F383918

General Info

Members Datasets Scaffolds Average Seq Length
280 210 560 361

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0133009|Ga0501038_0133009_502_1617
Length 371
Sequence MSTIALDKLTKVFGDLTAVDRVDLNVEAGEVVCLLGPSGCGKTTTLRMIAGLEYPTAGDIRIAGRRVNHLAPRDRDVAMVFQFYALYPTLTVAENLAYPLHAERMGAAEIAARVRRVSATLHLDEVLDRRPGQLAEGERQRVAVGRAIIRDPSCFLFDEPLSRLDVQLREEMRGQIKEVLAGLAKATVIVTHDQLEALTMADRIAVMRDGLIEQCASPHEIFARPANRFVAGFIGTPQMNLIPAVLDGSADCGVRGADAEGMMRFRIDSESIVLRVDPAVGRLPPDSSVTLGIRPRSVELVGEPQSDSLSADVDLVEPMGAETLLHVVGPGRELRIVVDQHVAAHVGERLHLRFKPGQTHVFGSDERRVSA

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
173 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
174 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
177 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
178 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
184 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
188 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
189 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
190 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
191 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
192 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
193 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
194 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
195 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
196 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
197 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
198 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
199 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
200 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
201 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
202 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
203 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
204 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
205 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
206 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
207 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
208 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
209 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
210 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.43
Metatranscriptomes 0
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.79
Nodule 3.93
Rhizoplane 6.07
Rhizosphere 61.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0133009 3300049574 Bacteria 2040
2 JGI24739J22299_10034888 3300001989 Bacteria 1710
3 JGI25151J46595_10000193 3300003187 Bacteria 75098
4 JGI25153J46596_10000047 3300003215 Bacteria 146400
5 JGI25153J46596_10002272 3300003215 Bacteria 11198
6 rootH1_10121820 3300003316 Bacteria 1381
7 JGI25160J50197_1003740 3300003354 Bacteria 6706
8 Ga0065715_10143014 3300005293 Bacteria 1824
9 Ga0070658_10140715 3300005327 Bacteria 2016
10 Ga0068869_100021131 3300005334 Bacteria 4474
11 Ga0070660_100013330 3300005339 Bacteria 5893
12 Ga0070691_10123501 3300005341 Bacteria 1306
13 Ga0070661_100037155 3300005344 Bacteria 3543
14 Ga0070668_100157743 3300005347 Bacteria 1839
15 Ga0070668_100189207 3300005347 Bacteria 1685
16 Ga0070668_100292432 3300005347 Bacteria 1364
17 Ga0070674_100348553 3300005356 Bacteria 1195
18 Ga0070709_10018190 3300005434 Bacteria 4043
19 Ga0070714_100274187 3300005435 Bacteria 1565
20 Ga0070713_100019148 3300005436 Bacteria 5217
21 Ga0070708_100007578 3300005445 Bacteria 8689
22 Ga0070663_100300535 3300005455 Bacteria 1285
23 Ga0070707_100030098 3300005468 Bacteria 5165
24 Ga0070707_100067603 3300005468 Bacteria 3438
25 Ga0070698_100006881 3300005471 Bacteria 12319
26 Ga0070698_100008685 3300005471 Bacteria 10945
27 Ga0070698_100171887 3300005471 Bacteria 2107
28 Ga0070699_100002505 3300005518 Bacteria 16490
29 Ga0070699_100003766 3300005518 Bacteria 13408
30 Ga0070699_100028767 3300005518 Bacteria 4792
31 Ga0070699_100100871 3300005518 Bacteria 2530
32 Ga0070699_100343008 3300005518 Bacteria 1345
33 Ga0070684_100171860 3300005535 Bacteria 1968
34 Ga0070697_100010110 3300005536 Bacteria 7360
35 Ga0070697_100053282 3300005536 Bacteria 3288
36 Ga0070696_100056923 3300005546 Bacteria 2728
37 Ga0070693_100123636 3300005547 Bacteria 1608
38 Ga0070665_100061709 3300005548 Bacteria 3758
39 Ga0068855_100339411 3300005563 Bacteria 1657
40 Ga0070664_100375482 3300005564 Bacteria 1297
41 Ga0068854_100077766 3300005578 Bacteria 2442
42 Ga0068856_100183160 3300005614 Bacteria 2108
43 Ga0068852_100041148 3300005616 Bacteria 3903
44 Ga0068861_100044559 3300005719 Bacteria 3336
45 Ga0068861_100102323 3300005719 Bacteria 2280
46 Ga0068863_100042801 3300005841 Bacteria 4302
47 Ga0068863_100319913 3300005841 Bacteria 1507
48 Ga0068858_100079470 3300005842 Bacteria 3048
49 Ga0068860_100147877 3300005843 Bacteria 2261
50 Ga0068862_100033418 3300005844 Bacteria 4348
51 Ga0068862_100036338 3300005844 Bacteria 4176
52 Ga0081538_10004363 3300005981 Bacteria 13069
53 Ga0081538_10096492 3300005981 Bacteria 1506
54 Ga0081540_1018170 3300005983 Bacteria 4325
55 Ga0081540_1028944 3300005983 Bacteria 3098
56 Ga0081539_10003448 3300005985 Bacteria 19419
57 Ga0081539_10057780 3300005985 Bacteria 2144
58 Ga0070717_10002395 3300006028 Bacteria 13222
59 Ga0075365_10061186 3300006038 Bacteria 2514
60 Ga0075368_10006791 3300006042 Bacteria 4019
61 Ga0075363_100105647 3300006048 Bacteria 1561
62 Ga0075364_10002231 3300006051 Bacteria 10866
63 Ga0075362_10003826 3300006177 Bacteria 5337
64 Ga0075367_10010867 3300006178 Bacteria 4797
65 Ga0075367_10167345 3300006178 Bacteria 1368
66 Ga0075369_10000059 3300006186 Bacteria 28189
67 Ga0075369_10005240 3300006186 Bacteria 4833
68 Ga0075428_100014634 3300006844 Bacteria 8712
69 Ga0075431_100006227 3300006847 Bacteria 11850
70 Ga0075433_10013797 3300006852 Bacteria 6584
71 Ga0075429_100033724 3300006880 Bacteria 4449
72 Ga0105240_10226202 3300009093 Bacteria 2177
73 Ga0111539_10000051 3300009094 Bacteria 117607
74 Ga0105245_10247109 3300009098 Bacteria 1732
75 Ga0114129_10298164 3300009147 Bacteria 2149
76 Ga0114129_10362201 3300009147 Bacteria 1918
77 Ga0105243_10035002 3300009148 Bacteria 3892
78 Ga0105248_10305339 3300009177 Bacteria 1792
79 Ga0105237_10008290 3300009545 Bacteria 11282
80 Ga0105237_10059598 3300009545 Bacteria 3819
81 Ga0105237_10111218 3300009545 Bacteria 2731
82 Ga0105238_10018011 3300009551 Bacteria 7181
83 Ga0105238_10222456 3300009551 Bacteria 1864
84 Ga0105033_101433 3300009986 Bacteria 1948
85 Ga0105239_10070155 3300010375 Bacteria 3849
86 Ga0105239_10501691 3300010375 Bacteria 1380
87 Ga0157374_10026042 3300013296 Bacteria 5258
88 Ga0163162_10025071 3300013306 Bacteria 5893
89 Ga0163163_10050651 3300014325 Bacteria 4090
90 Ga0163163_10369492 3300014325 Bacteria 1491
91 Ga0182008_10012549 3300014497 Bacteria 4472
92 Ga0157379_10171374 3300014968 Bacteria 1959
93 Ga0213872_10010966 3300021361 Bacteria 4299
94 Ga0213872_10022996 3300021361 Bacteria 2868
95 Ga0213872_10047907 3300021361 Bacteria 1942
96 Ga0213876_10001432 3300021384 Bacteria 14863
97 Ga0213875_10047517 3300021388 Bacteria 2014
98 Ga0213875_10061694 3300021388 Bacteria 1754
99 Ga0213871_10000345 3300021441 Bacteria 5972
100 Ga0213871_10002308 3300021441 Bacteria 3486
101 Ga0209130_1001013 3300025284 Bacteria 21788
102 Ga0209025_1000061 3300025294 Bacteria 304827
103 Ga0209758_1000070 3300025297 Bacteria 284093
104 Ga0209758_1012164 3300025297 Bacteria 4856
105 Ga0209050_1007079 3300025298 Bacteria 6421
106 Ga0207426_1000451 3300025302 Bacteria 65459
107 Ga0209257_1000296 3300025304 Bacteria 109517
108 Ga0207653_10005399 3300025885 Bacteria 3997
109 Ga0207642_10144905 3300025899 Bacteria 1257
110 Ga0207647_10006278 3300025904 Bacteria 8654
111 Ga0207699_10030489 3300025906 Bacteria 3019
112 Ga0207695_10102863 3300025913 Bacteria 2849
113 Ga0207671_10035874 3300025914 Bacteria 3677
114 Ga0207657_10166532 3300025919 Bacteria 1787
115 Ga0207646_10031900 3300025922 Bacteria 4769
116 Ga0207646_10056306 3300025922 Bacteria 3515
117 Ga0207681_10043689 3300025923 Bacteria 3001
118 Ga0207700_10174017 3300025928 Bacteria 1798
119 Ga0207706_10007483 3300025933 Bacteria 10098
120 Ga0207706_10218931 3300025933 Bacteria 1667
121 Ga0207709_10076239 3300025935 Bacteria 2146
122 Ga0207669_10092403 3300025937 Bacteria 1974
123 Ga0207689_10004859 3300025942 Bacteria 12111
124 Ga0207679_10163284 3300025945 Bacteria 1826
125 Ga0207712_10030162 3300025961 Bacteria 3644
126 Ga0207668_10160137 3300025972 Bacteria 1753
127 Ga0207678_10022352 3300026067 Bacteria 5541
128 Ga0207708_10032779 3300026075 Bacteria 3944
129 Ga0207641_10039658 3300026088 Bacteria 3940
130 Ga0207675_100003282 3300026118 Bacteria 15845
131 Ga0207675_100015988 3300026118 Bacteria 7004
132 Ga0207698_10095226 3300026142 Bacteria 2450
133 Ga0207428_10003036 3300027907 Bacteria 16519
134 Ga0268266_10264166 3300028379 Bacteria 1596
135 Ga0268265_10046375 3300028380 Bacteria 3248
136 Ga0268265_10101801 3300028380 Bacteria 2321
137 Ga0268264_10000020 3300028381 Bacteria 483593
138 Ga0268264_10164886 3300028381 Bacteria 1999
139 Ga0307517_10160502 3300028786 Bacteria 1511
140 Ga0307512_10120678 3300030522 Bacteria 1686
141 Ga0307513_10013449 3300031456 Bacteria 10040
142 Ga0307513_10225152 3300031456 Bacteria 1693
143 Ga0307508_10077121 3300031616 Bacteria 2911
144 Ga0307413_10072095 3300031824 Bacteria 2179
145 Ga0307410_10069051 3300031852 Bacteria 2443
146 Ga0373931_0126784 3300035691 Bacteria 1465
147 Ga0373927_0024800 3300035695 Bacteria 3919
148 Ga0395905_0363953 3300037471 Bacteria 1339
149 Ga0436364_0010806 3300037853 Bacteria 2392
150 Ga0436364_0174801 3300037853 Bacteria 6251
151 Ga0436364_0302033 3300037853 Bacteria 9589
152 Ga0400483_029441 3300039062 Bacteria 7342
153 Ga0436365_0117548 3300039437 Bacteria 62327
154 Ga0436365_0896091 3300039437 Bacteria 1879
155 Ga0436365_1889837 3300039437 Bacteria 134049
156 Ga0436360_0531510 3300039438 Bacteria 12504
157 Ga0436360_0624224 3300039438 Bacteria 2014
158 Ga0436360_0827838 3300039438 Bacteria 1846
159 Ga0436360_0928900 3300039438 Bacteria 4688
160 Ga0436360_1037802 3300039438 Bacteria 4081
161 Ga0436361_0492578 3300039447 Bacteria 3921
162 Ga0436361_0597352 3300039447 Bacteria 1717
163 Ga0436361_0657024 3300039447 Bacteria 4054
164 Ga0436361_0668901 3300039447 Bacteria 11621
165 Ga0436363_1543396 3300039450 Bacteria 20579
166 Ga0451576_0125004 3300045051 Bacteria 2680
167 Ga0495625_0103525 3300046660 Bacteria 1952
168 Ga0495686_0038587 3300047472 Bacteria 3054
169 Ga0495686_0054083 3300047472 Bacteria 2515
170 Ga0495602_0073542 3300048088 Bacteria 2909
171 Ga0496100_0117491 3300048903 Bacteria 1857
172 Ga0496100_0240723 3300048903 Bacteria 1335
173 Ga0496102_0079408 3300048905 Bacteria 3022
174 Ga0496102_0109014 3300048905 Bacteria 2580
175 Ga0496103_0168557 3300048906 Bacteria 1405
176 Ga0496105_0174947 3300048908 Bacteria 1758
177 Ga0496106_0193701 3300048909 Bacteria 1616
178 Ga0496107_0144696 3300048910 Bacteria 1757
179 Ga0496107_0217837 3300048910 Bacteria 1420
180 Ga0496108_0000009 3300048911 Bacteria 276390
181 Ga0496109_0366114 3300048912 Bacteria 1362
182 Ga0496110_0043077 3300048913 Bacteria 3941
183 Ga0496110_0241645 3300048913 Bacteria 1643
184 Ga0496112_0017248 3300048915 Bacteria 6780
185 Ga0496113_0351990 3300048916 Bacteria 1182
186 Ga0496115_0048941 3300048918 Bacteria 3382
187 Ga0496115_0050524 3300048918 Bacteria 3331
188 Ga0496119_0051952 3300048922 Bacteria 2514
189 Ga0496120_0012804 3300048923 Bacteria 5684
190 Ga0496125_0090844 3300048928 Bacteria 2290
191 Ga0501034_0081370 3300049571 Bacteria 3241
192 Ga0501036_0138465 3300049572 Bacteria 2054
193 Ga0501038_0071625 3300049574 Bacteria 2940
194 Ga0501038_0191695 3300049574 Bacteria 1644
195 Ga0501040_0013501 3300049576 Bacteria 5369
196 Ga0501041_0001664 3300049577 Bacteria 12444
197 Ga0501042_0068275 3300049578 Bacteria 2542
198 Ga0501043_0045278 3300049579 Bacteria 3460
199 Ga0501047_0012129 3300049581 Bacteria 8158
200 Ga0501068_0023363 3300049584 Bacteria 3622
201 Ga0501069_0138828 3300049585 Bacteria 1394
202 Ga0501070_0025909 3300049586 Bacteria 4920
203 Ga0501072_0087108 3300049588 Bacteria 2478
204 Ga0501073_0004583 3300049589 Bacteria 10387
205 Ga0501073_0021467 3300049589 Bacteria 4655
206 Ga0501074_0005754 3300049590 Bacteria 8937
207 Ga0501076_0079388 3300049592 Bacteria 2633
208 Ga0501076_0128687 3300049592 Bacteria 2053
209 Ga0501077_0064608 3300049593 Bacteria 2321
210 Ga0501079_0021311 3300049741 Bacteria 4956
211 Ga0501080_0017182 3300049742 Bacteria 6683
212 Ga0501080_0064003 3300049742 Bacteria 3422
213 Ga0501080_0086114 3300049742 Bacteria 2919
214 Ga0501080_0105501 3300049742 Bacteria 2613
215 Ga0501081_0007918 3300049743 Bacteria 6893
216 Ga0501083_0030833 3300049744 Bacteria 3680
217 Ga0501083_0089586 3300049744 Bacteria 2033
218 Ga0501035_0100917 3300049822 Bacteria 2533
219 Ga0501044_0018682 3300049823 Bacteria 7425
220 Ga0501044_0063587 3300049823 Bacteria 3769
221 Ga0501044_0098918 3300049823 Bacteria 2936
222 nmdc:mga03683_89_c1 3300050489 Bacteria 33351
223 nmdc:mga0k408_1820_c1 3300050493 Bacteria 11438
224 nmdc:mga04h51_6198_c1 3300050495 Bacteria 3088
225 nmdc:mga07m45_17953_c1 3300050496 Bacteria 3808
226 nmdc:mga05p37_124987_c1 3300050507 Bacteria 3159
227 nmdc:mga06r32_43979_c1 3300050510 Bacteria 4251
228 nmdc:mga08y16_182827_c1 3300050511 Bacteria 2176
229 nmdc:mga08y16_237_c1 3300050511 Bacteria 49310
230 nmdc:mga0a205_3661_c1 3300050515 Bacteria 13766
231 nmdc:mga0sz30_19469_c2 3300050516 Bacteria 2337
232 nmdc:mga0sz30_266_c1 3300050516 Bacteria 20024
233 Ga0500610_0117586 3300053079 Bacteria 1362
234 Ga0500646_0019639 3300053090 Bacteria 1789
235 Ga0500651_0004113 3300053093 Bacteria 8105
236 Ga0500641_0003172 3300053096 Bacteria 5817
237 Ga0500555_001335 3300053103 Bacteria 7741
238 Ga0500556_0000368 3300053104 Bacteria 33053
239 Ga0500569_038343 3300053109 Bacteria 1390
240 Ga0500595_011357 3300053119 Bacteria 3491
241 Ga0500658_0032426 3300053134 Bacteria 2049
242 Ga0500658_0065670 3300053134 Bacteria 1520
243 Ga0500577_0015564 3300053142 Bacteria 2378
244 Ga0500577_0052928 3300053142 Bacteria 1532
245 Ga0500588_0004841 3300053146 Bacteria 2944
246 Ga0500588_0020438 3300053146 Bacteria 1774
247 Ga0500604_0002263 3300053151 Bacteria 5265
248 Ga0500616_0000355 3300053153 Bacteria 65385
249 Ga0500627_0000890 3300053158 Bacteria 8003
250 Ga0500636_0014750 3300053177 Bacteria 4598
251 Ga0500611_003350 3300053727 Bacteria 2042
252 Ga0500609_000801 3300053731 Bacteria 4721
253 Ga0500609_006447 3300053731 Bacteria 1599
254 Ga0501082_0000953 3300060353 Bacteria 25552
255 Ga0501082_0321554 3300060353 Bacteria 1348
256 Ga0530510_0040701 3300061734 Bacteria 3354
257 2512932863 2512875016 Bacteria 6529530
258 2513608974 2513237090 Bacteria 7096802
259 2588518919 2588253730 Bacteria 6881675
260 2792748274 2791355123 Bacteria 8049106
261 2821450901 2821443989 Bacteria 7658172
262 2844533269 2844533157 Bacteria 7517899
263 2874175066 2874168670 Bacteria 8062617
264 2876364887 2876363079 Bacteria 6544991
265 2876815992 2876808645 Bacteria 8824342
266 2879119097 2879110137 Bacteria 8907982
267 2888338034 2888337043 Bacteria 6629336
268 2891562578 2891554331 Bacteria 8812224
269 2903449651 2903448605 Bacteria 7357801
270 2903522377 2903521522 Bacteria 6525694
271 2903528756 2903528002 Bacteria 6586099
272 2937852476 2937848649 Bacteria 6983481
273 2963646343 2963644680 Bacteria 6530403
274 2968087131 2968083720 Bacteria 7351627
275 2977925284 2977922695 Bacteria 6956781
276 3000139319 3000135777 Bacteria 6891109
277 3004217778 3004211236 Bacteria 7417683
278 3004221174 3004218560 Bacteria 7421728
279 637075947 637000159 Bacteria 7596297
280 8006971883 8006964411 Bacteria 8966052
281 Ga0501038_0133009
282 JGI24739J22299_10034888
283 JGI25151J46595_10000193
284 JGI25153J46596_10000047
285 JGI25153J46596_10002272
286 rootH1_10121820
287 JGI25160J50197_1003740
288 Ga0065715_10143014
289 Ga0070658_10140715
290 Ga0068869_100021131
291 Ga0070660_100013330
292 Ga0070691_10123501
293 Ga0070661_100037155
294 Ga0070668_100157743
295 Ga0070668_100189207
296 Ga0070668_100292432
297 Ga0070674_100348553
298 Ga0070709_10018190
299 Ga0070714_100274187
300 Ga0070713_100019148
301 Ga0070708_100007578
302 Ga0070663_100300535
303 Ga0070707_100030098
304 Ga0070707_100067603
305 Ga0070698_100006881
306 Ga0070698_100008685
307 Ga0070698_100171887
308 Ga0070699_100002505
309 Ga0070699_100003766
310 Ga0070699_100028767
311 Ga0070699_100100871
312 Ga0070699_100343008
313 Ga0070684_100171860
314 Ga0070697_100010110
315 Ga0070697_100053282
316 Ga0070696_100056923
317 Ga0070693_100123636
318 Ga0070665_100061709
319 Ga0068855_100339411
320 Ga0070664_100375482
321 Ga0068854_100077766
322 Ga0068856_100183160
323 Ga0068852_100041148
324 Ga0068861_100044559
325 Ga0068861_100102323
326 Ga0068863_100042801
327 Ga0068863_100319913
328 Ga0068858_100079470
329 Ga0068860_100147877
330 Ga0068862_100033418
331 Ga0068862_100036338
332 Ga0081538_10004363
333 Ga0081538_10096492
334 Ga0081540_1018170
335 Ga0081540_1028944
336 Ga0081539_10003448
337 Ga0081539_10057780
338 Ga0070717_10002395
339 Ga0075365_10061186
340 Ga0075368_10006791
341 Ga0075363_100105647
342 Ga0075364_10002231
343 Ga0075362_10003826
344 Ga0075367_10010867
345 Ga0075367_10167345
346 Ga0075369_10000059
347 Ga0075369_10005240
348 Ga0075428_100014634
349 Ga0075431_100006227
350 Ga0075433_10013797
351 Ga0075429_100033724
352 Ga0105240_10226202
353 Ga0111539_10000051
354 Ga0105245_10247109
355 Ga0114129_10298164
356 Ga0114129_10362201
357 Ga0105243_10035002
358 Ga0105248_10305339
359 Ga0105237_10008290
360 Ga0105237_10059598
361 Ga0105237_10111218
362 Ga0105238_10018011
363 Ga0105238_10222456
364 Ga0105033_101433
365 Ga0105239_10070155
366 Ga0105239_10501691
367 Ga0157374_10026042
368 Ga0163162_10025071
369 Ga0163163_10050651
370 Ga0163163_10369492
371 Ga0182008_10012549
372 Ga0157379_10171374
373 Ga0213872_10010966
374 Ga0213872_10022996
375 Ga0213872_10047907
376 Ga0213876_10001432
377 Ga0213875_10047517
378 Ga0213875_10061694
379 Ga0213871_10000345
380 Ga0213871_10002308
381 Ga0209130_1001013
382 Ga0209025_1000061
383 Ga0209758_1000070
384 Ga0209758_1012164
385 Ga0209050_1007079
386 Ga0207426_1000451
387 Ga0209257_1000296
388 Ga0207653_10005399
389 Ga0207642_10144905
390 Ga0207647_10006278
391 Ga0207699_10030489
392 Ga0207695_10102863
393 Ga0207671_10035874
394 Ga0207657_10166532
395 Ga0207646_10031900
396 Ga0207646_10056306
397 Ga0207681_10043689
398 Ga0207700_10174017
399 Ga0207706_10007483
400 Ga0207706_10218931
401 Ga0207709_10076239
402 Ga0207669_10092403
403 Ga0207689_10004859
404 Ga0207679_10163284
405 Ga0207712_10030162
406 Ga0207668_10160137
407 Ga0207678_10022352
408 Ga0207708_10032779
409 Ga0207641_10039658
410 Ga0207675_100003282
411 Ga0207675_100015988
412 Ga0207698_10095226
413 Ga0207428_10003036
414 Ga0268266_10264166
415 Ga0268265_10046375
416 Ga0268265_10101801
417 Ga0268264_10000020
418 Ga0268264_10164886
419 Ga0307517_10160502
420 Ga0307512_10120678
421 Ga0307513_10013449
422 Ga0307513_10225152
423 Ga0307508_10077121
424 Ga0307413_10072095
425 Ga0307410_10069051
426 Ga0373931_0126784
427 Ga0373927_0024800
428 Ga0395905_0363953
429 Ga0436364_0010806
430 Ga0436364_0174801
431 Ga0436364_0302033
432 Ga0400483_029441
433 Ga0436365_0117548
434 Ga0436365_0896091
435 Ga0436365_1889837
436 Ga0436360_0531510
437 Ga0436360_0624224
438 Ga0436360_0827838
439 Ga0436360_0928900
440 Ga0436360_1037802
441 Ga0436361_0492578
442 Ga0436361_0597352
443 Ga0436361_0657024
444 Ga0436361_0668901
445 Ga0436363_1543396
446 Ga0451576_0125004
447 Ga0495625_0103525
448 Ga0495686_0038587
449 Ga0495686_0054083
450 Ga0495602_0073542
451 Ga0496100_0117491
452 Ga0496100_0240723
453 Ga0496102_0079408
454 Ga0496102_0109014
455 Ga0496103_0168557
456 Ga0496105_0174947
457 Ga0496106_0193701
458 Ga0496107_0144696
459 Ga0496107_0217837
460 Ga0496108_0000009
461 Ga0496109_0366114
462 Ga0496110_0043077
463 Ga0496110_0241645
464 Ga0496112_0017248
465 Ga0496113_0351990
466 Ga0496115_0048941
467 Ga0496115_0050524
468 Ga0496119_0051952
469 Ga0496120_0012804
470 Ga0496125_0090844
471 Ga0501034_0081370
472 Ga0501036_0138465
473 Ga0501038_0071625
474 Ga0501038_0191695
475 Ga0501040_0013501
476 Ga0501041_0001664
477 Ga0501042_0068275
478 Ga0501043_0045278
479 Ga0501047_0012129
480 Ga0501068_0023363
481 Ga0501069_0138828
482 Ga0501070_0025909
483 Ga0501072_0087108
484 Ga0501073_0004583
485 Ga0501073_0021467
486 Ga0501074_0005754
487 Ga0501076_0079388
488 Ga0501076_0128687
489 Ga0501077_0064608
490 Ga0501079_0021311
491 Ga0501080_0017182
492 Ga0501080_0064003
493 Ga0501080_0086114
494 Ga0501080_0105501
495 Ga0501081_0007918
496 Ga0501083_0030833
497 Ga0501083_0089586
498 Ga0501035_0100917
499 Ga0501044_0018682
500 Ga0501044_0063587
501 Ga0501044_0098918
502 nmdc:mga03683_89_c1
503 nmdc:mga0k408_1820_c1
504 nmdc:mga04h51_6198_c1
505 nmdc:mga07m45_17953_c1
506 nmdc:mga05p37_124987_c1
507 nmdc:mga06r32_43979_c1
508 nmdc:mga08y16_182827_c1
509 nmdc:mga08y16_237_c1
510 nmdc:mga0a205_3661_c1
511 nmdc:mga0sz30_19469_c2
512 nmdc:mga0sz30_266_c1
513 Ga0500610_0117586
514 Ga0500646_0019639
515 Ga0500651_0004113
516 Ga0500641_0003172
517 Ga0500555_001335
518 Ga0500556_0000368
519 Ga0500569_038343
520 Ga0500595_011357
521 Ga0500658_0032426
522 Ga0500658_0065670
523 Ga0500577_0015564
524 Ga0500577_0052928
525 Ga0500588_0004841
526 Ga0500588_0020438
527 Ga0500604_0002263
528 Ga0500616_0000355
529 Ga0500627_0000890
530 Ga0500636_0014750
531 Ga0500611_003350
532 Ga0500609_000801
533 Ga0500609_006447
534 Ga0501082_0000953
535 Ga0501082_0321554
536 Ga0530510_0040701
537 2512932863
538 2513608974
539 2588518919
540 2792748274
541 2821450901
542 2844533269
543 2874175066
544 2876364887
545 2876815992
546 2879119097
547 2888338034
548 2891562578
549 2903449651
550 2903522377
551 2903528756
552 2937852476
553 2963646343
554 2968087131
555 2977925284
556 3000139319
557 3004217778
558 3004221174
559 637075947
560 8006971883

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

19

162

0.94

PF08402

TOBE_2

TOBE domain

291

362

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.942 4 233
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9397 1 233
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9396 4 217
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.939 4 212
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9367 1 217
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.981 4 217 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9752 3 216 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 4 234 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9668 4 238 3.40.50.300
2awnC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9637 3 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M1A2L0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9867 1 208 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060
AF-A0A2E7V6G1-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9816 4 216 GO:0005524
GO:0016887
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9803 49 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A371MRW7-F1-model_v4 ABC transporter ATP-binding protein 0.978 62 149 GO:0005524
GO:0016887
GO:0055052
AF-A0A3M1A2L0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9774 1 208 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060

Map