0207689_101406153 | 155 |
| 215 | 3300025960 | Ga0207651_10020295 | Ga0207651_100202955 | 155 |
| 216 | 3300025960 | Ga0207651_10386644 | Ga0207651_103866442 | 155 |
| 217 | 3300025961 | Ga0207712_10040570 | Ga0207712_100405703 | 155 |
| 218 | 3300025972 | Ga0207668_10047520 | Ga0207668_100475203 | 155 |
| 219 | 3300025972 | Ga0207668_10253995 | Ga0207668_102539952 | 155 |
| 220 | 3300025981 | Ga0207640_10066520 | Ga0207640_100665203 | 155 |
| 221 | 3300025986 | Ga0207658_11014627 | Ga0207658_110146272 | 155 |
| 222 | 3300026041 | Ga0207639_10786960 | Ga0207639_107869601 | 155 |
| 223 | 3300026075 | Ga0207708_10075985 | Ga0207708_100759853 | 155 |
| 224 | 3300026075 | Ga0207708_10113919 | Ga0207708_101139192 | 155 |
| 225 | 3300026088 | Ga0207641_10048640 | Ga0207641_100486403 | 155 |
| 226 | 3300026089 | Ga0207648_10032732 | Ga0207648_100327323 | 155 |
| 227 | 3300026089 | Ga0207648_10055001 | Ga0207648_100550015 | 155 |
| 228 | 3300026089 | Ga0207648_10189509 | Ga0207648_101895092 | 155 |
| 229 | 3300026116 | Ga0207674_10011558 | Ga0207674_100115587 | 155 |
| 230 | 3300026116 | Ga0207674_10101186 | Ga0207674_101011864 | 155 |
| 231 | 3300026116 | Ga0207674_10120784 | Ga0207674_101207842 | 155 |
| 232 | 3300026118 | Ga0207675_100000971 | Ga0207675_10000097119 | 155 |
| 233 | 3300026118 | Ga0207675_100005986 | Ga0207675_1000059865 | 155 |
| 234 | 3300026118 | Ga0207675_100165688 | Ga0207675_1001656883 | 155 |
| 235 | 3300026118 | Ga0207675_101400418 | Ga0207675_1014004181 | 155 |
| 236 | 3300026142 | Ga0207698_10479041 | Ga0207698_104790412 | 155 |
| 237 | 3300027907 | Ga0207428_10062418 | Ga0207428_100624183 | 155 |
| 238 | 3300028380 | Ga0268265_10012647 | Ga0268265_100126472 | 155 |
| 239 | 3300028380 | Ga0268265_10078621 | Ga0268265_100786214 | 155 |
| 240 | 3300028380 | Ga0268265_10648099 | Ga0268265_106480992 | 155 |
| 241 | 3300031730 | Ga0307516_10085925 | Ga0307516_100859252 | 155 |
| 242 | 3300031995 | Ga0307409_101423720 | Ga0307409_1014237201 | 155 |
| 243 | 3300032004 | Ga0307414_10876357 | Ga0307414_108763571 | 155 |
| 244 | 3300041406 | Ga0439439_0014091 | Ga0439439_0014091_633_1112 | 155 |
| 245 | 3300041408 | Ga0439453_0053464 | Ga0439453_0053464_151_630 | 155 |
| 246 | 3300041413 | Ga0439465_0042844 | Ga0439465_0042844_162_641 | 155 |
| 247 | 3300041458 | Ga0451798_0012509 | Ga0451798_0012509_237_704 | 155 |
| 248 | 3300041505 | Ga0451849_1558981 | Ga0451849_1558981_99_566 | 155 |
| 249 | 3300041509 | Ga0451843_0775004 | Ga0451843_0775004_798_1277 | 155 |
| 250 | 3300042001 | Ga0439441_013234 | Ga0439441_013234_911_1417 | 155 |
| 251 | 3300042128 | Ga0450897_001202 | Ga0450897_001202_755_1234 | 155 |
| 252 | 3300042134 | Ga0450898_005998 | Ga0450898_005998_325_804 | 155 |
| 253 | 3300042135 | Ga0450899_004045 | Ga0450899_004045_79_558 | 155 |
| 254 | 3300042435 | Ga0439434_0018942 | Ga0439434_0018942_777_1256 | 155 |
| 255 | 3300042437 | Ga0439444_0079457 | Ga0439444_0079457_208_675 | 155 |
| 256 | 3300046460 | Ga0495638_0422909 | Ga0495638_0422909_187_666 | 155 |
| 257 | 3300046558 | Ga0495633_0082925 | Ga0495633_0082925_353_820 | 155 |
| 258 | 3300047318 | Ga0495636_0294087 | Ga0495636_0294087_248_715 | 155 |
| 259 | 3300047320 | Ga0495672_0062244 | Ga0495672_0062244_1357_1836 | 155 |
| 260 | 3300047320 | Ga0495672_0323581 | Ga0495672_0323581_161_640 | 155 |
| 261 | 3300047320 | Ga0495672_0487136 | Ga0495672_0487136_36_515 | 155 |
| 262 | 3300049744 | Ga0501083_0331195 | Ga0501083_0331195_489_968 | 155 |
| 263 | 3300050493 | nmdc:mga0k408_29953_c1 | nmdc:mga0k408_29953_c1_928_1407 | 155 |
| 264 | 3300050493 | nmdc:mga0k408_50035_c1 | nmdc:mga0k408_50035_c1_1413_1964 | 155 |
| 265 | 3300050507 | nmdc:mga05p37_42575_c1 | nmdc:mga05p37_42575_c1_4911_5378 | 155 |
| 266 | 3300050508 | nmdc:mga09592_4183_c1 | nmdc:mga09592_4183_c1_10937_11404 | 155 |
| 267 | 3300050509 | nmdc:mga0qj67_50886_c1 | nmdc:mga0qj67_50886_c1_1714_2181 | 155 |
| 268 | 3300050511 | nmdc:mga08y16_6499_c1 | nmdc:mga08y16_6499_c1_9122_9670 | 155 |
| 269 | 3300053139 | Ga0500568_0000224 | Ga0500568_0000224_46992_47468 | 155 |
| 270 | 3300005343 | Ga0070687_100453089 | Ga0070687_1004530891 | 156 |
| 271 | 3300005617 | Ga0068859_100957366 | Ga0068859_1009573662 | 156 |
| 272 | 3300006931 | Ga0097620_100957283 | Ga0097620_1009572832 | 156 |
| 273 | 3300013104 | Ga0157370_10005549 | Ga0157370_100055495 | 156 |
| 274 | 3300037312 | Ga0395899_0836107 | Ga0395899_0836107_40_525 | 156 |
| 275 | 3300037418 | Ga0395900_0137552 | Ga0395900_0137552_1560_2045 | 156 |
| 276 | 3300037466 | Ga0395898_1247597 | Ga0395898_1247597_50_535 | 156 |
| 277 | 3300038443 | Ga0395901_0540532 | Ga0395901_0540532_50_535 | 156 |
| 278 | 3300044712 | Ga0453684_0206248 | Ga0453684_0206248_1138_1620 | 156 |
| 279 | 3300046460 | Ga0495638_0313719 | Ga0495638_0313719_219_695 | 156 |
| 280 | 3300053727 | Ga0500611_000001 | Ga0500611_000001_316998_317474 | 156 |
| 281 | 3300002077 | JGI24744J21845_10040363 | JGI24744J21845_100403632 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yqy-assembly2.cif.gz_B | crystal structure of tt2238, a four-helix bundle protein | 0.6503 | 3 | 158 |
| 2f22-assembly1.cif.gz_A | crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution | 0.6284 | 1 | 152 |
| 2yqy-assembly2.cif.gz_B | crystal structure of tt2238, a four-helix bundle protein | 0.6241 | 3 | 158 |
| 2hkv-assembly1.cif.gz_A-2 | crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution | 0.5956 | 3 | 152 |
| 2nsg-assembly1.cif.gz_A | crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant | 0.5937 | 4 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WM91_7_150_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7004 | 4 | 152 | 1.20.120.450 |
| af_P9WM91_7_150_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6707 | 4 | 152 | 1.20.120.450 |
| af_O07256_17_140_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6651 | 6 | 153 | 1.20.120.450 |
| af_O07256_17_140_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6567 | 6 | 153 | 1.20.120.450 |
| 2yqyB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6503 | 3 | 158 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T4MGI7-F1-model_v4 | DinB-like domain-containing protein | 0.9842 | 1 | 154 |
|
| AF-A0A3C1R6Z3-F1-model_v4 | deleted | 0.9819 | 1 | 156 |
|
| AF-A0A3C1T5Z6-F1-model_v4 | DUF1569 domain-containing protein | 0.9818 | 1 | 154 |
|
| AF-A0A4Q5V3S3-F1-model_v4 | DUF1569 domain-containing protein | 0.9793 | 3 | 156 |
|
| AF-A0A537I2X6-F1-model_v4 | DUF1569 domain-containing protein | 0.9786 | 1 | 153 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar