F383962

General Info

Members Datasets Scaffolds Average Seq Length
280 165 272 207

Family's Representative Sequence

Representative Sequence 3300053123|Ga0500614_023471|Ga0500614_023471_656_1318
Length 220
Sequence LATSSTDLTGMTSDTVFKYFPELTAQQRAQVEQLPELYNTWNSQINVISRKDIDLLYERHVLHSMGIAKIMPFLPGESVLDVGTGGGFPGIPLAILFPQTSFHLVDSIGKKIKVVQEVAKALGLTNVKATHARAEEIDENFDFVVSRAVTQLKDFYPWVRSKFKKQSGNKLPNGILYLKGGDLDQEIKESGLKVQQYYLKDYFTEEFFETKQVIYVKGKL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
7 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
105 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
106 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
160 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
161 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 0.36
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 0
Rhizoplane 0.71
Rhizosphere 82.14
Stem 0
Stem Tuber 0
Unclassified 7.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10025407 3300001989 Bacteria 2083
2 JGI24737J22298_10000825 3300001990 Bacteria 11018
3 JGI24735J21928_10000004 3300002067 Bacteria 381713
4 JGI24735J21928_10013269 3300002067 Bacteria 2593
5 JGI24744J21845_10002724 3300002077 Bacteria 3604
6 JGI25162J39368_1000017 3300002737 Bacteria 281385
7 JGI25157J39369_1008852 3300002741 Bacteria 1379
8 JGI25164J39214_1001300 3300002772 Bacteria 6314
9 JGI25165J46597_1000615 3300003214 Bacteria 30104
10 rootH1_10063127 3300003316 Bacteria 8410
11 rootH1_10063127 3300003323 Bacteria 2558
12 rootH2_10002594 3300003320 Bacteria 27151
13 rootL2_10035012 3300003322 Bacteria 2391
14 rootH1_10018482 3300003323 Bacteria 48371
15 rootH1_10023390 3300003323 Bacteria 8037
16 rootH1_10073177 3300003323 Bacteria 3761
17 rootH1_10157886 3300003323 Bacteria 2881
18 Ga0065714_10074426 3300005288 Bacteria 3039
19 Ga0065714_10086067 3300005288 Bacteria 2118
20 Ga0070658_10022622 3300005327 Bacteria 5044
21 Ga0070658_10595854 3300005327 Unclassified 958
22 Ga0070676_10004899 3300005328 Bacteria 7093
23 Ga0070683_100086280 3300005329 Bacteria 2943
24 Ga0068868_100075871 3300005338 Bacteria 2687
25 Ga0070660_100030591 3300005339 Bacteria 4039
26 Ga0070675_100411277 3300005354 Bacteria 1208
27 Ga0070673_100013170 3300005364 Bacteria 5708
28 Ga0070673_101320041 3300005364 Bacteria 678
29 Ga0070659_100000899 3300005366 Bacteria 21771
30 Ga0070659_100018047 3300005366 Bacteria 5321
31 Ga0070678_100000238 3300005456 Bacteria 25199
32 Ga0070662_100000954 3300005457 Bacteria 17728
33 Ga0068867_100001989 3300005459 Bacteria 14258
34 Ga0070685_10403240 3300005466 Unclassified 947
35 Ga0070679_100896547 3300005530 Bacteria 830
36 Ga0070684_100051467 3300005535 Bacteria 3578
37 Ga0068853_100173489 3300005539 Bacteria 1952
38 Ga0068853_100532683 3300005539 Bacteria 1111
39 Ga0070665_100000072 3300005548 Bacteria 198575
40 Ga0068855_100000268 3300005563 Bacteria 64693
41 Ga0068855_100055857 3300005563 Bacteria 4635
42 Ga0068855_100146419 3300005563 Bacteria 2688
43 Ga0068855_100315870 3300005563 Bacteria 1728
44 Ga0068854_100053984 3300005578 Bacteria 2888
45 Ga0068854_100529661 3300005578 Bacteria 996
46 Ga0068856_100002547 3300005614 Bacteria 18779
47 Ga0068856_100098484 3300005614 Bacteria 2914
48 Ga0068852_100000143 3300005616 Bacteria 48192
49 Ga0068852_100022550 3300005616 Bacteria 5051
50 Ga0068866_10061294 3300005718 Bacteria 1953
51 Ga0075366_10000414 3300006195 Bacteria 19952
52 Ga0097621_100000028 3300006237 Bacteria 71678
53 Ga0075370_10119384 3300006353 Bacteria 1534
54 Ga0068871_100000066 3300006358 Bacteria 57980
55 Ga0068871_100558129 3300006358 Unclassified 1038
56 Ga0068865_100000732 3300006881 Bacteria 18431
57 Ga0105240_10000876 3300009093 Bacteria 54171
58 Ga0105240_10023971 3300009093 Bacteria 8061
59 Ga0105240_10028278 3300009093 Bacteria 7324
60 Ga0105240_10049341 3300009093 Bacteria 5313
61 Ga0105240_10078747 3300009093 Bacteria 4058
62 Ga0105240_10093141 3300009093 Bacteria 3678
63 Ga0105240_10129313 3300009093 Bacteria 3031
64 Ga0105240_10203072 3300009093 Bacteria 2321
65 Ga0105240_10240104 3300009093 Bacteria 2101
66 Ga0105241_10003705 3300009174 Bacteria 11358
67 Ga0105241_10011403 3300009174 Bacteria 6515
68 Ga0105241_10049977 3300009174 Bacteria 3186
69 Ga0105241_10172326 3300009174 Bacteria 1788
70 Ga0105242_10767108 3300009176 Bacteria 951
71 Ga0105237_10000485 3300009545 Bacteria 56664
72 Ga0105237_10008444 3300009545 Bacteria 11142
73 Ga0105237_10059742 3300009545 Bacteria 3814
74 Ga0105237_10065690 3300009545 Bacteria 3623
75 Ga0105237_10173594 3300009545 Bacteria 2156
76 Ga0105237_10174050 3300009545 Bacteria 2153
77 Ga0105237_10318002 3300009545 Bacteria 1560
78 Ga0105238_10057708 3300009551 Bacteria 3892
79 Ga0105249_10590660 3300009553 Bacteria 1164
80 Ga0105239_10000039 3300010375 Bacteria 203537
81 Ga0105239_10000120 3300010375 Bacteria 110003
82 Ga0105239_10001068 3300010375 Bacteria 38074
83 Ga0105239_10002256 3300010375 Bacteria 24634
84 Ga0105239_10004588 3300010375 Bacteria 16460
85 Ga0105239_10031340 3300010375 Bacteria 5849
86 Ga0105246_10468914 3300011119 Unclassified 1062
87 Ga0157373_10000119 3300013100 Bacteria 62053
88 Ga0157373_10004143 3300013100 Bacteria 10932
89 Ga0157373_10027859 3300013100 Bacteria 4076
90 Ga0157371_10000263 3300013102 Bacteria 71557
91 Ga0157371_10039035 3300013102 Bacteria 3396
92 Ga0157370_10081538 3300013104 Bacteria 3044
93 Ga0157369_10017498 3300013105 Bacteria 8055
94 Ga0157374_10000174 3300013296 Bacteria 59597
95 Ga0157374_10001861 3300013296 Bacteria 17768
96 Ga0163162_10000010 3300013306 Bacteria 302032
97 Ga0163162_10004644 3300013306 Bacteria 13243
98 Ga0157372_10000635 3300013307 Bacteria 38523
99 Ga0157372_10010262 3300013307 Bacteria 9949
100 Ga0157372_10011346 3300013307 Bacteria 9478
101 Ga0157372_10011463 3300013307 Bacteria 9427
102 Ga0157372_10053455 3300013307 Bacteria 4502
103 Ga0157372_10063039 3300013307 Bacteria 4155
104 Ga0157375_10209497 3300013308 Bacteria 2106
105 Ga0163161_10055914 3300017792 Bacteria 2865
106 Ga0206351_10472049 3300020077 Bacteria 2167
107 Ga0213872_10008465 3300021361 Bacteria 4978
108 Ga0207427_100172 3300025231 Bacteria 71550
109 Ga0209437_100024 3300025233 Bacteria 592878
110 Ga0209437_100034 3300025233 Bacteria 494007
111 Ga0209026_1000514 3300025250 Bacteria 27275
112 Ga0209148_1028914 3300025254 Bacteria 840
113 Ga0209129_1010024 3300025258 Bacteria 2411
114 Ga0209233_1000038 3300025261 Bacteria 548972
115 Ga0209233_1004303 3300025261 Bacteria 4864
116 Ga0209455_1001647 3300025272 Bacteria 9710
117 Ga0207642_10075928 3300025899 Bacteria 1616
118 Ga0207647_10000076 3300025904 Bacteria 75824
119 Ga0207647_10010252 3300025904 Bacteria 6620
120 Ga0207647_10100871 3300025904 Bacteria 1713
121 Ga0207645_10001390 3300025907 Bacteria 19866
122 Ga0207705_10051326 3300025909 Bacteria 2969
123 Ga0207654_10003959 3300025911 Bacteria 7458
124 Ga0207654_10008138 3300025911 Bacteria 5287
125 Ga0207654_10160331 3300025911 Bacteria 1452
126 Ga0207654_10481199 3300025911 Bacteria 874
127 Ga0207695_10000013 3300025913 Bacteria 821265
128 Ga0207695_10002721 3300025913 Bacteria 25814
129 Ga0207695_10018312 3300025913 Bacteria 8102
130 Ga0207695_10019916 3300025913 Bacteria 7707
131 Ga0207695_10153390 3300025913 Bacteria 2240
132 Ga0207695_10206117 3300025913 Bacteria 1879
133 Ga0207695_10443806 3300025913 Bacteria 1181
134 Ga0207695_10491361 3300025913 Bacteria 1109
135 Ga0207671_10000663 3300025914 Bacteria 44922
136 Ga0207671_10004095 3300025914 Bacteria 14111
137 Ga0207671_10007966 3300025914 Bacteria 9077
138 Ga0207671_10031253 3300025914 Bacteria 3967
139 Ga0207671_10046814 3300025914 Bacteria 3200
140 Ga0207671_10057566 3300025914 Bacteria 2881
141 Ga0207671_10132650 3300025914 Bacteria 1913
142 Ga0207657_10034159 3300025919 Bacteria 4576
143 Ga0207652_10883140 3300025921 Bacteria 790
144 Ga0207694_10003884 3300025924 Bacteria 11815
145 Ga0207694_10275662 3300025924 Bacteria 1380
146 Ga0207659_10509540 3300025926 Unclassified 1019
147 Ga0207690_10000594 3300025932 Bacteria 23425
148 Ga0207706_10001262 3300025933 Bacteria 25516
149 Ga0207704_10000044 3300025938 Bacteria 86753
150 Ga0207704_10642693 3300025938 Bacteria 873
151 Ga0207661_10078663 3300025944 Bacteria 2716
152 Ga0207667_10001079 3300025949 Bacteria 34634
153 Ga0207667_10026398 3300025949 Bacteria 6347
154 Ga0207667_10107814 3300025949 Bacteria 2874
155 Ga0207667_10123542 3300025949 Bacteria 2667
156 Ga0207667_10160087 3300025949 Bacteria 2316
157 Ga0207651_10001871 3300025960 Bacteria 9842
158 Ga0207640_10099552 3300025981 Bacteria 2035
159 Ga0207703_10468687 3300026035 Bacteria 1179
160 Ga0207639_10038533 3300026041 Bacteria 3556
161 Ga0207702_10000797 3300026078 Bacteria 33437
162 Ga0207702_10004560 3300026078 Bacteria 12275
163 Ga0207702_10076688 3300026078 Bacteria 2890
164 Ga0207648_10000529 3300026089 Bacteria 42805
165 Ga0207674_10143969 3300026116 Bacteria 2343
166 Ga0207683_10002525 3300026121 Bacteria 15981
167 Ga0207698_10001299 3300026142 Bacteria 14560
168 Ga0207698_10035311 3300026142 Bacteria 3656
169 Ga0268266_10000089 3300028379 Bacteria 198566
170 Ga0307517_10010238 3300028786 Bacteria 13156
171 Ga0307515_10001997 3300028794 Bacteria 45190
172 Ga0307515_10002629 3300028794 Bacteria 38616
173 Ga0307515_10115021 3300028794 Bacteria 3104
174 Ga0265338_10059513 3300028800 Bacteria 3365
175 Ga0316183_1092444 3300030742 Bacteria 19117
176 Ga0316181_1058180 3300030744 Bacteria 14447
177 Ga0316182_1100448 3300030745 Bacteria 1519
178 Ga0265327_10205383 3300031251 Bacteria 891
179 Ga0307509_10347777 3300031507 Bacteria 1207
180 Ga0307408_100000143 3300031548 Bacteria 79423
181 Ga0307408_100000672 3300031548 Bacteria 28427
182 Ga0307408_100007095 3300031548 Bacteria 7415
183 Ga0307413_10661813 3300031824 Unclassified 863
184 Ga0307412_10000847 3300031911 Bacteria 17599
185 Ga0307412_10013283 3300031911 Bacteria 4822
186 Ga0307412_10929920 3300031911 Bacteria 764
187 Ga0307414_10009343 3300032004 Bacteria 5627
188 Ga0307414_10016196 3300032004 Bacteria 4525
189 Ga0307414_10334201 3300032004 Unclassified 1294
190 Ga0307414_10585791 3300032004 Bacteria 999
191 Ga0307411_10140074 3300032005 Unclassified 1782
192 Ga0307507_10000015 3300033179 Bacteria 237419
193 Ga0307510_10042210 3300033180 Bacteria 4973
194 Ga0395899_0006330 3300037312 Bacteria 9163
195 Ga0395899_0022763 3300037312 Bacteria 4748
196 Ga0395900_0000277 3300037418 Bacteria 77256
197 Ga0395898_0104003 3300037466 Bacteria 2724
198 Ga0395905_0000068 3300037471 Bacteria 177163
199 Ga0395905_0000727 3300037471 Bacteria 43437
200 Ga0395901_0000199 3300038443 Bacteria 76415
201 Ga0395901_0007872 3300038443 Bacteria 10748
202 Ga0395901_0045851 3300038443 Bacteria 4539
203 Ga0436361_1010852 3300039447 Bacteria 6529
204 Ga0451802_1261061 3300041460 Bacteria 751
205 Ga0451833_0845009 3300041491 Bacteria 1378
206 Ga0439457_012313 3300042014 Bacteria 1929
207 Ga0495629_0238600 3300046459 Bacteria 1252
208 Ga0495651_0020461 3300046462 Bacteria 5138
209 Ga0495650_0000087 3300046471 Bacteria 234870
210 Ga0495650_0136705 3300046471 Bacteria 890
211 Ga0495585_0000286 3300046492 Bacteria 50524
212 Ga0495585_0000667 3300046492 Bacteria 31526
213 Ga0495606_0000052 3300046507 Bacteria 201529
214 Ga0495606_0017553 3300046507 Bacteria 5404
215 Ga0495606_0049243 3300046507 Bacteria 2765
216 Ga0495608_0424732 3300046511 Bacteria 811
217 Ga0495610_0004136 3300046512 Bacteria 10856
218 Ga0495610_0012603 3300046512 Bacteria 5077
219 Ga0495616_0008553 3300046513 Bacteria 6052
220 Ga0495628_0298345 3300046516 Bacteria 1193
221 Ga0495631_0157237 3300046518 Bacteria 975
222 Ga0495637_0034291 3300046520 Bacteria 2224
223 Ga0495644_0016404 3300046523 Bacteria 2835
224 Ga0495648_0005254 3300046524 Bacteria 10819
225 Ga0495648_0159759 3300046524 Bacteria 1166
226 Ga0495609_0040730 3300046538 Bacteria 2090
227 Ga0495609_0156687 3300046538 Bacteria 967
228 Ga0495633_0000035 3300046558 Bacteria 185403
229 Ga0495633_0005233 3300046558 Bacteria 8002
230 Ga0495633_0138462 3300046558 Bacteria 1126
231 Ga0495668_0000032 3300046616 Bacteria 254951
232 Ga0495668_0480968 3300046616 Bacteria 684
233 Ga0495634_0396271 3300046642 Bacteria 821
234 Ga0495625_0000008 3300046660 Bacteria 536165
235 Ga0495625_0000753 3300046660 Bacteria 45225
236 Ga0495625_0000981 3300046660 Bacteria 37838
237 Ga0495625_0013744 3300046660 Bacteria 6491
238 Ga0495625_0129013 3300046660 Bacteria 1714
239 Ga0495661_0002168 3300046665 Bacteria 15344
240 Ga0495661_0005175 3300046665 Bacteria 9289
241 Ga0495661_0033784 3300046665 Bacteria 3224
242 Ga0495669_0138061 3300046684 Bacteria 1150
243 Ga0495649_0000018 3300046694 Bacteria 220586
244 Ga0495649_0064420 3300046694 Bacteria 1968
245 Ga0495589_0079535 3300046794 Bacteria 1595
246 Ga0495660_0058663 3300046810 Bacteria 2072
247 Ga0495683_0046144 3300047323 Bacteria 2187
248 Ga0495683_0057023 3300047323 Bacteria 1942
249 Ga0495687_000484 3300047443 Bacteria 48242
250 Ga0495687_001763 3300047443 Bacteria 19137
251 Ga0495677_0018378 3300047445 Bacteria 2534
252 Ga0495686_0000052 3300047472 Bacteria 262622
253 Ga0495686_0001825 3300047472 Bacteria 21435
254 Ga0495686_0021353 3300047472 Bacteria 4302
255 Ga0495614_0018052 3300048089 Bacteria 3058
256 Ga0495682_0038658 3300049460 Bacteria 1753
257 Ga0501223_000948 3300049663 Bacteria 6835
258 Ga0501240_004036 3300049673 Unclassified 1678
259 nmdc:mga0k408_244617_c1 3300050493 Bacteria 1071
260 nmdc:mga0k408_518_c1 3300050493 Bacteria 21209
261 nmdc:mga0k408_56250_c1 3300050493 Bacteria 2282
262 Ga0500635_0025064 3300053080 Bacteria 1877
263 Ga0500608_025564 3300053122 Bacteria 2764
264 Ga0500608_043017 3300053122 Bacteria 2168
265 Ga0500614_023471 3300053123 Bacteria 1450
266 Ga0500618_000037 3300053125 Bacteria 117320
267 Ga0500642_0092814 3300053130 Bacteria 1397
268 Ga0500642_0094047 3300053130 Bacteria 1388
269 Ga0500568_0063099 3300053139 Bacteria 1430
270 Ga0500616_0219032 3300053153 Bacteria 831
271 Ga0500622_0084848 3300053156 Bacteria 1581
272 Ga0500624_001110 3300053157 Bacteria 5041

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025938 Ga0207704_10642693 Ga0207704_106426931 181
2 3300031911 Ga0307412_10013283 Ga0307412_100132834 184
3 3300049663 Ga0501223_000948 Ga0501223_000948_1051_1716 184
4 3300049673 Ga0501240_004036 Ga0501240_004036_44_676 184
5 3300041460 Ga0451802_1261061 Ga0451802_1261061_178_738 185
6 3300037312 Ga0395899_0006330 Ga0395899_0006330_7073_7702 190
7 3300037418 Ga0395900_0000277 Ga0395900_0000277_49872_50501 190
8 3300037471 Ga0395905_0000068 Ga0395905_0000068_40765_41394 190
9 3300038443 Ga0395901_0000199 Ga0395901_0000199_27551_28180 190
10 3300005327 Ga0070658_10595854 Ga0070658_105958542 191
11 3300053080 Ga0500635_0025064 Ga0500635_0025064_384_1013 194
12 3300021361 Ga0213872_10008465 Ga0213872_100084654 195
13 3300039447 Ga0436361_1010852 Ga0436361_1010852_2142_2771 195
14 3300053130 Ga0500642_0092814 Ga0500642_0092814_119_745 195
15 3300013307 Ga0157372_10053455 Ga0157372_100534556 197
16 3300028786 Ga0307517_10010238 Ga0307517_1001023814 197
17 3300031507 Ga0307509_10347777 Ga0307509_103477772 197
18 3300033180 Ga0307510_10042210 Ga0307510_100422105 197
19 3300047323 Ga0495683_0057023 Ga0495683_0057023_499_1128 197
20 3300047472 Ga0495686_0000052 Ga0495686_0000052_221318_221974 197
21 3300053122 Ga0500608_025564 Ga0500608_025564_1850_2476 197
22 3300005718 Ga0068866_10061294 Ga0068866_100612942 198
23 3300025899 Ga0207642_10075928 Ga0207642_100759282 198
24 3300046616 Ga0495668_0480968 Ga0495668_0480968_19_645 198
25 3300046694 Ga0495649_0064420 Ga0495649_0064420_300_926 198
26 3300046538 Ga0495609_0040730 Ga0495609_0040730_1160_1789 200
27 iso_pu_bacteria 2599185184 2599478306 204
28 iso_pu_bacteria 2852623160 2852626890 204
29 iso_pu_bacteria 2884933994 2884938058 204
30 iso_pu_bacteria 2919437846 2919438991 204
31 iso_pu_bacteria 2928078545 2928080644 204
32 iso_pu_bacteria 2928147474 2928150868 204
33 iso_pu_bacteria 2932082852 2932082972 204
34 iso_pu_bacteria 2977232053 2977236237 204
35 3300026035 Ga0207703_10468687 Ga0207703_104686872 206
36 3300053130 Ga0500642_0094047 Ga0500642_0094047_701_1324 207
37 iso_pu_bacteria 2842903701 2842905782 207
38 3300001989 JGI24739J22299_10025407 JGI24739J22299_100254072 208
39 3300001990 JGI24737J22298_10000825 JGI24737J22298_100008254 208
40 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004132 208
41 3300002067 JGI24735J21928_10013269 JGI24735J21928_100132691 208
42 3300002077 JGI24744J21845_10002724 JGI24744J21845_100027245 208
43 3300002737 JGI25162J39368_1000017 JGI25162J39368_100001741 208
44 3300002741 JGI25157J39369_1008852 JGI25157J39369_10088522 208
45 3300002772 JGI25164J39214_1001300 JGI25164J39214_10013004 208
46 3300003214 JGI25165J46597_1000615 JGI25165J46597_100061517 208
47 3300003316 rootH1_10063127 rootH1_100631275 208
48 3300003320 rootH2_10002594 rootH2_1000259416 208
49 3300003322 rootL2_10035012 rootL2_100350123 208
50 3300003323 rootH1_10018482 rootH1_1001848238 208
51 3300003323 rootH1_10023390 rootH1_100233909 208
52 3300003323 rootH1_10073177 rootH1_100731772 208
53 3300003323 rootH1_10157886 rootH1_101578863 208
54 3300005288 Ga0065714_10074426 Ga0065714_100744263 208
55 3300005288 Ga0065714_10086067 Ga0065714_100860673 208
56 3300005327 Ga0070658_10022622 Ga0070658_100226225 208
57 3300005328 Ga0070676_10004899 Ga0070676_100048997 208
58 3300005329 Ga0070683_100086280 Ga0070683_1000862802 208
59 3300005338 Ga0068868_100075871 Ga0068868_1000758712 208
60 3300005339 Ga0070660_100030591 Ga0070660_1000305913 208
61 3300005354 Ga0070675_100411277 Ga0070675_1004112772 208
62 3300005364 Ga0070673_100013170 Ga0070673_1000131704 208
63 3300005364 Ga0070673_101320041 Ga0070673_1013200411 208
64 3300005366 Ga0070659_100000899 Ga0070659_1000008999 208
65 3300005366 Ga0070659_100018047 Ga0070659_1000180475 208
66 3300005456 Ga0070678_100000238 Ga0070678_10000023829 208
67 3300005457 Ga0070662_100000954 Ga0070662_1000009549 208
68 3300005459 Ga0068867_100001989 Ga0068867_10000198911 208
69 3300005466 Ga0070685_10403240 Ga0070685_104032402 208
70 3300005530 Ga0070679_100896547 Ga0070679_1008965471 208
71 3300005535 Ga0070684_100051467 Ga0070684_1000514672 208
72 3300005539 Ga0068853_100173489 Ga0068853_1001734893 208
73 3300005539 Ga0068853_100532683 Ga0068853_1005326832 208
74 3300005548 Ga0070665_100000072 Ga0070665_10000007248 208
75 3300005563 Ga0068855_100000268 Ga0068855_10000026844 208
76 3300005563 Ga0068855_100055857 Ga0068855_1000558573 208
77 3300005563 Ga0068855_100146419 Ga0068855_1001464193 208
78 3300005563 Ga0068855_100315870 Ga0068855_1003158701 208
79 3300005578 Ga0068854_100053984 Ga0068854_1000539843 208
80 3300005578 Ga0068854_100529661 Ga0068854_1005296612 208
81 3300005614 Ga0068856_100002547 Ga0068856_1000025472 208
82 3300005614 Ga0068856_100098484 Ga0068856_1000984843 208
83 3300005616 Ga0068852_100000143 Ga0068852_10000014318 208
84 3300005616 Ga0068852_100022550 Ga0068852_1000225504 208
85 3300006195 Ga0075366_10000414 Ga0075366_1000041422 208
86 3300006237 Ga0097621_100000028 Ga0097621_10000002835 208
87 3300006353 Ga0075370_10119384 Ga0075370_101193841 208
88 3300006358 Ga0068871_100000066 Ga0068871_10000006632 208
89 3300006358 Ga0068871_100558129 Ga0068871_1005581292 208
90 3300006881 Ga0068865_100000732 Ga0068865_10000073212 208
91 3300009093 Ga0105240_10000876 Ga0105240_1000087649 208
92 3300009093 Ga0105240_10023971 Ga0105240_100239713 208
93 3300009093 Ga0105240_10028278 Ga0105240_100282783 208
94 3300009093 Ga0105240_10049341 Ga0105240_100493415 208
95 3300009093 Ga0105240_10078747 Ga0105240_100787475 208
96 3300009093 Ga0105240_10093141 Ga0105240_100931412 208
97 3300009093 Ga0105240_10129313 Ga0105240_101293132 208
98 3300009093 Ga0105240_10203072 Ga0105240_102030722 208
99 3300009093 Ga0105240_10240104 Ga0105240_102401043 208
100 3300009174 Ga0105241_10003705 Ga0105241_100037053 208
101 3300009174 Ga0105241_10011403 Ga0105241_100114033 208
102 3300009174 Ga0105241_10049977 Ga0105241_100499773 208
103 3300009174 Ga0105241_10172326 Ga0105241_101723262 208
104 3300009176 Ga0105242_10767108 Ga0105242_107671081 208
105 3300009545 Ga0105237_10000485 Ga0105237_100004855 208
106 3300009545 Ga0105237_10008444 Ga0105237_1000844413 208
107 3300009545 Ga0105237_10059742 Ga0105237_100597422 208
108 3300009545 Ga0105237_10065690 Ga0105237_100656904 208
109 3300009545 Ga0105237_10173594 Ga0105237_101735942 208
110 3300009545 Ga0105237_10174050 Ga0105237_101740503 208
111 3300009545 Ga0105237_10318002 Ga0105237_103180022 208
112 3300009551 Ga0105238_10057708 Ga0105238_100577083 208
113 3300009553 Ga0105249_10590660 Ga0105249_105906602 208
114 3300010375 Ga0105239_10000039 Ga0105239_10000039119 208
115 3300010375 Ga0105239_10000120 Ga0105239_1000012060 208
116 3300010375 Ga0105239_10001068 Ga0105239_1000106812 208
117 3300010375 Ga0105239_10002256 Ga0105239_1000225614 208
118 3300010375 Ga0105239_10004588 Ga0105239_100045885 208
119 3300010375 Ga0105239_10031340 Ga0105239_100313403 208
120 3300011119 Ga0105246_10468914 Ga0105246_104689142 208
121 3300013100 Ga0157373_10000119 Ga0157373_1000011938 208
122 3300013100 Ga0157373_10004143 Ga0157373_100041433 208
123 3300013100 Ga0157373_10027859 Ga0157373_100278592 208
124 3300013102 Ga0157371_10000263 Ga0157371_1000026352 208
125 3300013102 Ga0157371_10039035 Ga0157371_100390353 208
126 3300013104 Ga0157370_10081538 Ga0157370_100815382 208
127 3300013105 Ga0157369_10017498 Ga0157369_100174984 208
128 3300013296 Ga0157374_10000174 Ga0157374_1000017453 208
129 3300013296 Ga0157374_10001861 Ga0157374_1000186113 208
130 3300013306 Ga0163162_10000010 Ga0163162_1000001081 208
131 3300013306 Ga0163162_10004644 Ga0163162_100046445 208
132 3300013307 Ga0157372_10000635 Ga0157372_100006359 208
133 3300013307 Ga0157372_10010262 Ga0157372_100102628 208
134 3300013307 Ga0157372_10011346 Ga0157372_100113462 208
135 3300013307 Ga0157372_10011463 Ga0157372_100114638 208
136 3300013307 Ga0157372_10063039 Ga0157372_100630393 208
137 3300013308 Ga0157375_10209497 Ga0157375_102094972 208
138 3300017792 Ga0163161_10055914 Ga0163161_100559144 208
139 3300020077 Ga0206351_10472049 Ga0206351_104720493 208
140 3300025231 Ga0207427_100172 Ga0207427_10017244 208
141 3300025233 Ga0209437_100024 Ga0209437_100024275 208
142 3300025233 Ga0209437_100034 Ga0209437_100034149 208
143 3300025250 Ga0209026_1000514 Ga0209026_100051423 208
144 3300025254 Ga0209148_1028914 Ga0209148_10289141 208
145 3300025258 Ga0209129_1010024 Ga0209129_10100242 208
146 3300025261 Ga0209233_1000038 Ga0209233_1000038149 208
147 3300025261 Ga0209233_1004303 Ga0209233_10043032 208
148 3300025272 Ga0209455_1001647 Ga0209455_10016475 208
149 3300025904 Ga0207647_10000076 Ga0207647_1000007621 208
150 3300025904 Ga0207647_10010252 Ga0207647_100102522 208
151 3300025904 Ga0207647_10100871 Ga0207647_101008713 208
152 3300025907 Ga0207645_10001390 Ga0207645_100013905 208
153 3300025909 Ga0207705_10051326 Ga0207705_100513263 208
154 3300025911 Ga0207654_10003959 Ga0207654_100039599 208
155 3300025911 Ga0207654_10008138 Ga0207654_100081383 208
156 3300025911 Ga0207654_10160331 Ga0207654_101603312 208
157 3300025911 Ga0207654_10481199 Ga0207654_104811991 208
158 3300025913 Ga0207695_10000013 Ga0207695_10000013276 208
159 3300025913 Ga0207695_10002721 Ga0207695_1000272114 208
160 3300025913 Ga0207695_10018312 Ga0207695_100183129 208
161 3300025913 Ga0207695_10019916 Ga0207695_100199165 208
162 3300025913 Ga0207695_10153390 Ga0207695_101533902 208
163 3300025913 Ga0207695_10206117 Ga0207695_102061172 208
164 3300025913 Ga0207695_10443806 Ga0207695_104438062 208
165 3300025913 Ga0207695_10491361 Ga0207695_104913612 208
166 3300025914 Ga0207671_10000663 Ga0207671_1000066316 208
167 3300025914 Ga0207671_10004095 Ga0207671_1000409510 208
168 3300025914 Ga0207671_10007966 Ga0207671_100079662 208
169 3300025914 Ga0207671_10031253 Ga0207671_100312535 208
170 3300025914 Ga0207671_10046814 Ga0207671_100468142 208
171 3300025914 Ga0207671_10057566 Ga0207671_100575662 208
172 3300025914 Ga0207671_10132650 Ga0207671_101326502 208
173 3300025919 Ga0207657_10034159 Ga0207657_100341593 208
174 3300025921 Ga0207652_10883140 Ga0207652_108831401 208
175 3300025924 Ga0207694_10003884 Ga0207694_1000388410 208
176 3300025924 Ga0207694_10275662 Ga0207694_102756622 208
177 3300025926 Ga0207659_10509540 Ga0207659_105095402 208
178 3300025932 Ga0207690_10000594 Ga0207690_1000059412 208
179 3300025933 Ga0207706_10001262 Ga0207706_100012627 208
180 3300025938 Ga0207704_10000044 Ga0207704_1000004466 208
181 3300025944 Ga0207661_10078663 Ga0207661_100786632 208
182 3300025949 Ga0207667_10001079 Ga0207667_1000107942 208
183 3300025949 Ga0207667_10026398 Ga0207667_100263982 208
184 3300025949 Ga0207667_10107814 Ga0207667_101078143 208
185 3300025949 Ga0207667_10123542 Ga0207667_101235423 208
186 3300025949 Ga0207667_10160087 Ga0207667_101600871 208
187 3300025960 Ga0207651_10001871 Ga0207651_1000187110 208
188 3300025981 Ga0207640_10099552 Ga0207640_100995523 208
189 3300026041 Ga0207639_10038533 Ga0207639_100385332 208
190 3300026078 Ga0207702_10000797 Ga0207702_1000079716 208
191 3300026078 Ga0207702_10004560 Ga0207702_100045605 208
192 3300026078 Ga0207702_10076688 Ga0207702_100766883 208
193 3300026089 Ga0207648_10000529 Ga0207648_1000052933 208
194 3300026116 Ga0207674_10143969 Ga0207674_101439691 208
195 3300026121 Ga0207683_10002525 Ga0207683_100025253 208
196 3300026142 Ga0207698_10001299 Ga0207698_100012998 208
197 3300026142 Ga0207698_10035311 Ga0207698_100353113 208
198 3300028379 Ga0268266_10000089 Ga0268266_1000008947 208
199 3300028794 Ga0307515_10001997 Ga0307515_100019973 208
200 3300028794 Ga0307515_10002629 Ga0307515_1000262914 208
201 3300028794 Ga0307515_10115021 Ga0307515_101150213 208
202 3300028800 Ga0265338_10059513 Ga0265338_100595132 208
203 3300030742 Ga0316183_1092444 Ga0316183_10924445 208
204 3300030744 Ga0316181_1058180 Ga0316181_10581802 208
205 3300030745 Ga0316182_1100448 Ga0316182_11004481 208
206 3300031251 Ga0265327_10205383 Ga0265327_102053831 208
207 3300031548 Ga0307408_100000143 Ga0307408_10000014376 208
208 3300031548 Ga0307408_100000672 Ga0307408_10000067221 208
209 3300031548 Ga0307408_100007095 Ga0307408_1000070957 208
210 3300031824 Ga0307413_10661813 Ga0307413_106618131 208
211 3300031911 Ga0307412_10000847 Ga0307412_1000084715 208
212 3300031911 Ga0307412_10929920 Ga0307412_109299202 208
213 3300032004 Ga0307414_10009343 Ga0307414_100093435 208
214 3300032004 Ga0307414_10016196 Ga0307414_100161964 208
215 3300032004 Ga0307414_10334201 Ga0307414_103342011 208
216 3300032004 Ga0307414_10585791 Ga0307414_105857911 208
217 3300032005 Ga0307411_10140074 Ga0307411_101400742 208
218 3300033179 Ga0307507_10000015 Ga0307507_1000001524 208
219 3300037312 Ga0395899_0022763 Ga0395899_0022763_2807_3439 208
220 3300037466 Ga0395898_0104003 Ga0395898_0104003_52_684 208
221 3300037471 Ga0395905_0000727 Ga0395905_0000727_9284_9916 208
222 3300038443 Ga0395901_0007872 Ga0395901_0007872_1468_2100 208
223 3300038443 Ga0395901_0045851 Ga0395901_0045851_963_1589 208
224 3300041491 Ga0451833_0845009 Ga0451833_0845009_663_1319 208
225 3300042014 Ga0439457_012313 Ga0439457_012313_1203_1835 208
226 3300046459 Ga0495629_0238600 Ga0495629_0238600_441_1073 208
227 3300046462 Ga0495651_0020461 Ga0495651_0020461_4342_4968 208
228 3300046471 Ga0495650_0000087 Ga0495650_0000087_50755_51381 208
229 3300046471 Ga0495650_0136705 Ga0495650_0136705_112_738 208
230 3300046492 Ga0495585_0000286 Ga0495585_0000286_3824_4450 208
231 3300046492 Ga0495585_0000667 Ga0495585_0000667_4255_4887 208
232 3300046507 Ga0495606_0000052 Ga0495606_0000052_144975_145601 208
233 3300046507 Ga0495606_0017553 Ga0495606_0017553_2602_3228 208
234 3300046507 Ga0495606_0049243 Ga0495606_0049243_1326_1952 208
235 3300046511 Ga0495608_0424732 Ga0495608_0424732_162_791 208
236 3300046512 Ga0495610_0004136 Ga0495610_0004136_10033_10659 208
237 3300046512 Ga0495610_0012603 Ga0495610_0012603_3812_4438 208
238 3300046513 Ga0495616_0008553 Ga0495616_0008553_4046_4672 208
239 3300046516 Ga0495628_0298345 Ga0495628_0298345_364_996 208
240 3300046518 Ga0495631_0157237 Ga0495631_0157237_309_935 208
241 3300046520 Ga0495637_0034291 Ga0495637_0034291_774_1400 208
242 3300046523 Ga0495644_0016404 Ga0495644_0016404_960_1586 208
243 3300046524 Ga0495648_0005254 Ga0495648_0005254_9845_10477 208
244 3300046524 Ga0495648_0159759 Ga0495648_0159759_484_1116 208
245 3300046538 Ga0495609_0156687 Ga0495609_0156687_148_774 208
246 3300046558 Ga0495633_0000035 Ga0495633_0000035_162626_163258 208
247 3300046558 Ga0495633_0005233 Ga0495633_0005233_1301_1927 208
248 3300046558 Ga0495633_0138462 Ga0495633_0138462_210_836 208
249 3300046616 Ga0495668_0000032 Ga0495668_0000032_32384_33016 208
250 3300046642 Ga0495634_0396271 Ga0495634_0396271_49_678 208
251 3300046660 Ga0495625_0000008 Ga0495625_0000008_509204_509830 208
252 3300046660 Ga0495625_0000753 Ga0495625_0000753_37046_37678 208
253 3300046660 Ga0495625_0000981 Ga0495625_0000981_21075_21707 208
254 3300046660 Ga0495625_0013744 Ga0495625_0013744_1045_1671 208
255 3300046660 Ga0495625_0129013 Ga0495625_0129013_326_958 208
256 3300046665 Ga0495661_0002168 Ga0495661_0002168_3616_4242 208
257 3300046665 Ga0495661_0005175 Ga0495661_0005175_7479_8105 208
258 3300046665 Ga0495661_0033784 Ga0495661_0033784_393_1019 208
259 3300046684 Ga0495669_0138061 Ga0495669_0138061_15_641 208
260 3300046694 Ga0495649_0000018 Ga0495649_0000018_26336_26962 208
261 3300046794 Ga0495589_0079535 Ga0495589_0079535_891_1517 208
262 3300046810 Ga0495660_0058663 Ga0495660_0058663_1226_1852 208
263 3300047323 Ga0495683_0046144 Ga0495683_0046144_58_684 208
264 3300047443 Ga0495687_000484 Ga0495687_000484_37869_38498 208
265 3300047443 Ga0495687_001763 Ga0495687_001763_13417_14049 208
266 3300047445 Ga0495677_0018378 Ga0495677_0018378_1348_1974 208
267 3300047472 Ga0495686_0001825 Ga0495686_0001825_17452_18078 208
268 3300047472 Ga0495686_0021353 Ga0495686_0021353_2849_3475 208
269 3300048089 Ga0495614_0018052 Ga0495614_0018052_944_1576 208
270 3300049460 Ga0495682_0038658 Ga0495682_0038658_313_945 208
271 3300050493 nmdc:mga0k408_244617_c1 nmdc:mga0k408_244617_c1_345_971 208
272 3300050493 nmdc:mga0k408_518_c1 nmdc:mga0k408_518_c1_1451_2083 208
273 3300050493 nmdc:mga0k408_56250_c1 nmdc:mga0k408_56250_c1_620_1246 208
274 3300053122 Ga0500608_043017 Ga0500608_043017_907_1542 208
275 3300053123 Ga0500614_023471 Ga0500614_023471_656_1318 208
276 3300053125 Ga0500618_000037 Ga0500618_000037_47718_48350 208
277 3300053139 Ga0500568_0063099 Ga0500568_0063099_765_1391 208
278 3300053153 Ga0500616_0219032 Ga0500616_0219032_77_703 208
279 3300053156 Ga0500622_0084848 Ga0500622_0084848_912_1538 208
280 3300053157 Ga0500624_001110 Ga0500624_001110_4368_4994 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

79

161

0.92

PF02527

GidB

rRNA small subunit methyltransferase G

27

215

0.88

PF13847

Methyltransf_31

Methyltransferase domain

74

211

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.8122 13 206
7pnz-assembly1.cif.gz_b assembly intermediate of human mitochondrial ribosome small subunit without ms37 in complex with rbfa and mettl15 conformation c 0.8011 54 140
7pnx-assembly1.cif.gz_b assembly intermediate of human mitochondrial ribosome small subunit without ms37 in complex with rbfa and mettl15 conformation a 0.8009 54 140
7cfe-assembly1.cif.gz_A crystal structure of rsmg methyltransferase of m. tuberculosis 0.8005 15 208
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.8002 19 206
ID Description Score Start End Superfamily
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8939 65 136 3.40.50.150
af_A0A0G2K635_413_588_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8443 38 136 3.40.50.150
af_Q2FUQ4_1_237_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8417 1 206 3.40.50.150
af_Q2FUQ4_1_237_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8305 1 206 3.40.50.150
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8152 7 206 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6I4I714-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.98 1 208 GO:0005829
GO:0070043
AF-A0A7G3FFS8-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9793 6 207 GO:0005829
GO:0070043
AF-A0A519SBH6-F1-model_v4 16S rRNA (Guanine(527)-N(7))-methyltransferase RsmG 0.9791 111 208 GO:0008168
GO:0032259
AF-A0A7D4UB94-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9789 1 208 GO:0005829
GO:0070043
AF-A0A223NVB6-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9783 1 208 GO:0005829
GO:0070043

Feature Viewer

pLDDT pTM Quality
91.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map