F383962
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 165 | 272 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300053123|Ga0500614_023471|Ga0500614_023471_656_1318 |
| Length | 220 |
| Sequence | LATSSTDLTGMTSDTVFKYFPELTAQQRAQVEQLPELYNTWNSQINVISRKDIDLLYERHVLHSMGIAKIMPFLPGESVLDVGTGGGFPGIPLAILFPQTSFHLVDSIGKKIKVVQEVAKALGLTNVKATHARAEEIDENFDFVVSRAVTQLKDFYPWVRSKFKKQSGNKLPNGILYLKGGDLDQEIKESGLKVQQYYLKDYFTEEFFETKQVIYVKGKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 3 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 4 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 5 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 6 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 7 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 8 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 9 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 16 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 68 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 105 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 106 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 107 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 115 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 122 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 124 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 156 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 157 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 158 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 159 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 160 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 161 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 162 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 163 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 164 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 165 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.43 |
| Metatranscriptomes | 0.36 |
| Isolates | 3.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.64 |
| Nodule | 0 |
| Rhizoplane | 0.71 |
| Rhizosphere | 82.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10025407 | 3300001989 | Bacteria | 2083 |
| 2 | JGI24737J22298_10000825 | 3300001990 | Bacteria | 11018 |
| 3 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 4 | JGI24735J21928_10013269 | 3300002067 | Bacteria | 2593 |
| 5 | JGI24744J21845_10002724 | 3300002077 | Bacteria | 3604 |
| 6 | JGI25162J39368_1000017 | 3300002737 | Bacteria | 281385 |
| 7 | JGI25157J39369_1008852 | 3300002741 | Bacteria | 1379 |
| 8 | JGI25164J39214_1001300 | 3300002772 | Bacteria | 6314 |
| 9 | JGI25165J46597_1000615 | 3300003214 | Bacteria | 30104 |
| 10 | rootH1_10063127 | 3300003316 | Bacteria | 8410 |
| 11 | rootH1_10063127 | 3300003323 | Bacteria | 2558 |
| 12 | rootH2_10002594 | 3300003320 | Bacteria | 27151 |
| 13 | rootL2_10035012 | 3300003322 | Bacteria | 2391 |
| 14 | rootH1_10018482 | 3300003323 | Bacteria | 48371 |
| 15 | rootH1_10023390 | 3300003323 | Bacteria | 8037 |
| 16 | rootH1_10073177 | 3300003323 | Bacteria | 3761 |
| 17 | rootH1_10157886 | 3300003323 | Bacteria | 2881 |
| 18 | Ga0065714_10074426 | 3300005288 | Bacteria | 3039 |
| 19 | Ga0065714_10086067 | 3300005288 | Bacteria | 2118 |
| 20 | Ga0070658_10022622 | 3300005327 | Bacteria | 5044 |
| 21 | Ga0070658_10595854 | 3300005327 | Unclassified | 958 |
| 22 | Ga0070676_10004899 | 3300005328 | Bacteria | 7093 |
| 23 | Ga0070683_100086280 | 3300005329 | Bacteria | 2943 |
| 24 | Ga0068868_100075871 | 3300005338 | Bacteria | 2687 |
| 25 | Ga0070660_100030591 | 3300005339 | Bacteria | 4039 |
| 26 | Ga0070675_100411277 | 3300005354 | Bacteria | 1208 |
| 27 | Ga0070673_100013170 | 3300005364 | Bacteria | 5708 |
| 28 | Ga0070673_101320041 | 3300005364 | Bacteria | 678 |
| 29 | Ga0070659_100000899 | 3300005366 | Bacteria | 21771 |
| 30 | Ga0070659_100018047 | 3300005366 | Bacteria | 5321 |
| 31 | Ga0070678_100000238 | 3300005456 | Bacteria | 25199 |
| 32 | Ga0070662_100000954 | 3300005457 | Bacteria | 17728 |
| 33 | Ga0068867_100001989 | 3300005459 | Bacteria | 14258 |
| 34 | Ga0070685_10403240 | 3300005466 | Unclassified | 947 |
| 35 | Ga0070679_100896547 | 3300005530 | Bacteria | 830 |
| 36 | Ga0070684_100051467 | 3300005535 | Bacteria | 3578 |
| 37 | Ga0068853_100173489 | 3300005539 | Bacteria | 1952 |
| 38 | Ga0068853_100532683 | 3300005539 | Bacteria | 1111 |
| 39 | Ga0070665_100000072 | 3300005548 | Bacteria | 198575 |
| 40 | Ga0068855_100000268 | 3300005563 | Bacteria | 64693 |
| 41 | Ga0068855_100055857 | 3300005563 | Bacteria | 4635 |
| 42 | Ga0068855_100146419 | 3300005563 | Bacteria | 2688 |
| 43 | Ga0068855_100315870 | 3300005563 | Bacteria | 1728 |
| 44 | Ga0068854_100053984 | 3300005578 | Bacteria | 2888 |
| 45 | Ga0068854_100529661 | 3300005578 | Bacteria | 996 |
| 46 | Ga0068856_100002547 | 3300005614 | Bacteria | 18779 |
| 47 | Ga0068856_100098484 | 3300005614 | Bacteria | 2914 |
| 48 | Ga0068852_100000143 | 3300005616 | Bacteria | 48192 |
| 49 | Ga0068852_100022550 | 3300005616 | Bacteria | 5051 |
| 50 | Ga0068866_10061294 | 3300005718 | Bacteria | 1953 |
| 51 | Ga0075366_10000414 | 3300006195 | Bacteria | 19952 |
| 52 | Ga0097621_100000028 | 3300006237 | Bacteria | 71678 |
| 53 | Ga0075370_10119384 | 3300006353 | Bacteria | 1534 |
| 54 | Ga0068871_100000066 | 3300006358 | Bacteria | 57980 |
| 55 | Ga0068871_100558129 | 3300006358 | Unclassified | 1038 |
| 56 | Ga0068865_100000732 | 3300006881 | Bacteria | 18431 |
| 57 | Ga0105240_10000876 | 3300009093 | Bacteria | 54171 |
| 58 | Ga0105240_10023971 | 3300009093 | Bacteria | 8061 |
| 59 | Ga0105240_10028278 | 3300009093 | Bacteria | 7324 |
| 60 | Ga0105240_10049341 | 3300009093 | Bacteria | 5313 |
| 61 | Ga0105240_10078747 | 3300009093 | Bacteria | 4058 |
| 62 | Ga0105240_10093141 | 3300009093 | Bacteria | 3678 |
| 63 | Ga0105240_10129313 | 3300009093 | Bacteria | 3031 |
| 64 | Ga0105240_10203072 | 3300009093 | Bacteria | 2321 |
| 65 | Ga0105240_10240104 | 3300009093 | Bacteria | 2101 |
| 66 | Ga0105241_10003705 | 3300009174 | Bacteria | 11358 |
| 67 | Ga0105241_10011403 | 3300009174 | Bacteria | 6515 |
| 68 | Ga0105241_10049977 | 3300009174 | Bacteria | 3186 |
| 69 | Ga0105241_10172326 | 3300009174 | Bacteria | 1788 |
| 70 | Ga0105242_10767108 | 3300009176 | Bacteria | 951 |
| 71 | Ga0105237_10000485 | 3300009545 | Bacteria | 56664 |
| 72 | Ga0105237_10008444 | 3300009545 | Bacteria | 11142 |
| 73 | Ga0105237_10059742 | 3300009545 | Bacteria | 3814 |
| 74 | Ga0105237_10065690 | 3300009545 | Bacteria | 3623 |
| 75 | Ga0105237_10173594 | 3300009545 | Bacteria | 2156 |
| 76 | Ga0105237_10174050 | 3300009545 | Bacteria | 2153 |
| 77 | Ga0105237_10318002 | 3300009545 | Bacteria | 1560 |
| 78 | Ga0105238_10057708 | 3300009551 | Bacteria | 3892 |
| 79 | Ga0105249_10590660 | 3300009553 | Bacteria | 1164 |
| 80 | Ga0105239_10000039 | 3300010375 | Bacteria | 203537 |
| 81 | Ga0105239_10000120 | 3300010375 | Bacteria | 110003 |
| 82 | Ga0105239_10001068 | 3300010375 | Bacteria | 38074 |
| 83 | Ga0105239_10002256 | 3300010375 | Bacteria | 24634 |
| 84 | Ga0105239_10004588 | 3300010375 | Bacteria | 16460 |
| 85 | Ga0105239_10031340 | 3300010375 | Bacteria | 5849 |
| 86 | Ga0105246_10468914 | 3300011119 | Unclassified | 1062 |
| 87 | Ga0157373_10000119 | 3300013100 | Bacteria | 62053 |
| 88 | Ga0157373_10004143 | 3300013100 | Bacteria | 10932 |
| 89 | Ga0157373_10027859 | 3300013100 | Bacteria | 4076 |
| 90 | Ga0157371_10000263 | 3300013102 | Bacteria | 71557 |
| 91 | Ga0157371_10039035 | 3300013102 | Bacteria | 3396 |
| 92 | Ga0157370_10081538 | 3300013104 | Bacteria | 3044 |
| 93 | Ga0157369_10017498 | 3300013105 | Bacteria | 8055 |
| 94 | Ga0157374_10000174 | 3300013296 | Bacteria | 59597 |
| 95 | Ga0157374_10001861 | 3300013296 | Bacteria | 17768 |
| 96 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 97 | Ga0163162_10004644 | 3300013306 | Bacteria | 13243 |
| 98 | Ga0157372_10000635 | 3300013307 | Bacteria | 38523 |
| 99 | Ga0157372_10010262 | 3300013307 | Bacteria | 9949 |
| 100 | Ga0157372_10011346 | 3300013307 | Bacteria | 9478 |
| 101 | Ga0157372_10011463 | 3300013307 | Bacteria | 9427 |
| 102 | Ga0157372_10053455 | 3300013307 | Bacteria | 4502 |
| 103 | Ga0157372_10063039 | 3300013307 | Bacteria | 4155 |
| 104 | Ga0157375_10209497 | 3300013308 | Bacteria | 2106 |
| 105 | Ga0163161_10055914 | 3300017792 | Bacteria | 2865 |
| 106 | Ga0206351_10472049 | 3300020077 | Bacteria | 2167 |
| 107 | Ga0213872_10008465 | 3300021361 | Bacteria | 4978 |
| 108 | Ga0207427_100172 | 3300025231 | Bacteria | 71550 |
| 109 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 110 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 111 | Ga0209026_1000514 | 3300025250 | Bacteria | 27275 |
| 112 | Ga0209148_1028914 | 3300025254 | Bacteria | 840 |
| 113 | Ga0209129_1010024 | 3300025258 | Bacteria | 2411 |
| 114 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 115 | Ga0209233_1004303 | 3300025261 | Bacteria | 4864 |
| 116 | Ga0209455_1001647 | 3300025272 | Bacteria | 9710 |
| 117 | Ga0207642_10075928 | 3300025899 | Bacteria | 1616 |
| 118 | Ga0207647_10000076 | 3300025904 | Bacteria | 75824 |
| 119 | Ga0207647_10010252 | 3300025904 | Bacteria | 6620 |
| 120 | Ga0207647_10100871 | 3300025904 | Bacteria | 1713 |
| 121 | Ga0207645_10001390 | 3300025907 | Bacteria | 19866 |
| 122 | Ga0207705_10051326 | 3300025909 | Bacteria | 2969 |
| 123 | Ga0207654_10003959 | 3300025911 | Bacteria | 7458 |
| 124 | Ga0207654_10008138 | 3300025911 | Bacteria | 5287 |
| 125 | Ga0207654_10160331 | 3300025911 | Bacteria | 1452 |
| 126 | Ga0207654_10481199 | 3300025911 | Bacteria | 874 |
| 127 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 128 | Ga0207695_10002721 | 3300025913 | Bacteria | 25814 |
| 129 | Ga0207695_10018312 | 3300025913 | Bacteria | 8102 |
| 130 | Ga0207695_10019916 | 3300025913 | Bacteria | 7707 |
| 131 | Ga0207695_10153390 | 3300025913 | Bacteria | 2240 |
| 132 | Ga0207695_10206117 | 3300025913 | Bacteria | 1879 |
| 133 | Ga0207695_10443806 | 3300025913 | Bacteria | 1181 |
| 134 | Ga0207695_10491361 | 3300025913 | Bacteria | 1109 |
| 135 | Ga0207671_10000663 | 3300025914 | Bacteria | 44922 |
| 136 | Ga0207671_10004095 | 3300025914 | Bacteria | 14111 |
| 137 | Ga0207671_10007966 | 3300025914 | Bacteria | 9077 |
| 138 | Ga0207671_10031253 | 3300025914 | Bacteria | 3967 |
| 139 | Ga0207671_10046814 | 3300025914 | Bacteria | 3200 |
| 140 | Ga0207671_10057566 | 3300025914 | Bacteria | 2881 |
| 141 | Ga0207671_10132650 | 3300025914 | Bacteria | 1913 |
| 142 | Ga0207657_10034159 | 3300025919 | Bacteria | 4576 |
| 143 | Ga0207652_10883140 | 3300025921 | Bacteria | 790 |
| 144 | Ga0207694_10003884 | 3300025924 | Bacteria | 11815 |
| 145 | Ga0207694_10275662 | 3300025924 | Bacteria | 1380 |
| 146 | Ga0207659_10509540 | 3300025926 | Unclassified | 1019 |
| 147 | Ga0207690_10000594 | 3300025932 | Bacteria | 23425 |
| 148 | Ga0207706_10001262 | 3300025933 | Bacteria | 25516 |
| 149 | Ga0207704_10000044 | 3300025938 | Bacteria | 86753 |
| 150 | Ga0207704_10642693 | 3300025938 | Bacteria | 873 |
| 151 | Ga0207661_10078663 | 3300025944 | Bacteria | 2716 |
| 152 | Ga0207667_10001079 | 3300025949 | Bacteria | 34634 |
| 153 | Ga0207667_10026398 | 3300025949 | Bacteria | 6347 |
| 154 | Ga0207667_10107814 | 3300025949 | Bacteria | 2874 |
| 155 | Ga0207667_10123542 | 3300025949 | Bacteria | 2667 |
| 156 | Ga0207667_10160087 | 3300025949 | Bacteria | 2316 |
| 157 | Ga0207651_10001871 | 3300025960 | Bacteria | 9842 |
| 158 | Ga0207640_10099552 | 3300025981 | Bacteria | 2035 |
| 159 | Ga0207703_10468687 | 3300026035 | Bacteria | 1179 |
| 160 | Ga0207639_10038533 | 3300026041 | Bacteria | 3556 |
| 161 | Ga0207702_10000797 | 3300026078 | Bacteria | 33437 |
| 162 | Ga0207702_10004560 | 3300026078 | Bacteria | 12275 |
| 163 | Ga0207702_10076688 | 3300026078 | Bacteria | 2890 |
| 164 | Ga0207648_10000529 | 3300026089 | Bacteria | 42805 |
| 165 | Ga0207674_10143969 | 3300026116 | Bacteria | 2343 |
| 166 | Ga0207683_10002525 | 3300026121 | Bacteria | 15981 |
| 167 | Ga0207698_10001299 | 3300026142 | Bacteria | 14560 |
| 168 | Ga0207698_10035311 | 3300026142 | Bacteria | 3656 |
| 169 | Ga0268266_10000089 | 3300028379 | Bacteria | 198566 |
| 170 | Ga0307517_10010238 | 3300028786 | Bacteria | 13156 |
| 171 | Ga0307515_10001997 | 3300028794 | Bacteria | 45190 |
| 172 | Ga0307515_10002629 | 3300028794 | Bacteria | 38616 |
| 173 | Ga0307515_10115021 | 3300028794 | Bacteria | 3104 |
| 174 | Ga0265338_10059513 | 3300028800 | Bacteria | 3365 |
| 175 | Ga0316183_1092444 | 3300030742 | Bacteria | 19117 |
| 176 | Ga0316181_1058180 | 3300030744 | Bacteria | 14447 |
| 177 | Ga0316182_1100448 | 3300030745 | Bacteria | 1519 |
| 178 | Ga0265327_10205383 | 3300031251 | Bacteria | 891 |
| 179 | Ga0307509_10347777 | 3300031507 | Bacteria | 1207 |
| 180 | Ga0307408_100000143 | 3300031548 | Bacteria | 79423 |
| 181 | Ga0307408_100000672 | 3300031548 | Bacteria | 28427 |
| 182 | Ga0307408_100007095 | 3300031548 | Bacteria | 7415 |
| 183 | Ga0307413_10661813 | 3300031824 | Unclassified | 863 |
| 184 | Ga0307412_10000847 | 3300031911 | Bacteria | 17599 |
| 185 | Ga0307412_10013283 | 3300031911 | Bacteria | 4822 |
| 186 | Ga0307412_10929920 | 3300031911 | Bacteria | 764 |
| 187 | Ga0307414_10009343 | 3300032004 | Bacteria | 5627 |
| 188 | Ga0307414_10016196 | 3300032004 | Bacteria | 4525 |
| 189 | Ga0307414_10334201 | 3300032004 | Unclassified | 1294 |
| 190 | Ga0307414_10585791 | 3300032004 | Bacteria | 999 |
| 191 | Ga0307411_10140074 | 3300032005 | Unclassified | 1782 |
| 192 | Ga0307507_10000015 | 3300033179 | Bacteria | 237419 |
| 193 | Ga0307510_10042210 | 3300033180 | Bacteria | 4973 |
| 194 | Ga0395899_0006330 | 3300037312 | Bacteria | 9163 |
| 195 | Ga0395899_0022763 | 3300037312 | Bacteria | 4748 |
| 196 | Ga0395900_0000277 | 3300037418 | Bacteria | 77256 |
| 197 | Ga0395898_0104003 | 3300037466 | Bacteria | 2724 |
| 198 | Ga0395905_0000068 | 3300037471 | Bacteria | 177163 |
| 199 | Ga0395905_0000727 | 3300037471 | Bacteria | 43437 |
| 200 | Ga0395901_0000199 | 3300038443 | Bacteria | 76415 |
| 201 | Ga0395901_0007872 | 3300038443 | Bacteria | 10748 |
| 202 | Ga0395901_0045851 | 3300038443 | Bacteria | 4539 |
| 203 | Ga0436361_1010852 | 3300039447 | Bacteria | 6529 |
| 204 | Ga0451802_1261061 | 3300041460 | Bacteria | 751 |
| 205 | Ga0451833_0845009 | 3300041491 | Bacteria | 1378 |
| 206 | Ga0439457_012313 | 3300042014 | Bacteria | 1929 |
| 207 | Ga0495629_0238600 | 3300046459 | Bacteria | 1252 |
| 208 | Ga0495651_0020461 | 3300046462 | Bacteria | 5138 |
| 209 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 210 | Ga0495650_0136705 | 3300046471 | Bacteria | 890 |
| 211 | Ga0495585_0000286 | 3300046492 | Bacteria | 50524 |
| 212 | Ga0495585_0000667 | 3300046492 | Bacteria | 31526 |
| 213 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 214 | Ga0495606_0017553 | 3300046507 | Bacteria | 5404 |
| 215 | Ga0495606_0049243 | 3300046507 | Bacteria | 2765 |
| 216 | Ga0495608_0424732 | 3300046511 | Bacteria | 811 |
| 217 | Ga0495610_0004136 | 3300046512 | Bacteria | 10856 |
| 218 | Ga0495610_0012603 | 3300046512 | Bacteria | 5077 |
| 219 | Ga0495616_0008553 | 3300046513 | Bacteria | 6052 |
| 220 | Ga0495628_0298345 | 3300046516 | Bacteria | 1193 |
| 221 | Ga0495631_0157237 | 3300046518 | Bacteria | 975 |
| 222 | Ga0495637_0034291 | 3300046520 | Bacteria | 2224 |
| 223 | Ga0495644_0016404 | 3300046523 | Bacteria | 2835 |
| 224 | Ga0495648_0005254 | 3300046524 | Bacteria | 10819 |
| 225 | Ga0495648_0159759 | 3300046524 | Bacteria | 1166 |
| 226 | Ga0495609_0040730 | 3300046538 | Bacteria | 2090 |
| 227 | Ga0495609_0156687 | 3300046538 | Bacteria | 967 |
| 228 | Ga0495633_0000035 | 3300046558 | Bacteria | 185403 |
| 229 | Ga0495633_0005233 | 3300046558 | Bacteria | 8002 |
| 230 | Ga0495633_0138462 | 3300046558 | Bacteria | 1126 |
| 231 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 232 | Ga0495668_0480968 | 3300046616 | Bacteria | 684 |
| 233 | Ga0495634_0396271 | 3300046642 | Bacteria | 821 |
| 234 | Ga0495625_0000008 | 3300046660 | Bacteria | 536165 |
| 235 | Ga0495625_0000753 | 3300046660 | Bacteria | 45225 |
| 236 | Ga0495625_0000981 | 3300046660 | Bacteria | 37838 |
| 237 | Ga0495625_0013744 | 3300046660 | Bacteria | 6491 |
| 238 | Ga0495625_0129013 | 3300046660 | Bacteria | 1714 |
| 239 | Ga0495661_0002168 | 3300046665 | Bacteria | 15344 |
| 240 | Ga0495661_0005175 | 3300046665 | Bacteria | 9289 |
| 241 | Ga0495661_0033784 | 3300046665 | Bacteria | 3224 |
| 242 | Ga0495669_0138061 | 3300046684 | Bacteria | 1150 |
| 243 | Ga0495649_0000018 | 3300046694 | Bacteria | 220586 |
| 244 | Ga0495649_0064420 | 3300046694 | Bacteria | 1968 |
| 245 | Ga0495589_0079535 | 3300046794 | Bacteria | 1595 |
| 246 | Ga0495660_0058663 | 3300046810 | Bacteria | 2072 |
| 247 | Ga0495683_0046144 | 3300047323 | Bacteria | 2187 |
| 248 | Ga0495683_0057023 | 3300047323 | Bacteria | 1942 |
| 249 | Ga0495687_000484 | 3300047443 | Bacteria | 48242 |
| 250 | Ga0495687_001763 | 3300047443 | Bacteria | 19137 |
| 251 | Ga0495677_0018378 | 3300047445 | Bacteria | 2534 |
| 252 | Ga0495686_0000052 | 3300047472 | Bacteria | 262622 |
| 253 | Ga0495686_0001825 | 3300047472 | Bacteria | 21435 |
| 254 | Ga0495686_0021353 | 3300047472 | Bacteria | 4302 |
| 255 | Ga0495614_0018052 | 3300048089 | Bacteria | 3058 |
| 256 | Ga0495682_0038658 | 3300049460 | Bacteria | 1753 |
| 257 | Ga0501223_000948 | 3300049663 | Bacteria | 6835 |
| 258 | Ga0501240_004036 | 3300049673 | Unclassified | 1678 |
| 259 | nmdc:mga0k408_244617_c1 | 3300050493 | Bacteria | 1071 |
| 260 | nmdc:mga0k408_518_c1 | 3300050493 | Bacteria | 21209 |
| 261 | nmdc:mga0k408_56250_c1 | 3300050493 | Bacteria | 2282 |
| 262 | Ga0500635_0025064 | 3300053080 | Bacteria | 1877 |
| 263 | Ga0500608_025564 | 3300053122 | Bacteria | 2764 |
| 264 | Ga0500608_043017 | 3300053122 | Bacteria | 2168 |
| 265 | Ga0500614_023471 | 3300053123 | Bacteria | 1450 |
| 266 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 267 | Ga0500642_0092814 | 3300053130 | Bacteria | 1397 |
| 268 | Ga0500642_0094047 | 3300053130 | Bacteria | 1388 |
| 269 | Ga0500568_0063099 | 3300053139 | Bacteria | 1430 |
| 270 | Ga0500616_0219032 | 3300053153 | Bacteria | 831 |
| 271 | Ga0500622_0084848 | 3300053156 | Bacteria | 1581 |
| 272 | Ga0500624_001110 | 3300053157 | Bacteria | 5041 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025938 | Ga0207704_10642693 | Ga0207704_106426931 | 181 |
| 2 | 3300031911 | Ga0307412_10013283 | Ga0307412_100132834 | 184 |
| 3 | 3300049663 | Ga0501223_000948 | Ga0501223_000948_1051_1716 | 184 |
| 4 | 3300049673 | Ga0501240_004036 | Ga0501240_004036_44_676 | 184 |
| 5 | 3300041460 | Ga0451802_1261061 | Ga0451802_1261061_178_738 | 185 |
| 6 | 3300037312 | Ga0395899_0006330 | Ga0395899_0006330_7073_7702 | 190 |
| 7 | 3300037418 | Ga0395900_0000277 | Ga0395900_0000277_49872_50501 | 190 |
| 8 | 3300037471 | Ga0395905_0000068 | Ga0395905_0000068_40765_41394 | 190 |
| 9 | 3300038443 | Ga0395901_0000199 | Ga0395901_0000199_27551_28180 | 190 |
| 10 | 3300005327 | Ga0070658_10595854 | Ga0070658_105958542 | 191 |
| 11 | 3300053080 | Ga0500635_0025064 | Ga0500635_0025064_384_1013 | 194 |
| 12 | 3300021361 | Ga0213872_10008465 | Ga0213872_100084654 | 195 |
| 13 | 3300039447 | Ga0436361_1010852 | Ga0436361_1010852_2142_2771 | 195 |
| 14 | 3300053130 | Ga0500642_0092814 | Ga0500642_0092814_119_745 | 195 |
| 15 | 3300013307 | Ga0157372_10053455 | Ga0157372_100534556 | 197 |
| 16 | 3300028786 | Ga0307517_10010238 | Ga0307517_1001023814 | 197 |
| 17 | 3300031507 | Ga0307509_10347777 | Ga0307509_103477772 | 197 |
| 18 | 3300033180 | Ga0307510_10042210 | Ga0307510_100422105 | 197 |
| 19 | 3300047323 | Ga0495683_0057023 | Ga0495683_0057023_499_1128 | 197 |
| 20 | 3300047472 | Ga0495686_0000052 | Ga0495686_0000052_221318_221974 | 197 |
| 21 | 3300053122 | Ga0500608_025564 | Ga0500608_025564_1850_2476 | 197 |
| 22 | 3300005718 | Ga0068866_10061294 | Ga0068866_100612942 | 198 |
| 23 | 3300025899 | Ga0207642_10075928 | Ga0207642_100759282 | 198 |
| 24 | 3300046616 | Ga0495668_0480968 | Ga0495668_0480968_19_645 | 198 |
| 25 | 3300046694 | Ga0495649_0064420 | Ga0495649_0064420_300_926 | 198 |
| 26 | 3300046538 | Ga0495609_0040730 | Ga0495609_0040730_1160_1789 | 200 |
| 27 | iso_pu_bacteria | 2599185184 | 2599478306 | 204 |
| 28 | iso_pu_bacteria | 2852623160 | 2852626890 | 204 |
| 29 | iso_pu_bacteria | 2884933994 | 2884938058 | 204 |
| 30 | iso_pu_bacteria | 2919437846 | 2919438991 | 204 |
| 31 | iso_pu_bacteria | 2928078545 | 2928080644 | 204 |
| 32 | iso_pu_bacteria | 2928147474 | 2928150868 | 204 |
| 33 | iso_pu_bacteria | 2932082852 | 2932082972 | 204 |
| 34 | iso_pu_bacteria | 2977232053 | 2977236237 | 204 |
| 35 | 3300026035 | Ga0207703_10468687 | Ga0207703_104686872 | 206 |
| 36 | 3300053130 | Ga0500642_0094047 | Ga0500642_0094047_701_1324 | 207 |
| 37 | iso_pu_bacteria | 2842903701 | 2842905782 | 207 |
| 38 | 3300001989 | JGI24739J22299_10025407 | JGI24739J22299_100254072 | 208 |
| 39 | 3300001990 | JGI24737J22298_10000825 | JGI24737J22298_100008254 | 208 |
| 40 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_10000004132 | 208 |
| 41 | 3300002067 | JGI24735J21928_10013269 | JGI24735J21928_100132691 | 208 |
| 42 | 3300002077 | JGI24744J21845_10002724 | JGI24744J21845_100027245 | 208 |
| 43 | 3300002737 | JGI25162J39368_1000017 | JGI25162J39368_100001741 | 208 |
| 44 | 3300002741 | JGI25157J39369_1008852 | JGI25157J39369_10088522 | 208 |
| 45 | 3300002772 | JGI25164J39214_1001300 | JGI25164J39214_10013004 | 208 |
| 46 | 3300003214 | JGI25165J46597_1000615 | JGI25165J46597_100061517 | 208 |
| 47 | 3300003316 | rootH1_10063127 | rootH1_100631275 | 208 |
| 48 | 3300003320 | rootH2_10002594 | rootH2_1000259416 | 208 |
| 49 | 3300003322 | rootL2_10035012 | rootL2_100350123 | 208 |
| 50 | 3300003323 | rootH1_10018482 | rootH1_1001848238 | 208 |
| 51 | 3300003323 | rootH1_10023390 | rootH1_100233909 | 208 |
| 52 | 3300003323 | rootH1_10073177 | rootH1_100731772 | 208 |
| 53 | 3300003323 | rootH1_10157886 | rootH1_101578863 | 208 |
| 54 | 3300005288 | Ga0065714_10074426 | Ga0065714_100744263 | 208 |
| 55 | 3300005288 | Ga0065714_10086067 | Ga0065714_100860673 | 208 |
| 56 | 3300005327 | Ga0070658_10022622 | Ga0070658_100226225 | 208 |
| 57 | 3300005328 | Ga0070676_10004899 | Ga0070676_100048997 | 208 |
| 58 | 3300005329 | Ga0070683_100086280 | Ga0070683_1000862802 | 208 |
| 59 | 3300005338 | Ga0068868_100075871 | Ga0068868_1000758712 | 208 |
| 60 | 3300005339 | Ga0070660_100030591 | Ga0070660_1000305913 | 208 |
| 61 | 3300005354 | Ga0070675_100411277 | Ga0070675_1004112772 | 208 |
| 62 | 3300005364 | Ga0070673_100013170 | Ga0070673_1000131704 | 208 |
| 63 | 3300005364 | Ga0070673_101320041 | Ga0070673_1013200411 | 208 |
| 64 | 3300005366 | Ga0070659_100000899 | Ga0070659_1000008999 | 208 |
| 65 | 3300005366 | Ga0070659_100018047 | Ga0070659_1000180475 | 208 |
| 66 | 3300005456 | Ga0070678_100000238 | Ga0070678_10000023829 | 208 |
| 67 | 3300005457 | Ga0070662_100000954 | Ga0070662_1000009549 | 208 |
| 68 | 3300005459 | Ga0068867_100001989 | Ga0068867_10000198911 | 208 |
| 69 | 3300005466 | Ga0070685_10403240 | Ga0070685_104032402 | 208 |
| 70 | 3300005530 | Ga0070679_100896547 | Ga0070679_1008965471 | 208 |
| 71 | 3300005535 | Ga0070684_100051467 | Ga0070684_1000514672 | 208 |
| 72 | 3300005539 | Ga0068853_100173489 | Ga0068853_1001734893 | 208 |
| 73 | 3300005539 | Ga0068853_100532683 | Ga0068853_1005326832 | 208 |
| 74 | 3300005548 | Ga0070665_100000072 | Ga0070665_10000007248 | 208 |
| 75 | 3300005563 | Ga0068855_100000268 | Ga0068855_10000026844 | 208 |
| 76 | 3300005563 | Ga0068855_100055857 | Ga0068855_1000558573 | 208 |
| 77 | 3300005563 | Ga0068855_100146419 | Ga0068855_1001464193 | 208 |
| 78 | 3300005563 | Ga0068855_100315870 | Ga0068855_1003158701 | 208 |
| 79 | 3300005578 | Ga0068854_100053984 | Ga0068854_1000539843 | 208 |
| 80 | 3300005578 | Ga0068854_100529661 | Ga0068854_1005296612 | 208 |
| 81 | 3300005614 | Ga0068856_100002547 | Ga0068856_1000025472 | 208 |
| 82 | 3300005614 | Ga0068856_100098484 | Ga0068856_1000984843 | 208 |
| 83 | 3300005616 | Ga0068852_100000143 | Ga0068852_10000014318 | 208 |
| 84 | 3300005616 | Ga0068852_100022550 | Ga0068852_1000225504 | 208 |
| 85 | 3300006195 | Ga0075366_10000414 | Ga0075366_1000041422 | 208 |
| 86 | 3300006237 | Ga0097621_100000028 | Ga0097621_10000002835 | 208 |
| 87 | 3300006353 | Ga0075370_10119384 | Ga0075370_101193841 | 208 |
| 88 | 3300006358 | Ga0068871_100000066 | Ga0068871_10000006632 | 208 |
| 89 | 3300006358 | Ga0068871_100558129 | Ga0068871_1005581292 | 208 |
| 90 | 3300006881 | Ga0068865_100000732 | Ga0068865_10000073212 | 208 |
| 91 | 3300009093 | Ga0105240_10000876 | Ga0105240_1000087649 | 208 |
| 92 | 3300009093 | Ga0105240_10023971 | Ga0105240_100239713 | 208 |
| 93 | 3300009093 | Ga0105240_10028278 | Ga0105240_100282783 | 208 |
| 94 | 3300009093 | Ga0105240_10049341 | Ga0105240_100493415 | 208 |
| 95 | 3300009093 | Ga0105240_10078747 | Ga0105240_100787475 | 208 |
| 96 | 3300009093 | Ga0105240_10093141 | Ga0105240_100931412 | 208 |
| 97 | 3300009093 | Ga0105240_10129313 | Ga0105240_101293132 | 208 |
| 98 | 3300009093 | Ga0105240_10203072 | Ga0105240_102030722 | 208 |
| 99 | 3300009093 | Ga0105240_10240104 | Ga0105240_102401043 | 208 |
| 100 | 3300009174 | Ga0105241_10003705 | Ga0105241_100037053 | 208 |
| 101 | 3300009174 | Ga0105241_10011403 | Ga0105241_100114033 | 208 |
| 102 | 3300009174 | Ga0105241_10049977 | Ga0105241_100499773 | 208 |
| 103 | 3300009174 | Ga0105241_10172326 | Ga0105241_101723262 | 208 |
| 104 | 3300009176 | Ga0105242_10767108 | Ga0105242_107671081 | 208 |
| 105 | 3300009545 | Ga0105237_10000485 | Ga0105237_100004855 | 208 |
| 106 | 3300009545 | Ga0105237_10008444 | Ga0105237_1000844413 | 208 |
| 107 | 3300009545 | Ga0105237_10059742 | Ga0105237_100597422 | 208 |
| 108 | 3300009545 | Ga0105237_10065690 | Ga0105237_100656904 | 208 |
| 109 | 3300009545 | Ga0105237_10173594 | Ga0105237_101735942 | 208 |
| 110 | 3300009545 | Ga0105237_10174050 | Ga0105237_101740503 | 208 |
| 111 | 3300009545 | Ga0105237_10318002 | Ga0105237_103180022 | 208 |
| 112 | 3300009551 | Ga0105238_10057708 | Ga0105238_100577083 | 208 |
| 113 | 3300009553 | Ga0105249_10590660 | Ga0105249_105906602 | 208 |
| 114 | 3300010375 | Ga0105239_10000039 | Ga0105239_10000039119 | 208 |
| 115 | 3300010375 | Ga0105239_10000120 | Ga0105239_1000012060 | 208 |
| 116 | 3300010375 | Ga0105239_10001068 | Ga0105239_1000106812 | 208 |
| 117 | 3300010375 | Ga0105239_10002256 | Ga0105239_1000225614 | 208 |
| 118 | 3300010375 | Ga0105239_10004588 | Ga0105239_100045885 | 208 |
| 119 | 3300010375 | Ga0105239_10031340 | Ga0105239_100313403 | 208 |
| 120 | 3300011119 | Ga0105246_10468914 | Ga0105246_104689142 | 208 |
| 121 | 3300013100 | Ga0157373_10000119 | Ga0157373_1000011938 | 208 |
| 122 | 3300013100 | Ga0157373_10004143 | Ga0157373_100041433 | 208 |
| 123 | 3300013100 | Ga0157373_10027859 | Ga0157373_100278592 | 208 |
| 124 | 3300013102 | Ga0157371_10000263 | Ga0157371_1000026352 | 208 |
| 125 | 3300013102 | Ga0157371_10039035 | Ga0157371_100390353 | 208 |
| 126 | 3300013104 | Ga0157370_10081538 | Ga0157370_100815382 | 208 |
| 127 | 3300013105 | Ga0157369_10017498 | Ga0157369_100174984 | 208 |
| 128 | 3300013296 | Ga0157374_10000174 | Ga0157374_1000017453 | 208 |
| 129 | 3300013296 | Ga0157374_10001861 | Ga0157374_1000186113 | 208 |
| 130 | 3300013306 | Ga0163162_10000010 | Ga0163162_1000001081 | 208 |
| 131 | 3300013306 | Ga0163162_10004644 | Ga0163162_100046445 | 208 |
| 132 | 3300013307 | Ga0157372_10000635 | Ga0157372_100006359 | 208 |
| 133 | 3300013307 | Ga0157372_10010262 | Ga0157372_100102628 | 208 |
| 134 | 3300013307 | Ga0157372_10011346 | Ga0157372_100113462 | 208 |
| 135 | 3300013307 | Ga0157372_10011463 | Ga0157372_100114638 | 208 |
| 136 | 3300013307 | Ga0157372_10063039 | Ga0157372_100630393 | 208 |
| 137 | 3300013308 | Ga0157375_10209497 | Ga0157375_102094972 | 208 |
| 138 | 3300017792 | Ga0163161_10055914 | Ga0163161_100559144 | 208 |
| 139 | 3300020077 | Ga0206351_10472049 | Ga0206351_104720493 | 208 |
| 140 | 3300025231 | Ga0207427_100172 | Ga0207427_10017244 | 208 |
| 141 | 3300025233 | Ga0209437_100024 | Ga0209437_100024275 | 208 |
| 142 | 3300025233 | Ga0209437_100034 | Ga0209437_100034149 | 208 |
| 143 | 3300025250 | Ga0209026_1000514 | Ga0209026_100051423 | 208 |
| 144 | 3300025254 | Ga0209148_1028914 | Ga0209148_10289141 | 208 |
| 145 | 3300025258 | Ga0209129_1010024 | Ga0209129_10100242 | 208 |
| 146 | 3300025261 | Ga0209233_1000038 | Ga0209233_1000038149 | 208 |
| 147 | 3300025261 | Ga0209233_1004303 | Ga0209233_10043032 | 208 |
| 148 | 3300025272 | Ga0209455_1001647 | Ga0209455_10016475 | 208 |
| 149 | 3300025904 | Ga0207647_10000076 | Ga0207647_1000007621 | 208 |
| 150 | 3300025904 | Ga0207647_10010252 | Ga0207647_100102522 | 208 |
| 151 | 3300025904 | Ga0207647_10100871 | Ga0207647_101008713 | 208 |
| 152 | 3300025907 | Ga0207645_10001390 | Ga0207645_100013905 | 208 |
| 153 | 3300025909 | Ga0207705_10051326 | Ga0207705_100513263 | 208 |
| 154 | 3300025911 | Ga0207654_10003959 | Ga0207654_100039599 | 208 |
| 155 | 3300025911 | Ga0207654_10008138 | Ga0207654_100081383 | 208 |
| 156 | 3300025911 | Ga0207654_10160331 | Ga0207654_101603312 | 208 |
| 157 | 3300025911 | Ga0207654_10481199 | Ga0207654_104811991 | 208 |
| 158 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013276 | 208 |
| 159 | 3300025913 | Ga0207695_10002721 | Ga0207695_1000272114 | 208 |
| 160 | 3300025913 | Ga0207695_10018312 | Ga0207695_100183129 | 208 |
| 161 | 3300025913 | Ga0207695_10019916 | Ga0207695_100199165 | 208 |
| 162 | 3300025913 | Ga0207695_10153390 | Ga0207695_101533902 | 208 |
| 163 | 3300025913 | Ga0207695_10206117 | Ga0207695_102061172 | 208 |
| 164 | 3300025913 | Ga0207695_10443806 | Ga0207695_104438062 | 208 |
| 165 | 3300025913 | Ga0207695_10491361 | Ga0207695_104913612 | 208 |
| 166 | 3300025914 | Ga0207671_10000663 | Ga0207671_1000066316 | 208 |
| 167 | 3300025914 | Ga0207671_10004095 | Ga0207671_1000409510 | 208 |
| 168 | 3300025914 | Ga0207671_10007966 | Ga0207671_100079662 | 208 |
| 169 | 3300025914 | Ga0207671_10031253 | Ga0207671_100312535 | 208 |
| 170 | 3300025914 | Ga0207671_10046814 | Ga0207671_100468142 | 208 |
| 171 | 3300025914 | Ga0207671_10057566 | Ga0207671_100575662 | 208 |
| 172 | 3300025914 | Ga0207671_10132650 | Ga0207671_101326502 | 208 |
| 173 | 3300025919 | Ga0207657_10034159 | Ga0207657_100341593 | 208 |
| 174 | 3300025921 | Ga0207652_10883140 | Ga0207652_108831401 | 208 |
| 175 | 3300025924 | Ga0207694_10003884 | Ga0207694_1000388410 | 208 |
| 176 | 3300025924 | Ga0207694_10275662 | Ga0207694_102756622 | 208 |
| 177 | 3300025926 | Ga0207659_10509540 | Ga0207659_105095402 | 208 |
| 178 | 3300025932 | Ga0207690_10000594 | Ga0207690_1000059412 | 208 |
| 179 | 3300025933 | Ga0207706_10001262 | Ga0207706_100012627 | 208 |
| 180 | 3300025938 | Ga0207704_10000044 | Ga0207704_1000004466 | 208 |
| 181 | 3300025944 | Ga0207661_10078663 | Ga0207661_100786632 | 208 |
| 182 | 3300025949 | Ga0207667_10001079 | Ga0207667_1000107942 | 208 |
| 183 | 3300025949 | Ga0207667_10026398 | Ga0207667_100263982 | 208 |
| 184 | 3300025949 | Ga0207667_10107814 | Ga0207667_101078143 | 208 |
| 185 | 3300025949 | Ga0207667_10123542 | Ga0207667_101235423 | 208 |
| 186 | 3300025949 | Ga0207667_10160087 | Ga0207667_101600871 | 208 |
| 187 | 3300025960 | Ga0207651_10001871 | Ga0207651_1000187110 | 208 |
| 188 | 3300025981 | Ga0207640_10099552 | Ga0207640_100995523 | 208 |
| 189 | 3300026041 | Ga0207639_10038533 | Ga0207639_100385332 | 208 |
| 190 | 3300026078 | Ga0207702_10000797 | Ga0207702_1000079716 | 208 |
| 191 | 3300026078 | Ga0207702_10004560 | Ga0207702_100045605 | 208 |
| 192 | 3300026078 | Ga0207702_10076688 | Ga0207702_100766883 | 208 |
| 193 | 3300026089 | Ga0207648_10000529 | Ga0207648_1000052933 | 208 |
| 194 | 3300026116 | Ga0207674_10143969 | Ga0207674_101439691 | 208 |
| 195 | 3300026121 | Ga0207683_10002525 | Ga0207683_100025253 | 208 |
| 196 | 3300026142 | Ga0207698_10001299 | Ga0207698_100012998 | 208 |
| 197 | 3300026142 | Ga0207698_10035311 | Ga0207698_100353113 | 208 |
| 198 | 3300028379 | Ga0268266_10000089 | Ga0268266_1000008947 | 208 |
| 199 | 3300028794 | Ga0307515_10001997 | Ga0307515_100019973 | 208 |
| 200 | 3300028794 | Ga0307515_10002629 | Ga0307515_1000262914 | 208 |
| 201 | 3300028794 | Ga0307515_10115021 | Ga0307515_101150213 | 208 |
| 202 | 3300028800 | Ga0265338_10059513 | Ga0265338_100595132 | 208 |
| 203 | 3300030742 | Ga0316183_1092444 | Ga0316183_10924445 | 208 |
| 204 | 3300030744 | Ga0316181_1058180 | Ga0316181_10581802 | 208 |
| 205 | 3300030745 | Ga0316182_1100448 | Ga0316182_11004481 | 208 |
| 206 | 3300031251 | Ga0265327_10205383 | Ga0265327_102053831 | 208 |
| 207 | 3300031548 | Ga0307408_100000143 | Ga0307408_10000014376 | 208 |
| 208 | 3300031548 | Ga0307408_100000672 | Ga0307408_10000067221 | 208 |
| 209 | 3300031548 | Ga0307408_100007095 | Ga0307408_1000070957 | 208 |
| 210 | 3300031824 | Ga0307413_10661813 | Ga0307413_106618131 | 208 |
| 211 | 3300031911 | Ga0307412_10000847 | Ga0307412_1000084715 | 208 |
| 212 | 3300031911 | Ga0307412_10929920 | Ga0307412_109299202 | 208 |
| 213 | 3300032004 | Ga0307414_10009343 | Ga0307414_100093435 | 208 |
| 214 | 3300032004 | Ga0307414_10016196 | Ga0307414_100161964 | 208 |
| 215 | 3300032004 | Ga0307414_10334201 | Ga0307414_103342011 | 208 |
| 216 | 3300032004 | Ga0307414_10585791 | Ga0307414_105857911 | 208 |
| 217 | 3300032005 | Ga0307411_10140074 | Ga0307411_101400742 | 208 |
| 218 | 3300033179 | Ga0307507_10000015 | Ga0307507_1000001524 | 208 |
| 219 | 3300037312 | Ga0395899_0022763 | Ga0395899_0022763_2807_3439 | 208 |
| 220 | 3300037466 | Ga0395898_0104003 | Ga0395898_0104003_52_684 | 208 |
| 221 | 3300037471 | Ga0395905_0000727 | Ga0395905_0000727_9284_9916 | 208 |
| 222 | 3300038443 | Ga0395901_0007872 | Ga0395901_0007872_1468_2100 | 208 |
| 223 | 3300038443 | Ga0395901_0045851 | Ga0395901_0045851_963_1589 | 208 |
| 224 | 3300041491 | Ga0451833_0845009 | Ga0451833_0845009_663_1319 | 208 |
| 225 | 3300042014 | Ga0439457_012313 | Ga0439457_012313_1203_1835 | 208 |
| 226 | 3300046459 | Ga0495629_0238600 | Ga0495629_0238600_441_1073 | 208 |
| 227 | 3300046462 | Ga0495651_0020461 | Ga0495651_0020461_4342_4968 | 208 |
| 228 | 3300046471 | Ga0495650_0000087 | Ga0495650_0000087_50755_51381 | 208 |
| 229 | 3300046471 | Ga0495650_0136705 | Ga0495650_0136705_112_738 | 208 |
| 230 | 3300046492 | Ga0495585_0000286 | Ga0495585_0000286_3824_4450 | 208 |
| 231 | 3300046492 | Ga0495585_0000667 | Ga0495585_0000667_4255_4887 | 208 |
| 232 | 3300046507 | Ga0495606_0000052 | Ga0495606_0000052_144975_145601 | 208 |
| 233 | 3300046507 | Ga0495606_0017553 | Ga0495606_0017553_2602_3228 | 208 |
| 234 | 3300046507 | Ga0495606_0049243 | Ga0495606_0049243_1326_1952 | 208 |
| 235 | 3300046511 | Ga0495608_0424732 | Ga0495608_0424732_162_791 | 208 |
| 236 | 3300046512 | Ga0495610_0004136 | Ga0495610_0004136_10033_10659 | 208 |
| 237 | 3300046512 | Ga0495610_0012603 | Ga0495610_0012603_3812_4438 | 208 |
| 238 | 3300046513 | Ga0495616_0008553 | Ga0495616_0008553_4046_4672 | 208 |
| 239 | 3300046516 | Ga0495628_0298345 | Ga0495628_0298345_364_996 | 208 |
| 240 | 3300046518 | Ga0495631_0157237 | Ga0495631_0157237_309_935 | 208 |
| 241 | 3300046520 | Ga0495637_0034291 | Ga0495637_0034291_774_1400 | 208 |
| 242 | 3300046523 | Ga0495644_0016404 | Ga0495644_0016404_960_1586 | 208 |
| 243 | 3300046524 | Ga0495648_0005254 | Ga0495648_0005254_9845_10477 | 208 |
| 244 | 3300046524 | Ga0495648_0159759 | Ga0495648_0159759_484_1116 | 208 |
| 245 | 3300046538 | Ga0495609_0156687 | Ga0495609_0156687_148_774 | 208 |
| 246 | 3300046558 | Ga0495633_0000035 | Ga0495633_0000035_162626_163258 | 208 |
| 247 | 3300046558 | Ga0495633_0005233 | Ga0495633_0005233_1301_1927 | 208 |
| 248 | 3300046558 | Ga0495633_0138462 | Ga0495633_0138462_210_836 | 208 |
| 249 | 3300046616 | Ga0495668_0000032 | Ga0495668_0000032_32384_33016 | 208 |
| 250 | 3300046642 | Ga0495634_0396271 | Ga0495634_0396271_49_678 | 208 |
| 251 | 3300046660 | Ga0495625_0000008 | Ga0495625_0000008_509204_509830 | 208 |
| 252 | 3300046660 | Ga0495625_0000753 | Ga0495625_0000753_37046_37678 | 208 |
| 253 | 3300046660 | Ga0495625_0000981 | Ga0495625_0000981_21075_21707 | 208 |
| 254 | 3300046660 | Ga0495625_0013744 | Ga0495625_0013744_1045_1671 | 208 |
| 255 | 3300046660 | Ga0495625_0129013 | Ga0495625_0129013_326_958 | 208 |
| 256 | 3300046665 | Ga0495661_0002168 | Ga0495661_0002168_3616_4242 | 208 |
| 257 | 3300046665 | Ga0495661_0005175 | Ga0495661_0005175_7479_8105 | 208 |
| 258 | 3300046665 | Ga0495661_0033784 | Ga0495661_0033784_393_1019 | 208 |
| 259 | 3300046684 | Ga0495669_0138061 | Ga0495669_0138061_15_641 | 208 |
| 260 | 3300046694 | Ga0495649_0000018 | Ga0495649_0000018_26336_26962 | 208 |
| 261 | 3300046794 | Ga0495589_0079535 | Ga0495589_0079535_891_1517 | 208 |
| 262 | 3300046810 | Ga0495660_0058663 | Ga0495660_0058663_1226_1852 | 208 |
| 263 | 3300047323 | Ga0495683_0046144 | Ga0495683_0046144_58_684 | 208 |
| 264 | 3300047443 | Ga0495687_000484 | Ga0495687_000484_37869_38498 | 208 |
| 265 | 3300047443 | Ga0495687_001763 | Ga0495687_001763_13417_14049 | 208 |
| 266 | 3300047445 | Ga0495677_0018378 | Ga0495677_0018378_1348_1974 | 208 |
| 267 | 3300047472 | Ga0495686_0001825 | Ga0495686_0001825_17452_18078 | 208 |
| 268 | 3300047472 | Ga0495686_0021353 | Ga0495686_0021353_2849_3475 | 208 |
| 269 | 3300048089 | Ga0495614_0018052 | Ga0495614_0018052_944_1576 | 208 |
| 270 | 3300049460 | Ga0495682_0038658 | Ga0495682_0038658_313_945 | 208 |
| 271 | 3300050493 | nmdc:mga0k408_244617_c1 | nmdc:mga0k408_244617_c1_345_971 | 208 |
| 272 | 3300050493 | nmdc:mga0k408_518_c1 | nmdc:mga0k408_518_c1_1451_2083 | 208 |
| 273 | 3300050493 | nmdc:mga0k408_56250_c1 | nmdc:mga0k408_56250_c1_620_1246 | 208 |
| 274 | 3300053122 | Ga0500608_043017 | Ga0500608_043017_907_1542 | 208 |
| 275 | 3300053123 | Ga0500614_023471 | Ga0500614_023471_656_1318 | 208 |
| 276 | 3300053125 | Ga0500618_000037 | Ga0500618_000037_47718_48350 | 208 |
| 277 | 3300053139 | Ga0500568_0063099 | Ga0500568_0063099_765_1391 | 208 |
| 278 | 3300053153 | Ga0500616_0219032 | Ga0500616_0219032_77_703 | 208 |
| 279 | 3300053156 | Ga0500622_0084848 | Ga0500622_0084848_912_1538 | 208 |
| 280 | 3300053157 | Ga0500624_001110 | Ga0500624_001110_4368_4994 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xdz-assembly1.cif.gz_A | crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg | 0.8122 | 13 | 206 |
| 7pnz-assembly1.cif.gz_b | assembly intermediate of human mitochondrial ribosome small subunit without ms37 in complex with rbfa and mettl15 conformation c | 0.8011 | 54 | 140 |
| 7pnx-assembly1.cif.gz_b | assembly intermediate of human mitochondrial ribosome small subunit without ms37 in complex with rbfa and mettl15 conformation a | 0.8009 | 54 | 140 |
| 7cfe-assembly1.cif.gz_A | crystal structure of rsmg methyltransferase of m. tuberculosis | 0.8005 | 15 | 208 |
| 3g8b-assembly1.cif.gz_A | t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 | 0.8002 | 19 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8I3G1_737_866_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8939 | 65 | 136 | 3.40.50.150 |
| af_A0A0G2K635_413_588_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8443 | 38 | 136 | 3.40.50.150 |
| af_Q2FUQ4_1_237_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8417 | 1 | 206 | 3.40.50.150 |
| af_Q2FUQ4_1_237_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8305 | 1 | 206 | 3.40.50.150 |
| af_I1JZW8_31_274_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8152 | 7 | 206 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4I714-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) | 0.98 | 1 | 208 |
GO:0005829
GO:0070043 |
| AF-A0A7G3FFS8-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) | 0.9793 | 6 | 207 |
GO:0005829
GO:0070043 |
| AF-A0A519SBH6-F1-model_v4 | 16S rRNA (Guanine(527)-N(7))-methyltransferase RsmG | 0.9791 | 111 | 208 |
GO:0008168
GO:0032259 |
| AF-A0A7D4UB94-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) | 0.9789 | 1 | 208 |
GO:0005829
GO:0070043 |
| AF-A0A223NVB6-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) | 0.9783 | 1 | 208 |
GO:0005829
GO:0070043 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar