F383918
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 210 | 560 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300049574|Ga0501038_0133009|Ga0501038_0133009_502_1617 |
| Length | 371 |
| Sequence | MSTIALDKLTKVFGDLTAVDRVDLNVEAGEVVCLLGPSGCGKTTTLRMIAGLEYPTAGDIRIAGRRVNHLAPRDRDVAMVFQFYALYPTLTVAENLAYPLHAERMGAAEIAARVRRVSATLHLDEVLDRRPGQLAEGERQRVAVGRAIIRDPSCFLFDEPLSRLDVQLREEMRGQIKEVLAGLAKATVIVTHDQLEALTMADRIAVMRDGLIEQCASPHEIFARPANRFVAGFIGTPQMNLIPAVLDGSADCGVRGADAEGMMRFRIDSESIVLRVDPAVGRLPPDSSVTLGIRPRSVELVGEPQSDSLSADVDLVEPMGAETLLHVVGPGRELRIVVDQHVAAHVGERLHLRFKPGQTHVFGSDERRVSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 44 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 45 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 71 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 72 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 105 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 114 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 117 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 118 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 125 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 126 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 127 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 128 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 129 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 132 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 133 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 134 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 135 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 136 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 137 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 138 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 160 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 161 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 162 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 163 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 168 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 169 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 170 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 171 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 172 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 173 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 174 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 175 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 176 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 177 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 178 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 179 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 180 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 181 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 182 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 183 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 184 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 185 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 187 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 188 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 189 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 190 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 191 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 192 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 193 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 194 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 195 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 196 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 197 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 198 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 199 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 200 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 201 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 202 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 203 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 204 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 205 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 206 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 207 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 208 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 209 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 210 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.43 |
| Metatranscriptomes | 0 |
| Isolates | 8.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.79 |
| Nodule | 3.93 |
| Rhizoplane | 6.07 |
| Rhizosphere | 61.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501038_0133009 | 3300049574 | Bacteria | 2040 |
| 2 | JGI24739J22299_10034888 | 3300001989 | Bacteria | 1710 |
| 3 | JGI25151J46595_10000193 | 3300003187 | Bacteria | 75098 |
| 4 | JGI25153J46596_10000047 | 3300003215 | Bacteria | 146400 |
| 5 | JGI25153J46596_10002272 | 3300003215 | Bacteria | 11198 |
| 6 | rootH1_10121820 | 3300003316 | Bacteria | 1381 |
| 7 | JGI25160J50197_1003740 | 3300003354 | Bacteria | 6706 |
| 8 | Ga0065715_10143014 | 3300005293 | Bacteria | 1824 |
| 9 | Ga0070658_10140715 | 3300005327 | Bacteria | 2016 |
| 10 | Ga0068869_100021131 | 3300005334 | Bacteria | 4474 |
| 11 | Ga0070660_100013330 | 3300005339 | Bacteria | 5893 |
| 12 | Ga0070691_10123501 | 3300005341 | Bacteria | 1306 |
| 13 | Ga0070661_100037155 | 3300005344 | Bacteria | 3543 |
| 14 | Ga0070668_100157743 | 3300005347 | Bacteria | 1839 |
| 15 | Ga0070668_100189207 | 3300005347 | Bacteria | 1685 |
| 16 | Ga0070668_100292432 | 3300005347 | Bacteria | 1364 |
| 17 | Ga0070674_100348553 | 3300005356 | Bacteria | 1195 |
| 18 | Ga0070709_10018190 | 3300005434 | Bacteria | 4043 |
| 19 | Ga0070714_100274187 | 3300005435 | Bacteria | 1565 |
| 20 | Ga0070713_100019148 | 3300005436 | Bacteria | 5217 |
| 21 | Ga0070708_100007578 | 3300005445 | Bacteria | 8689 |
| 22 | Ga0070663_100300535 | 3300005455 | Bacteria | 1285 |
| 23 | Ga0070707_100030098 | 3300005468 | Bacteria | 5165 |
| 24 | Ga0070707_100067603 | 3300005468 | Bacteria | 3438 |
| 25 | Ga0070698_100006881 | 3300005471 | Bacteria | 12319 |
| 26 | Ga0070698_100008685 | 3300005471 | Bacteria | 10945 |
| 27 | Ga0070698_100171887 | 3300005471 | Bacteria | 2107 |
| 28 | Ga0070699_100002505 | 3300005518 | Bacteria | 16490 |
| 29 | Ga0070699_100003766 | 3300005518 | Bacteria | 13408 |
| 30 | Ga0070699_100028767 | 3300005518 | Bacteria | 4792 |
| 31 | Ga0070699_100100871 | 3300005518 | Bacteria | 2530 |
| 32 | Ga0070699_100343008 | 3300005518 | Bacteria | 1345 |
| 33 | Ga0070684_100171860 | 3300005535 | Bacteria | 1968 |
| 34 | Ga0070697_100010110 | 3300005536 | Bacteria | 7360 |
| 35 | Ga0070697_100053282 | 3300005536 | Bacteria | 3288 |
| 36 | Ga0070696_100056923 | 3300005546 | Bacteria | 2728 |
| 37 | Ga0070693_100123636 | 3300005547 | Bacteria | 1608 |
| 38 | Ga0070665_100061709 | 3300005548 | Bacteria | 3758 |
| 39 | Ga0068855_100339411 | 3300005563 | Bacteria | 1657 |
| 40 | Ga0070664_100375482 | 3300005564 | Bacteria | 1297 |
| 41 | Ga0068854_100077766 | 3300005578 | Bacteria | 2442 |
| 42 | Ga0068856_100183160 | 3300005614 | Bacteria | 2108 |
| 43 | Ga0068852_100041148 | 3300005616 | Bacteria | 3903 |
| 44 | Ga0068861_100044559 | 3300005719 | Bacteria | 3336 |
| 45 | Ga0068861_100102323 | 3300005719 | Bacteria | 2280 |
| 46 | Ga0068863_100042801 | 3300005841 | Bacteria | 4302 |
| 47 | Ga0068863_100319913 | 3300005841 | Bacteria | 1507 |
| 48 | Ga0068858_100079470 | 3300005842 | Bacteria | 3048 |
| 49 | Ga0068860_100147877 | 3300005843 | Bacteria | 2261 |
| 50 | Ga0068862_100033418 | 3300005844 | Bacteria | 4348 |
| 51 | Ga0068862_100036338 | 3300005844 | Bacteria | 4176 |
| 52 | Ga0081538_10004363 | 3300005981 | Bacteria | 13069 |
| 53 | Ga0081538_10096492 | 3300005981 | Bacteria | 1506 |
| 54 | Ga0081540_1018170 | 3300005983 | Bacteria | 4325 |
| 55 | Ga0081540_1028944 | 3300005983 | Bacteria | 3098 |
| 56 | Ga0081539_10003448 | 3300005985 | Bacteria | 19419 |
| 57 | Ga0081539_10057780 | 3300005985 | Bacteria | 2144 |
| 58 | Ga0070717_10002395 | 3300006028 | Bacteria | 13222 |
| 59 | Ga0075365_10061186 | 3300006038 | Bacteria | 2514 |
| 60 | Ga0075368_10006791 | 3300006042 | Bacteria | 4019 |
| 61 | Ga0075363_100105647 | 3300006048 | Bacteria | 1561 |
| 62 | Ga0075364_10002231 | 3300006051 | Bacteria | 10866 |
| 63 | Ga0075362_10003826 | 3300006177 | Bacteria | 5337 |
| 64 | Ga0075367_10010867 | 3300006178 | Bacteria | 4797 |
| 65 | Ga0075367_10167345 | 3300006178 | Bacteria | 1368 |
| 66 | Ga0075369_10000059 | 3300006186 | Bacteria | 28189 |
| 67 | Ga0075369_10005240 | 3300006186 | Bacteria | 4833 |
| 68 | Ga0075428_100014634 | 3300006844 | Bacteria | 8712 |
| 69 | Ga0075431_100006227 | 3300006847 | Bacteria | 11850 |
| 70 | Ga0075433_10013797 | 3300006852 | Bacteria | 6584 |
| 71 | Ga0075429_100033724 | 3300006880 | Bacteria | 4449 |
| 72 | Ga0105240_10226202 | 3300009093 | Bacteria | 2177 |
| 73 | Ga0111539_10000051 | 3300009094 | Bacteria | 117607 |
| 74 | Ga0105245_10247109 | 3300009098 | Bacteria | 1732 |
| 75 | Ga0114129_10298164 | 3300009147 | Bacteria | 2149 |
| 76 | Ga0114129_10362201 | 3300009147 | Bacteria | 1918 |
| 77 | Ga0105243_10035002 | 3300009148 | Bacteria | 3892 |
| 78 | Ga0105248_10305339 | 3300009177 | Bacteria | 1792 |
| 79 | Ga0105237_10008290 | 3300009545 | Bacteria | 11282 |
| 80 | Ga0105237_10059598 | 3300009545 | Bacteria | 3819 |
| 81 | Ga0105237_10111218 | 3300009545 | Bacteria | 2731 |
| 82 | Ga0105238_10018011 | 3300009551 | Bacteria | 7181 |
| 83 | Ga0105238_10222456 | 3300009551 | Bacteria | 1864 |
| 84 | Ga0105033_101433 | 3300009986 | Bacteria | 1948 |
| 85 | Ga0105239_10070155 | 3300010375 | Bacteria | 3849 |
| 86 | Ga0105239_10501691 | 3300010375 | Bacteria | 1380 |
| 87 | Ga0157374_10026042 | 3300013296 | Bacteria | 5258 |
| 88 | Ga0163162_10025071 | 3300013306 | Bacteria | 5893 |
| 89 | Ga0163163_10050651 | 3300014325 | Bacteria | 4090 |
| 90 | Ga0163163_10369492 | 3300014325 | Bacteria | 1491 |
| 91 | Ga0182008_10012549 | 3300014497 | Bacteria | 4472 |
| 92 | Ga0157379_10171374 | 3300014968 | Bacteria | 1959 |
| 93 | Ga0213872_10010966 | 3300021361 | Bacteria | 4299 |
| 94 | Ga0213872_10022996 | 3300021361 | Bacteria | 2868 |
| 95 | Ga0213872_10047907 | 3300021361 | Bacteria | 1942 |
| 96 | Ga0213876_10001432 | 3300021384 | Bacteria | 14863 |
| 97 | Ga0213875_10047517 | 3300021388 | Bacteria | 2014 |
| 98 | Ga0213875_10061694 | 3300021388 | Bacteria | 1754 |
| 99 | Ga0213871_10000345 | 3300021441 | Bacteria | 5972 |
| 100 | Ga0213871_10002308 | 3300021441 | Bacteria | 3486 |
| 101 | Ga0209130_1001013 | 3300025284 | Bacteria | 21788 |
| 102 | Ga0209025_1000061 | 3300025294 | Bacteria | 304827 |
| 103 | Ga0209758_1000070 | 3300025297 | Bacteria | 284093 |
| 104 | Ga0209758_1012164 | 3300025297 | Bacteria | 4856 |
| 105 | Ga0209050_1007079 | 3300025298 | Bacteria | 6421 |
| 106 | Ga0207426_1000451 | 3300025302 | Bacteria | 65459 |
| 107 | Ga0209257_1000296 | 3300025304 | Bacteria | 109517 |
| 108 | Ga0207653_10005399 | 3300025885 | Bacteria | 3997 |
| 109 | Ga0207642_10144905 | 3300025899 | Bacteria | 1257 |
| 110 | Ga0207647_10006278 | 3300025904 | Bacteria | 8654 |
| 111 | Ga0207699_10030489 | 3300025906 | Bacteria | 3019 |
| 112 | Ga0207695_10102863 | 3300025913 | Bacteria | 2849 |
| 113 | Ga0207671_10035874 | 3300025914 | Bacteria | 3677 |
| 114 | Ga0207657_10166532 | 3300025919 | Bacteria | 1787 |
| 115 | Ga0207646_10031900 | 3300025922 | Bacteria | 4769 |
| 116 | Ga0207646_10056306 | 3300025922 | Bacteria | 3515 |
| 117 | Ga0207681_10043689 | 3300025923 | Bacteria | 3001 |
| 118 | Ga0207700_10174017 | 3300025928 | Bacteria | 1798 |
| 119 | Ga0207706_10007483 | 3300025933 | Bacteria | 10098 |
| 120 | Ga0207706_10218931 | 3300025933 | Bacteria | 1667 |
| 121 | Ga0207709_10076239 | 3300025935 | Bacteria | 2146 |
| 122 | Ga0207669_10092403 | 3300025937 | Bacteria | 1974 |
| 123 | Ga0207689_10004859 | 3300025942 | Bacteria | 12111 |
| 124 | Ga0207679_10163284 | 3300025945 | Bacteria | 1826 |
| 125 | Ga0207712_10030162 | 3300025961 | Bacteria | 3644 |
| 126 | Ga0207668_10160137 | 3300025972 | Bacteria | 1753 |
| 127 | Ga0207678_10022352 | 3300026067 | Bacteria | 5541 |
| 128 | Ga0207708_10032779 | 3300026075 | Bacteria | 3944 |
| 129 | Ga0207641_10039658 | 3300026088 | Bacteria | 3940 |
| 130 | Ga0207675_100003282 | 3300026118 | Bacteria | 15845 |
| 131 | Ga0207675_100015988 | 3300026118 | Bacteria | 7004 |
| 132 | Ga0207698_10095226 | 3300026142 | Bacteria | 2450 |
| 133 | Ga0207428_10003036 | 3300027907 | Bacteria | 16519 |
| 134 | Ga0268266_10264166 | 3300028379 | Bacteria | 1596 |
| 135 | Ga0268265_10046375 | 3300028380 | Bacteria | 3248 |
| 136 | Ga0268265_10101801 | 3300028380 | Bacteria | 2321 |
| 137 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 138 | Ga0268264_10164886 | 3300028381 | Bacteria | 1999 |
| 139 | Ga0307517_10160502 | 3300028786 | Bacteria | 1511 |
| 140 | Ga0307512_10120678 | 3300030522 | Bacteria | 1686 |
| 141 | Ga0307513_10013449 | 3300031456 | Bacteria | 10040 |
| 142 | Ga0307513_10225152 | 3300031456 | Bacteria | 1693 |
| 143 | Ga0307508_10077121 | 3300031616 | Bacteria | 2911 |
| 144 | Ga0307413_10072095 | 3300031824 | Bacteria | 2179 |
| 145 | Ga0307410_10069051 | 3300031852 | Bacteria | 2443 |
| 146 | Ga0373931_0126784 | 3300035691 | Bacteria | 1465 |
| 147 | Ga0373927_0024800 | 3300035695 | Bacteria | 3919 |
| 148 | Ga0395905_0363953 | 3300037471 | Bacteria | 1339 |
| 149 | Ga0436364_0010806 | 3300037853 | Bacteria | 2392 |
| 150 | Ga0436364_0174801 | 3300037853 | Bacteria | 6251 |
| 151 | Ga0436364_0302033 | 3300037853 | Bacteria | 9589 |
| 152 | Ga0400483_029441 | 3300039062 | Bacteria | 7342 |
| 153 | Ga0436365_0117548 | 3300039437 | Bacteria | 62327 |
| 154 | Ga0436365_0896091 | 3300039437 | Bacteria | 1879 |
| 155 | Ga0436365_1889837 | 3300039437 | Bacteria | 134049 |
| 156 | Ga0436360_0531510 | 3300039438 | Bacteria | 12504 |
| 157 | Ga0436360_0624224 | 3300039438 | Bacteria | 2014 |
| 158 | Ga0436360_0827838 | 3300039438 | Bacteria | 1846 |
| 159 | Ga0436360_0928900 | 3300039438 | Bacteria | 4688 |
| 160 | Ga0436360_1037802 | 3300039438 | Bacteria | 4081 |
| 161 | Ga0436361_0492578 | 3300039447 | Bacteria | 3921 |
| 162 | Ga0436361_0597352 | 3300039447 | Bacteria | 1717 |
| 163 | Ga0436361_0657024 | 3300039447 | Bacteria | 4054 |
| 164 | Ga0436361_0668901 | 3300039447 | Bacteria | 11621 |
| 165 | Ga0436363_1543396 | 3300039450 | Bacteria | 20579 |
| 166 | Ga0451576_0125004 | 3300045051 | Bacteria | 2680 |
| 167 | Ga0495625_0103525 | 3300046660 | Bacteria | 1952 |
| 168 | Ga0495686_0038587 | 3300047472 | Bacteria | 3054 |
| 169 | Ga0495686_0054083 | 3300047472 | Bacteria | 2515 |
| 170 | Ga0495602_0073542 | 3300048088 | Bacteria | 2909 |
| 171 | Ga0496100_0117491 | 3300048903 | Bacteria | 1857 |
| 172 | Ga0496100_0240723 | 3300048903 | Bacteria | 1335 |
| 173 | Ga0496102_0079408 | 3300048905 | Bacteria | 3022 |
| 174 | Ga0496102_0109014 | 3300048905 | Bacteria | 2580 |
| 175 | Ga0496103_0168557 | 3300048906 | Bacteria | 1405 |
| 176 | Ga0496105_0174947 | 3300048908 | Bacteria | 1758 |
| 177 | Ga0496106_0193701 | 3300048909 | Bacteria | 1616 |
| 178 | Ga0496107_0144696 | 3300048910 | Bacteria | 1757 |
| 179 | Ga0496107_0217837 | 3300048910 | Bacteria | 1420 |
| 180 | Ga0496108_0000009 | 3300048911 | Bacteria | 276390 |
| 181 | Ga0496109_0366114 | 3300048912 | Bacteria | 1362 |
| 182 | Ga0496110_0043077 | 3300048913 | Bacteria | 3941 |
| 183 | Ga0496110_0241645 | 3300048913 | Bacteria | 1643 |
| 184 | Ga0496112_0017248 | 3300048915 | Bacteria | 6780 |
| 185 | Ga0496113_0351990 | 3300048916 | Bacteria | 1182 |
| 186 | Ga0496115_0048941 | 3300048918 | Bacteria | 3382 |
| 187 | Ga0496115_0050524 | 3300048918 | Bacteria | 3331 |
| 188 | Ga0496119_0051952 | 3300048922 | Bacteria | 2514 |
| 189 | Ga0496120_0012804 | 3300048923 | Bacteria | 5684 |
| 190 | Ga0496125_0090844 | 3300048928 | Bacteria | 2290 |
| 191 | Ga0501034_0081370 | 3300049571 | Bacteria | 3241 |
| 192 | Ga0501036_0138465 | 3300049572 | Bacteria | 2054 |
| 193 | Ga0501038_0071625 | 3300049574 | Bacteria | 2940 |
| 194 | Ga0501038_0191695 | 3300049574 | Bacteria | 1644 |
| 195 | Ga0501040_0013501 | 3300049576 | Bacteria | 5369 |
| 196 | Ga0501041_0001664 | 3300049577 | Bacteria | 12444 |
| 197 | Ga0501042_0068275 | 3300049578 | Bacteria | 2542 |
| 198 | Ga0501043_0045278 | 3300049579 | Bacteria | 3460 |
| 199 | Ga0501047_0012129 | 3300049581 | Bacteria | 8158 |
| 200 | Ga0501068_0023363 | 3300049584 | Bacteria | 3622 |
| 201 | Ga0501069_0138828 | 3300049585 | Bacteria | 1394 |
| 202 | Ga0501070_0025909 | 3300049586 | Bacteria | 4920 |
| 203 | Ga0501072_0087108 | 3300049588 | Bacteria | 2478 |
| 204 | Ga0501073_0004583 | 3300049589 | Bacteria | 10387 |
| 205 | Ga0501073_0021467 | 3300049589 | Bacteria | 4655 |
| 206 | Ga0501074_0005754 | 3300049590 | Bacteria | 8937 |
| 207 | Ga0501076_0079388 | 3300049592 | Bacteria | 2633 |
| 208 | Ga0501076_0128687 | 3300049592 | Bacteria | 2053 |
| 209 | Ga0501077_0064608 | 3300049593 | Bacteria | 2321 |
| 210 | Ga0501079_0021311 | 3300049741 | Bacteria | 4956 |
| 211 | Ga0501080_0017182 | 3300049742 | Bacteria | 6683 |
| 212 | Ga0501080_0064003 | 3300049742 | Bacteria | 3422 |
| 213 | Ga0501080_0086114 | 3300049742 | Bacteria | 2919 |
| 214 | Ga0501080_0105501 | 3300049742 | Bacteria | 2613 |
| 215 | Ga0501081_0007918 | 3300049743 | Bacteria | 6893 |
| 216 | Ga0501083_0030833 | 3300049744 | Bacteria | 3680 |
| 217 | Ga0501083_0089586 | 3300049744 | Bacteria | 2033 |
| 218 | Ga0501035_0100917 | 3300049822 | Bacteria | 2533 |
| 219 | Ga0501044_0018682 | 3300049823 | Bacteria | 7425 |
| 220 | Ga0501044_0063587 | 3300049823 | Bacteria | 3769 |
| 221 | Ga0501044_0098918 | 3300049823 | Bacteria | 2936 |
| 222 | nmdc:mga03683_89_c1 | 3300050489 | Bacteria | 33351 |
| 223 | nmdc:mga0k408_1820_c1 | 3300050493 | Bacteria | 11438 |
| 224 | nmdc:mga04h51_6198_c1 | 3300050495 | Bacteria | 3088 |
| 225 | nmdc:mga07m45_17953_c1 | 3300050496 | Bacteria | 3808 |
| 226 | nmdc:mga05p37_124987_c1 | 3300050507 | Bacteria | 3159 |
| 227 | nmdc:mga06r32_43979_c1 | 3300050510 | Bacteria | 4251 |
| 228 | nmdc:mga08y16_182827_c1 | 3300050511 | Bacteria | 2176 |
| 229 | nmdc:mga08y16_237_c1 | 3300050511 | Bacteria | 49310 |
| 230 | nmdc:mga0a205_3661_c1 | 3300050515 | Bacteria | 13766 |
| 231 | nmdc:mga0sz30_19469_c2 | 3300050516 | Bacteria | 2337 |
| 232 | nmdc:mga0sz30_266_c1 | 3300050516 | Bacteria | 20024 |
| 233 | Ga0500610_0117586 | 3300053079 | Bacteria | 1362 |
| 234 | Ga0500646_0019639 | 3300053090 | Bacteria | 1789 |
| 235 | Ga0500651_0004113 | 3300053093 | Bacteria | 8105 |
| 236 | Ga0500641_0003172 | 3300053096 | Bacteria | 5817 |
| 237 | Ga0500555_001335 | 3300053103 | Bacteria | 7741 |
| 238 | Ga0500556_0000368 | 3300053104 | Bacteria | 33053 |
| 239 | Ga0500569_038343 | 3300053109 | Bacteria | 1390 |
| 240 | Ga0500595_011357 | 3300053119 | Bacteria | 3491 |
| 241 | Ga0500658_0032426 | 3300053134 | Bacteria | 2049 |
| 242 | Ga0500658_0065670 | 3300053134 | Bacteria | 1520 |
| 243 | Ga0500577_0015564 | 3300053142 | Bacteria | 2378 |
| 244 | Ga0500577_0052928 | 3300053142 | Bacteria | 1532 |
| 245 | Ga0500588_0004841 | 3300053146 | Bacteria | 2944 |
| 246 | Ga0500588_0020438 | 3300053146 | Bacteria | 1774 |
| 247 | Ga0500604_0002263 | 3300053151 | Bacteria | 5265 |
| 248 | Ga0500616_0000355 | 3300053153 | Bacteria | 65385 |
| 249 | Ga0500627_0000890 | 3300053158 | Bacteria | 8003 |
| 250 | Ga0500636_0014750 | 3300053177 | Bacteria | 4598 |
| 251 | Ga0500611_003350 | 3300053727 | Bacteria | 2042 |
| 252 | Ga0500609_000801 | 3300053731 | Bacteria | 4721 |
| 253 | Ga0500609_006447 | 3300053731 | Bacteria | 1599 |
| 254 | Ga0501082_0000953 | 3300060353 | Bacteria | 25552 |
| 255 | Ga0501082_0321554 | 3300060353 | Bacteria | 1348 |
| 256 | Ga0530510_0040701 | 3300061734 | Bacteria | 3354 |
| 257 | 2512932863 | 2512875016 | Bacteria | 6529530 |
| 258 | 2513608974 | 2513237090 | Bacteria | 7096802 |
| 259 | 2588518919 | 2588253730 | Bacteria | 6881675 |
| 260 | 2792748274 | 2791355123 | Bacteria | 8049106 |
| 261 | 2821450901 | 2821443989 | Bacteria | 7658172 |
| 262 | 2844533269 | 2844533157 | Bacteria | 7517899 |
| 263 | 2874175066 | 2874168670 | Bacteria | 8062617 |
| 264 | 2876364887 | 2876363079 | Bacteria | 6544991 |
| 265 | 2876815992 | 2876808645 | Bacteria | 8824342 |
| 266 | 2879119097 | 2879110137 | Bacteria | 8907982 |
| 267 | 2888338034 | 2888337043 | Bacteria | 6629336 |
| 268 | 2891562578 | 2891554331 | Bacteria | 8812224 |
| 269 | 2903449651 | 2903448605 | Bacteria | 7357801 |
| 270 | 2903522377 | 2903521522 | Bacteria | 6525694 |
| 271 | 2903528756 | 2903528002 | Bacteria | 6586099 |
| 272 | 2937852476 | 2937848649 | Bacteria | 6983481 |
| 273 | 2963646343 | 2963644680 | Bacteria | 6530403 |
| 274 | 2968087131 | 2968083720 | Bacteria | 7351627 |
| 275 | 2977925284 | 2977922695 | Bacteria | 6956781 |
| 276 | 3000139319 | 3000135777 | Bacteria | 6891109 |
| 277 | 3004217778 | 3004211236 | Bacteria | 7417683 |
| 278 | 3004221174 | 3004218560 | Bacteria | 7421728 |
| 279 | 637075947 | 637000159 | Bacteria | 7596297 |
| 280 | 8006971883 | 8006964411 | Bacteria | 8966052 |
| 281 | Ga0501038_0133009 | |||
| 282 | JGI24739J22299_10034888 | |||
| 283 | JGI25151J46595_10000193 | |||
| 284 | JGI25153J46596_10000047 | |||
| 285 | JGI25153J46596_10002272 | |||
| 286 | rootH1_10121820 | |||
| 287 | JGI25160J50197_1003740 | |||
| 288 | Ga0065715_10143014 | |||
| 289 | Ga0070658_10140715 | |||
| 290 | Ga0068869_100021131 | |||
| 291 | Ga0070660_100013330 | |||
| 292 | Ga0070691_10123501 | |||
| 293 | Ga0070661_100037155 | |||
| 294 | Ga0070668_100157743 | |||
| 295 | Ga0070668_100189207 | |||
| 296 | Ga0070668_100292432 | |||
| 297 | Ga0070674_100348553 | |||
| 298 | Ga0070709_10018190 | |||
| 299 | Ga0070714_100274187 | |||
| 300 | Ga0070713_100019148 | |||
| 301 | Ga0070708_100007578 | |||
| 302 | Ga0070663_100300535 | |||
| 303 | Ga0070707_100030098 | |||
| 304 | Ga0070707_100067603 | |||
| 305 | Ga0070698_100006881 | |||
| 306 | Ga0070698_100008685 | |||
| 307 | Ga0070698_100171887 | |||
| 308 | Ga0070699_100002505 | |||
| 309 | Ga0070699_100003766 | |||
| 310 | Ga0070699_100028767 | |||
| 311 | Ga0070699_100100871 | |||
| 312 | Ga0070699_100343008 | |||
| 313 | Ga0070684_100171860 | |||
| 314 | Ga0070697_100010110 | |||
| 315 | Ga0070697_100053282 | |||
| 316 | Ga0070696_100056923 | |||
| 317 | Ga0070693_100123636 | |||
| 318 | Ga0070665_100061709 | |||
| 319 | Ga0068855_100339411 | |||
| 320 | Ga0070664_100375482 | |||
| 321 | Ga0068854_100077766 | |||
| 322 | Ga0068856_100183160 | |||
| 323 | Ga0068852_100041148 | |||
| 324 | Ga0068861_100044559 | |||
| 325 | Ga0068861_100102323 | |||
| 326 | Ga0068863_100042801 | |||
| 327 | Ga0068863_100319913 | |||
| 328 | Ga0068858_100079470 | |||
| 329 | Ga0068860_100147877 | |||
| 330 | Ga0068862_100033418 | |||
| 331 | Ga0068862_100036338 | |||
| 332 | Ga0081538_10004363 | |||
| 333 | Ga0081538_10096492 | |||
| 334 | Ga0081540_1018170 | |||
| 335 | Ga0081540_1028944 | |||
| 336 | Ga0081539_10003448 | |||
| 337 | Ga0081539_10057780 | |||
| 338 | Ga0070717_10002395 | |||
| 339 | Ga0075365_10061186 | |||
| 340 | Ga0075368_10006791 | |||
| 341 | Ga0075363_100105647 | |||
| 342 | Ga0075364_10002231 | |||
| 343 | Ga0075362_10003826 | |||
| 344 | Ga0075367_10010867 | |||
| 345 | Ga0075367_10167345 | |||
| 346 | Ga0075369_10000059 | |||
| 347 | Ga0075369_10005240 | |||
| 348 | Ga0075428_100014634 | |||
| 349 | Ga0075431_100006227 | |||
| 350 | Ga0075433_10013797 | |||
| 351 | Ga0075429_100033724 | |||
| 352 | Ga0105240_10226202 | |||
| 353 | Ga0111539_10000051 | |||
| 354 | Ga0105245_10247109 | |||
| 355 | Ga0114129_10298164 | |||
| 356 | Ga0114129_10362201 | |||
| 357 | Ga0105243_10035002 | |||
| 358 | Ga0105248_10305339 | |||
| 359 | Ga0105237_10008290 | |||
| 360 | Ga0105237_10059598 | |||
| 361 | Ga0105237_10111218 | |||
| 362 | Ga0105238_10018011 | |||
| 363 | Ga0105238_10222456 | |||
| 364 | Ga0105033_101433 | |||
| 365 | Ga0105239_10070155 | |||
| 366 | Ga0105239_10501691 | |||
| 367 | Ga0157374_10026042 | |||
| 368 | Ga0163162_10025071 | |||
| 369 | Ga0163163_10050651 | |||
| 370 | Ga0163163_10369492 | |||
| 371 | Ga0182008_10012549 | |||
| 372 | Ga0157379_10171374 | |||
| 373 | Ga0213872_10010966 | |||
| 374 | Ga0213872_10022996 | |||
| 375 | Ga0213872_10047907 | |||
| 376 | Ga0213876_10001432 | |||
| 377 | Ga0213875_10047517 | |||
| 378 | Ga0213875_10061694 | |||
| 379 | Ga0213871_10000345 | |||
| 380 | Ga0213871_10002308 | |||
| 381 | Ga0209130_1001013 | |||
| 382 | Ga0209025_1000061 | |||
| 383 | Ga0209758_1000070 | |||
| 384 | Ga0209758_1012164 | |||
| 385 | Ga0209050_1007079 | |||
| 386 | Ga0207426_1000451 | |||
| 387 | Ga0209257_1000296 | |||
| 388 | Ga0207653_10005399 | |||
| 389 | Ga0207642_10144905 | |||
| 390 | Ga0207647_10006278 | |||
| 391 | Ga0207699_10030489 | |||
| 392 | Ga0207695_10102863 | |||
| 393 | Ga0207671_10035874 | |||
| 394 | Ga0207657_10166532 | |||
| 395 | Ga0207646_10031900 | |||
| 396 | Ga0207646_10056306 | |||
| 397 | Ga0207681_10043689 | |||
| 398 | Ga0207700_10174017 | |||
| 399 | Ga0207706_10007483 | |||
| 400 | Ga0207706_10218931 | |||
| 401 | Ga0207709_10076239 | |||
| 402 | Ga0207669_10092403 | |||
| 403 | Ga0207689_10004859 | |||
| 404 | Ga0207679_10163284 | |||
| 405 | Ga0207712_10030162 | |||
| 406 | Ga0207668_10160137 | |||
| 407 | Ga0207678_10022352 | |||
| 408 | Ga0207708_10032779 | |||
| 409 | Ga0207641_10039658 | |||
| 410 | Ga0207675_100003282 | |||
| 411 | Ga0207675_100015988 | |||
| 412 | Ga0207698_10095226 | |||
| 413 | Ga0207428_10003036 | |||
| 414 | Ga0268266_10264166 | |||
| 415 | Ga0268265_10046375 | |||
| 416 | Ga0268265_10101801 | |||
| 417 | Ga0268264_10000020 | |||
| 418 | Ga0268264_10164886 | |||
| 419 | Ga0307517_10160502 | |||
| 420 | Ga0307512_10120678 | |||
| 421 | Ga0307513_10013449 | |||
| 422 | Ga0307513_10225152 | |||
| 423 | Ga0307508_10077121 | |||
| 424 | Ga0307413_10072095 | |||
| 425 | Ga0307410_10069051 | |||
| 426 | Ga0373931_0126784 | |||
| 427 | Ga0373927_0024800 | |||
| 428 | Ga0395905_0363953 | |||
| 429 | Ga0436364_0010806 | |||
| 430 | Ga0436364_0174801 | |||
| 431 | Ga0436364_0302033 | |||
| 432 | Ga0400483_029441 | |||
| 433 | Ga0436365_0117548 | |||
| 434 | Ga0436365_0896091 | |||
| 435 | Ga0436365_1889837 | |||
| 436 | Ga0436360_0531510 | |||
| 437 | Ga0436360_0624224 | |||
| 438 | Ga0436360_0827838 | |||
| 439 | Ga0436360_0928900 | |||
| 440 | Ga0436360_1037802 | |||
| 441 | Ga0436361_0492578 | |||
| 442 | Ga0436361_0597352 | |||
| 443 | Ga0436361_0657024 | |||
| 444 | Ga0436361_0668901 | |||
| 445 | Ga0436363_1543396 | |||
| 446 | Ga0451576_0125004 | |||
| 447 | Ga0495625_0103525 | |||
| 448 | Ga0495686_0038587 | |||
| 449 | Ga0495686_0054083 | |||
| 450 | Ga0495602_0073542 | |||
| 451 | Ga0496100_0117491 | |||
| 452 | Ga0496100_0240723 | |||
| 453 | Ga0496102_0079408 | |||
| 454 | Ga0496102_0109014 | |||
| 455 | Ga0496103_0168557 | |||
| 456 | Ga0496105_0174947 | |||
| 457 | Ga0496106_0193701 | |||
| 458 | Ga0496107_0144696 | |||
| 459 | Ga0496107_0217837 | |||
| 460 | Ga0496108_0000009 | |||
| 461 | Ga0496109_0366114 | |||
| 462 | Ga0496110_0043077 | |||
| 463 | Ga0496110_0241645 | |||
| 464 | Ga0496112_0017248 | |||
| 465 | Ga0496113_0351990 | |||
| 466 | Ga0496115_0048941 | |||
| 467 | Ga0496115_0050524 | |||
| 468 | Ga0496119_0051952 | |||
| 469 | Ga0496120_0012804 | |||
| 470 | Ga0496125_0090844 | |||
| 471 | Ga0501034_0081370 | |||
| 472 | Ga0501036_0138465 | |||
| 473 | Ga0501038_0071625 | |||
| 474 | Ga0501038_0191695 | |||
| 475 | Ga0501040_0013501 | |||
| 476 | Ga0501041_0001664 | |||
| 477 | Ga0501042_0068275 | |||
| 478 | Ga0501043_0045278 | |||
| 479 | Ga0501047_0012129 | |||
| 480 | Ga0501068_0023363 | |||
| 481 | Ga0501069_0138828 | |||
| 482 | Ga0501070_0025909 | |||
| 483 | Ga0501072_0087108 | |||
| 484 | Ga0501073_0004583 | |||
| 485 | Ga0501073_0021467 | |||
| 486 | Ga0501074_0005754 | |||
| 487 | Ga0501076_0079388 | |||
| 488 | Ga0501076_0128687 | |||
| 489 | Ga0501077_0064608 | |||
| 490 | Ga0501079_0021311 | |||
| 491 | Ga0501080_0017182 | |||
| 492 | Ga0501080_0064003 | |||
| 493 | Ga0501080_0086114 | |||
| 494 | Ga0501080_0105501 | |||
| 495 | Ga0501081_0007918 | |||
| 496 | Ga0501083_0030833 | |||
| 497 | Ga0501083_0089586 | |||
| 498 | Ga0501035_0100917 | |||
| 499 | Ga0501044_0018682 | |||
| 500 | Ga0501044_0063587 | |||
| 501 | Ga0501044_0098918 | |||
| 502 | nmdc:mga03683_89_c1 | |||
| 503 | nmdc:mga0k408_1820_c1 | |||
| 504 | nmdc:mga04h51_6198_c1 | |||
| 505 | nmdc:mga07m45_17953_c1 | |||
| 506 | nmdc:mga05p37_124987_c1 | |||
| 507 | nmdc:mga06r32_43979_c1 | |||
| 508 | nmdc:mga08y16_182827_c1 | |||
| 509 | nmdc:mga08y16_237_c1 | |||
| 510 | nmdc:mga0a205_3661_c1 | |||
| 511 | nmdc:mga0sz30_19469_c2 | |||
| 512 | nmdc:mga0sz30_266_c1 | |||
| 513 | Ga0500610_0117586 | |||
| 514 | Ga0500646_0019639 | |||
| 515 | Ga0500651_0004113 | |||
| 516 | Ga0500641_0003172 | |||
| 517 | Ga0500555_001335 | |||
| 518 | Ga0500556_0000368 | |||
| 519 | Ga0500569_038343 | |||
| 520 | Ga0500595_011357 | |||
| 521 | Ga0500658_0032426 | |||
| 522 | Ga0500658_0065670 | |||
| 523 | Ga0500577_0015564 | |||
| 524 | Ga0500577_0052928 | |||
| 525 | Ga0500588_0004841 | |||
| 526 | Ga0500588_0020438 | |||
| 527 | Ga0500604_0002263 | |||
| 528 | Ga0500616_0000355 | |||
| 529 | Ga0500627_0000890 | |||
| 530 | Ga0500636_0014750 | |||
| 531 | Ga0500611_003350 | |||
| 532 | Ga0500609_000801 | |||
| 533 | Ga0500609_006447 | |||
| 534 | Ga0501082_0000953 | |||
| 535 | Ga0501082_0321554 | |||
| 536 | Ga0530510_0040701 | |||
| 537 | 2512932863 | |||
| 538 | 2513608974 | |||
| 539 | 2588518919 | |||
| 540 | 2792748274 | |||
| 541 | 2821450901 | |||
| 542 | 2844533269 | |||
| 543 | 2874175066 | |||
| 544 | 2876364887 | |||
| 545 | 2876815992 | |||
| 546 | 2879119097 | |||
| 547 | 2888338034 | |||
| 548 | 2891562578 | |||
| 549 | 2903449651 | |||
| 550 | 2903522377 | |||
| 551 | 2903528756 | |||
| 552 | 2937852476 | |||
| 553 | 2963646343 | |||
| 554 | 2968087131 | |||
| 555 | 2977925284 | |||
| 556 | 3000139319 | |||
| 557 | 3004217778 | |||
| 558 | 3004221174 | |||
| 559 | 637075947 | |||
| 560 | 8006971883 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.942 | 4 | 233 |
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9397 | 1 | 233 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9396 | 4 | 217 |
| 8tzj-assembly1.cif.gz_A | cryo-em structure of vibrio cholerae ftse/ftsx complex | 0.939 | 4 | 212 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9367 | 1 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.981 | 4 | 217 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9752 | 3 | 216 | 3.40.50.300 |
| af_Q2G089_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.967 | 4 | 234 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9668 | 4 | 238 | 3.40.50.300 |
| 2awnC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9637 | 3 | 239 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1A2L0-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9867 | 1 | 208 |
GO:0005524
GO:0015423 GO:0016887 GO:0055052 GO:1990060 |
| AF-A0A2E7V6G1-F1-model_v4 | Spermidine/putrescine ABC transporter ATP-binding protein | 0.9816 | 4 | 216 |
GO:0005524
GO:0016887 |
| AF-A0A382V5S9-F1-model_v4 | ABC transporter domain-containing protein | 0.9803 | 49 | 191 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A371MRW7-F1-model_v4 | ABC transporter ATP-binding protein | 0.978 | 62 | 149 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A3M1A2L0-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9774 | 1 | 208 |
GO:0005524
GO:0015423 GO:0016887 GO:0055052 GO:1990060 |