F383917

General Info

Members Datasets Scaffolds Average Seq Length
280 183 560 102

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0286866|Ga0501036_0286866_806_1171
Length 121
Sequence LAIVNIRHSSKLQSAICRYYMHYLLFYDVVDDYVNRRTPYRAAHIALAREALARGELVLAGALADPPDGAVLVFRGSSPAVAESFAKNDPYVKNGLVVRWRVREWATVIGAGAEVSLPDQL

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 0.36
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 28.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0286866 3300049572 Bacteria 1377
2 SwRhRL2b_contig_2697519 2162886007 Bacteria 1067
3 Ga0065704_10003430 3300005289 Bacteria 7933
4 Ga0065707_10285089 3300005295 Unclassified 1037
5 Ga0065707_10285761 3300005295 Bacteria 1036
6 Ga0065707_10449704 3300005295 Unclassified 802
7 Ga0070683_100282236 3300005329 Unclassified 1579
8 Ga0070670_100131277 3300005331 Bacteria 2163
9 Ga0070666_10890886 3300005335 Unclassified 658
10 Ga0070680_100855803 3300005336 Unclassified 784
11 Ga0068868_100703565 3300005338 Bacteria 904
12 Ga0070660_100893664 3300005339 Bacteria 749
13 Ga0070689_100098593 3300005340 Unclassified 2311
14 Ga0070689_100731580 3300005340 Bacteria 866
15 Ga0070689_100818594 3300005340 Unclassified 820
16 Ga0070687_100378691 3300005343 Bacteria 921
17 Ga0070661_100337867 3300005344 Unclassified 1179
18 Ga0070661_100524284 3300005344 Unclassified 951
19 Ga0070668_101153002 3300005347 Bacteria 701
20 Ga0070675_100008196 3300005354 Bacteria 8105
21 Ga0070675_100732062 3300005354 Bacteria 902
22 Ga0070675_101955686 3300005354 Bacteria 541
23 Ga0070671_100010821 3300005355 Bacteria 7321
24 Ga0070674_100858194 3300005356 Unclassified 788
25 Ga0070674_101716119 3300005356 Bacteria 568
26 Ga0070673_100229658 3300005364 Bacteria 1609
27 Ga0070673_100751636 3300005364 Bacteria 898
28 Ga0070688_100009622 3300005365 Bacteria 5297
29 Ga0070703_10014977 3300005406 Bacteria 2215
30 Ga0070709_11614634 3300005434 Bacteria 528
31 Ga0070701_10003431 3300005438 Bacteria 6268
32 Ga0070705_100096275 3300005440 Bacteria 1858
33 Ga0070694_100445692 3300005444 Unclassified 1021
34 Ga0070694_100775244 3300005444 Bacteria 785
35 Ga0070662_100004211 3300005457 Bacteria 9062
36 Ga0070662_100362693 3300005457 Bacteria 1189
37 Ga0070662_101300225 3300005457 Bacteria 626
38 Ga0070706_100332781 3300005467 Bacteria 1416
39 Ga0070706_100472170 3300005467 Bacteria 1167
40 Ga0070706_101024912 3300005467 Unclassified 761
41 Ga0070707_100116780 3300005468 Bacteria 2590
42 Ga0070707_100341355 3300005468 Bacteria 1455
43 Ga0070698_100024796 3300005471 Bacteria 6253
44 Ga0070698_100066704 3300005471 Bacteria 3620
45 Ga0070698_102011409 3300005471 Unclassified 531
46 Ga0070699_100004448 3300005518 Bacteria 12393
47 Ga0070699_100292985 3300005518 Bacteria 1459
48 Ga0070697_100792866 3300005536 Bacteria 838
49 Ga0070697_102034304 3300005536 Unclassified 514
50 Ga0070672_100150829 3300005543 Unclassified 1923
51 Ga0070672_102168704 3300005543 Unclassified 501
52 Ga0070695_100561543 3300005545 Unclassified 891
53 Ga0070696_100083154 3300005546 Unclassified 2270
54 Ga0070696_100127148 3300005546 Bacteria 1850
55 Ga0070665_101996294 3300005548 Unclassified 585
56 Ga0070704_100582234 3300005549 Bacteria 981
57 Ga0070704_100872703 3300005549 Bacteria 808
58 Ga0070704_101073919 3300005549 Unclassified 730
59 Ga0070664_100041350 3300005564 Bacteria 3889
60 Ga0070664_100472515 3300005564 Bacteria 1153
61 Ga0070664_100920025 3300005564 Bacteria 820
62 Ga0068857_100022754 3300005577 Bacteria 5514
63 Ga0068857_101345406 3300005577 Bacteria 694
64 Ga0070702_100567789 3300005615 Bacteria 845
65 Ga0068859_100022939 3300005617 Bacteria 6259
66 Ga0068859_102896992 3300005617 Unclassified 525
67 Ga0068864_101872567 3300005618 Unclassified 605
68 Ga0068861_100835832 3300005719 Unclassified 867
69 Ga0068870_10001277 3300005840 Bacteria 10114
70 Ga0068870_10021372 3300005840 Bacteria 3164
71 Ga0068870_10115451 3300005840 Unclassified 1539
72 Ga0068863_100168396 3300005841 Bacteria 2101
73 Ga0068858_100100271 3300005842 Unclassified 2701
74 Ga0068860_100092334 3300005843 Bacteria 2884
75 Ga0068862_100001232 3300005844 Bacteria 24141
76 Ga0070715_10639990 3300006163 Unclassified 628
77 Ga0075366_10137562 3300006195 Bacteria 1475
78 Ga0075366_10390416 3300006195 Bacteria 856
79 Ga0075366_10475486 3300006195 Bacteria 772
80 Ga0097621_100107524 3300006237 Unclassified 2354
81 Ga0097621_100134201 3300006237 Bacteria 2110
82 Ga0068871_100326801 3300006358 Bacteria 1352
83 Ga0068871_100619954 3300006358 Bacteria 985
84 Ga0068871_100876387 3300006358 Bacteria 831
85 Ga0075428_100085165 3300006844 Bacteria 3447
86 Ga0075428_100132304 3300006844 Bacteria 2713
87 Ga0075428_100174468 3300006844 Bacteria 2329
88 Ga0075428_100731705 3300006844 Bacteria 1053
89 Ga0075430_100002455 3300006846 Bacteria 15435
90 Ga0075431_100088145 3300006847 Bacteria 3202
91 Ga0075433_10267973 3300006852 Bacteria 1514
92 Ga0075433_10406639 3300006852 Bacteria 1201
93 Ga0075433_11356478 3300006852 Bacteria 615
94 Ga0075434_100001649 3300006871 Bacteria 19017
95 Ga0075434_100049978 3300006871 Bacteria 4153
96 Ga0075434_100134038 3300006871 Unclassified 2497
97 Ga0075434_100363415 3300006871 Bacteria 1468
98 Ga0075434_100372315 3300006871 Unclassified 1449
99 Ga0075429_100107908 3300006880 Bacteria 2433
100 Ga0075429_101969857 3300006880 Unclassified 506
101 Ga0068865_100218761 3300006881 Bacteria 1488
102 Ga0097620_100022938 3300006931 Bacteria 6259
103 Ga0097620_102897069 3300006931 Unclassified 525
104 Ga0075435_100045674 3300007076 Bacteria 3512
105 Ga0075435_100096616 3300007076 Bacteria 2444
106 Ga0075435_100792313 3300007076 Bacteria 825
107 Ga0111539_10003907 3300009094 Bacteria 19597
108 Ga0111539_10204450 3300009094 Unclassified 2302
109 Ga0111539_11986337 3300009094 Unclassified 674
110 Ga0111539_12689132 3300009094 Unclassified 577
111 Ga0105245_10628294 3300009098 Bacteria 1103
112 Ga0114129_10026508 3300009147 Bacteria 8207
113 Ga0114129_10053774 3300009147 Bacteria 5647
114 Ga0114129_10257401 3300009147 Bacteria 2341
115 Ga0114129_11452390 3300009147 Unclassified 844
116 Ga0114129_11600068 3300009147 Bacteria 798
117 Ga0114129_13416453 3300009147 Unclassified 510
118 Ga0105243_10865127 3300009148 Bacteria 896
119 Ga0105241_10763032 3300009174 Unclassified 888
120 Ga0105248_10295074 3300009177 Bacteria 1825
121 Ga0105248_12521683 3300009177 Unclassified 586
122 Ga0157373_10022697 3300013100 Bacteria 4551
123 Ga0157369_10000043 3300013105 Bacteria 180713
124 Ga0157374_10072496 3300013296 Bacteria 3249
125 Ga0157378_11073859 3300013297 Bacteria 841
126 Ga0157378_11899583 3300013297 Bacteria 644
127 Ga0157377_10093338 3300014745 Bacteria 1781
128 Ga0157377_10702076 3300014745 Unclassified 735
129 Ga0157377_10820858 3300014745 Unclassified 687
130 Ga0207685_10637434 3300025905 Unclassified 575
131 Ga0207643_10017471 3300025908 Bacteria 3923
132 Ga0207643_10047276 3300025908 Unclassified 2434
133 Ga0207684_10263552 3300025910 Bacteria 1487
134 Ga0207660_10817055 3300025917 Unclassified 761
135 Ga0207662_10173698 3300025918 Unclassified 1383
136 Ga0207662_10252133 3300025918 Bacteria 1159
137 Ga0207649_10126901 3300025920 Unclassified 1728
138 Ga0207649_10476617 3300025920 Unclassified 946
139 Ga0207646_10152122 3300025922 Bacteria 2087
140 Ga0207646_10221190 3300025922 Bacteria 1710
141 Ga0207650_10110630 3300025925 Bacteria 2126
142 Ga0207650_10138542 3300025925 Unclassified 1911
143 Ga0207650_11437203 3300025925 Unclassified 587
144 Ga0207659_10139569 3300025926 Bacteria 1880
145 Ga0207687_10724768 3300025927 Bacteria 845
146 Ga0207644_10169182 3300025931 Unclassified 1705
147 Ga0207690_10324890 3300025932 Bacteria 1210
148 Ga0207706_10704826 3300025933 Unclassified 862
149 Ga0207706_11100659 3300025933 Bacteria 664
150 Ga0207709_10428279 3300025935 Unclassified 1018
151 Ga0207670_10123161 3300025936 Bacteria 1888
152 Ga0207670_10294081 3300025936 Bacteria 1270
153 Ga0207704_10494478 3300025938 Unclassified 985
154 Ga0207691_10094460 3300025940 Unclassified 2676
155 Ga0207711_11027614 3300025941 Bacteria 764
156 Ga0207661_10050484 3300025944 Bacteria 3314
157 Ga0207679_10016331 3300025945 Bacteria 4928
158 Ga0207679_10776074 3300025945 Unclassified 873
159 Ga0207679_11070301 3300025945 Bacteria 740
160 Ga0207679_12037523 3300025945 Unclassified 522
161 Ga0207651_10268116 3300025960 Unclassified 1405
162 Ga0207651_10347004 3300025960 Bacteria 1249
163 Ga0207651_10406080 3300025960 Unclassified 1160
164 Ga0207703_10745526 3300026035 Unclassified 933
165 Ga0207641_10060486 3300026088 Unclassified 3229
166 Ga0207676_11176447 3300026095 Bacteria 759
167 Ga0207674_10050757 3300026116 Unclassified 4237
168 Ga0207674_11130403 3300026116 Bacteria 753
169 Ga0207675_100293702 3300026118 Unclassified 1581
170 Ga0207683_10615944 3300026121 Bacteria 1005
171 Ga0207428_10090390 3300027907 Bacteria 2378
172 Ga0268266_10974164 3300028379 Unclassified 821
173 Ga0268265_10026615 3300028380 Bacteria 4117
174 Ga0316177_1009561 3300030731 Bacteria 1170
175 Ga0265340_10033220 3300031247 Bacteria 2570
176 Ga0307408_100266320 3300031548 Bacteria 1421
177 Ga0265314_10000216 3300031711 Bacteria 85672
178 Ga0307405_10163429 3300031731 Unclassified 1580
179 Ga0307410_10147593 3300031852 Bacteria 1747
180 Ga0307410_10861581 3300031852 Bacteria 774
181 Ga0307406_11062670 3300031901 Bacteria 697
182 Ga0307407_10084446 3300031903 Bacteria 1929
183 Ga0307412_10182001 3300031911 Bacteria 1582
184 Ga0307409_100678315 3300031995 Unclassified 1027
185 Ga0307409_102186410 3300031995 Bacteria 583
186 Ga0307414_10503994 3300032004 Bacteria 1071
187 Ga0307414_11598565 3300032004 Unclassified 607
188 Ga0307414_12213613 3300032004 Bacteria 513
189 Ga0307411_10580579 3300032005 Bacteria 961
190 Ga0307411_11738644 3300032005 Bacteria 578
191 Ga0307415_101165602 3300032126 Bacteria 724
192 Ga0373934_0073336 3300035086 Bacteria 1370
193 Ga0373949_0186986 3300035090 Bacteria 616
194 Ga0373923_0034137 3300035111 Bacteria 2063
195 Ga0373939_0098983 3300035114 Bacteria 998
196 Ga0373941_0124448 3300035115 Bacteria 922
197 Ga0373941_0488373 3300035115 Unclassified 522
198 Ga0373953_0043671 3300035117 Bacteria 1790
199 Ga0373954_0001265 3300035118 Bacteria 10146
200 Ga0373957_0129646 3300035120 Bacteria 1026
201 Ga0373957_0242424 3300035120 Bacteria 757
202 Ga0373946_0095402 3300035171 Bacteria 1325
203 Ga0373955_0014494 3300035172 Bacteria 3836
204 Ga0373961_0125265 3300035241 Bacteria 855
205 Ga0373962_0139626 3300035242 Bacteria 786
206 Ga0373935_0511987 3300035692 Bacteria 872
207 Ga0373933_0068805 3300035724 Bacteria 2151
208 Ga0373947_0729568 3300035725 Bacteria 676
209 Ga0373947_0884515 3300035725 Bacteria 610
210 Ga0373937_0008250 3300036401 Bacteria 9044
211 Ga0373925_0197980 3300037068 Bacteria 1597
212 Ga0395899_0227345 3300037312 Unclassified 1290
213 Ga0395900_0657242 3300037418 Bacteria 984
214 Ga0395905_0336098 3300037471 Bacteria 1401
215 Ga0395901_0076832 3300038443 Unclassified 3484
216 Ga0436365_0831983 3300039437 Bacteria 1762
217 Ga0439431_0127580 3300041997 Bacteria 713
218 Ga0439441_126238 3300042001 Bacteria 590
219 Ga0439441_133466 3300042001 Unclassified 576
220 Ga0439443_048921 3300042003 Bacteria 736
221 Ga0439434_0301245 3300042435 Bacteria 554
222 Ga0439440_0044302 3300042993 Bacteria 1094
223 Ga0466965_0586127 3300044683 Unclassified 632
224 Ga0451576_0089873 3300045051 Bacteria 3194
225 Ga0451576_0850850 3300045051 Bacteria 957
226 Ga0495603_0085436 3300046455 Unclassified 1847
227 Ga0495664_0824075 3300046477 Bacteria 545
228 Ga0495584_0229804 3300046491 Bacteria 943
229 Ga0495594_0114324 3300046499 Bacteria 1523
230 Ga0495608_0509771 3300046511 Bacteria 728
231 Ga0495643_0002074 3300046522 Bacteria 16580
232 Ga0495598_0082418 3300046537 Bacteria 1035
233 Ga0495621_0000522 3300046539 Bacteria 9494
234 Ga0495621_0243249 3300046539 Unclassified 733
235 Ga0495645_0400270 3300046543 Bacteria 875
236 Ga0495633_0304534 3300046558 Bacteria 724
237 Ga0495659_0080264 3300046664 Bacteria 1237
238 Ga0495659_0140533 3300046664 Bacteria 963
239 Ga0495588_0023313 3300046674 Bacteria 3064
240 Ga0495669_0100470 3300046684 Bacteria 1343
241 Ga0495670_0325674 3300046691 Bacteria 825
242 Ga0495672_0343428 3300047320 Bacteria 695
243 Ga0496108_1343737 3300048911 Unclassified 600
244 Ga0501040_0098007 3300049576 Bacteria 2043
245 Ga0501042_0025304 3300049578 Bacteria 4167
246 Ga0501046_1009919 3300049580 Unclassified 577
247 Ga0501072_0013846 3300049588 Bacteria 6179
248 Ga0501072_0784674 3300049588 Bacteria 747
249 Ga0501075_0035609 3300049591 Bacteria 3713
250 Ga0501076_0171558 3300049592 Bacteria 1768
251 Ga0501077_0508482 3300049593 Unclassified 772
252 Ga0501227_003551 3300049665 Bacteria 3379
253 Ga0501079_0178482 3300049741 Bacteria 1657
254 Ga0501080_0491042 3300049742 Unclassified 1098
255 Ga0501081_0248618 3300049743 Bacteria 1298
256 Ga0501081_0351504 3300049743 Bacteria 1086
257 Ga0501083_0472408 3300049744 Unclassified 816
258 Ga0501045_0133117 3300049824 Bacteria 1848
259 nmdc:mga0k408_139362_c1 3300050493 Bacteria 1442
260 nmdc:mga05p37_292779_c1 3300050507 Bacteria 1937
261 nmdc:mga05p37_3371_c1 3300050507 Bacteria 18646
262 nmdc:mga05p37_590485_c1 3300050507 Bacteria 1256
263 nmdc:mga05p37_935065_c1 3300050507 Unclassified 930
264 nmdc:mga09592_1009759_c1 3300050508 Bacteria 695
265 nmdc:mga09592_190703_c1 3300050508 Unclassified 1774
266 nmdc:mga0qj67_2001_c1 3300050509 Bacteria 14519
267 nmdc:mga0qj67_243086_c1 3300050509 Bacteria 1460
268 nmdc:mga06r32_22672_c1 3300050510 Bacteria 5806
269 nmdc:mga08y16_1245_c1 3300050511 Bacteria 25244
270 nmdc:mga0n895_20786_c1 3300050512 Bacteria 6129
271 nmdc:mga0n895_2152830_c1 3300050512 Bacteria 514
272 nmdc:mga0n895_416326_c1 3300050512 Unclassified 1358
273 nmdc:mga0rr50_237071_c1 3300050513 Bacteria 1511
274 nmdc:mga0rr50_28450_c1 3300050513 Bacteria 3929
275 nmdc:mga0rr50_576347_c1 3300050513 Bacteria 959
276 nmdc:mga08x19_883788_c1 3300050514 Bacteria 635
277 nmdc:mga0a205_208635_c1 3300050515 Unclassified 1842
278 Ga0501084_0423321 3300054114 Bacteria 1126
279 Ga0530510_0107856 3300061734 Bacteria 2038
280 Ga0530510_0265067 3300061734 Bacteria 1282
281 Ga0501036_0286866
282 SwRhRL2b_contig_2697519
283 Ga0065704_10003430
284 Ga0065707_10285089
285 Ga0065707_10285761
286 Ga0065707_10449704
287 Ga0070683_100282236
288 Ga0070670_100131277
289 Ga0070666_10890886
290 Ga0070680_100855803
291 Ga0068868_100703565
292 Ga0070660_100893664
293 Ga0070689_100098593
294 Ga0070689_100731580
295 Ga0070689_100818594
296 Ga0070687_100378691
297 Ga0070661_100337867
298 Ga0070661_100524284
299 Ga0070668_101153002
300 Ga0070675_100008196
301 Ga0070675_100732062
302 Ga0070675_101955686
303 Ga0070671_100010821
304 Ga0070674_100858194
305 Ga0070674_101716119
306 Ga0070673_100229658
307 Ga0070673_100751636
308 Ga0070688_100009622
309 Ga0070703_10014977
310 Ga0070709_11614634
311 Ga0070701_10003431
312 Ga0070705_100096275
313 Ga0070694_100445692
314 Ga0070694_100775244
315 Ga0070662_100004211
316 Ga0070662_100362693
317 Ga0070662_101300225
318 Ga0070706_100332781
319 Ga0070706_100472170
320 Ga0070706_101024912
321 Ga0070707_100116780
322 Ga0070707_100341355
323 Ga0070698_100024796
324 Ga0070698_100066704
325 Ga0070698_102011409
326 Ga0070699_100004448
327 Ga0070699_100292985
328 Ga0070697_100792866
329 Ga0070697_102034304
330 Ga0070672_100150829
331 Ga0070672_102168704
332 Ga0070695_100561543
333 Ga0070696_100083154
334 Ga0070696_100127148
335 Ga0070665_101996294
336 Ga0070704_100582234
337 Ga0070704_100872703
338 Ga0070704_101073919
339 Ga0070664_100041350
340 Ga0070664_100472515
341 Ga0070664_100920025
342 Ga0068857_100022754
343 Ga0068857_101345406
344 Ga0070702_100567789
345 Ga0068859_100022939
346 Ga0068859_102896992
347 Ga0068864_101872567
348 Ga0068861_100835832
349 Ga0068870_10001277
350 Ga0068870_10021372
351 Ga0068870_10115451
352 Ga0068863_100168396
353 Ga0068858_100100271
354 Ga0068860_100092334
355 Ga0068862_100001232
356 Ga0070715_10639990
357 Ga0075366_10137562
358 Ga0075366_10390416
359 Ga0075366_10475486
360 Ga0097621_100107524
361 Ga0097621_100134201
362 Ga0068871_100326801
363 Ga0068871_100619954
364 Ga0068871_100876387
365 Ga0075428_100085165
366 Ga0075428_100132304
367 Ga0075428_100174468
368 Ga0075428_100731705
369 Ga0075430_100002455
370 Ga0075431_100088145
371 Ga0075433_10267973
372 Ga0075433_10406639
373 Ga0075433_11356478
374 Ga0075434_100001649
375 Ga0075434_100049978
376 Ga0075434_100134038
377 Ga0075434_100363415
378 Ga0075434_100372315
379 Ga0075429_100107908
380 Ga0075429_101969857
381 Ga0068865_100218761
382 Ga0097620_100022938
383 Ga0097620_102897069
384 Ga0075435_100045674
385 Ga0075435_100096616
386 Ga0075435_100792313
387 Ga0111539_10003907
388 Ga0111539_10204450
389 Ga0111539_11986337
390 Ga0111539_12689132
391 Ga0105245_10628294
392 Ga0114129_10026508
393 Ga0114129_10053774
394 Ga0114129_10257401
395 Ga0114129_11452390
396 Ga0114129_11600068
397 Ga0114129_13416453
398 Ga0105243_10865127
399 Ga0105241_10763032
400 Ga0105248_10295074
401 Ga0105248_12521683
402 Ga0157373_10022697
403 Ga0157369_10000043
404 Ga0157374_10072496
405 Ga0157378_11073859
406 Ga0157378_11899583
407 Ga0157377_10093338
408 Ga0157377_10702076
409 Ga0157377_10820858
410 Ga0207685_10637434
411 Ga0207643_10017471
412 Ga0207643_10047276
413 Ga0207684_10263552
414 Ga0207660_10817055
415 Ga0207662_10173698
416 Ga0207662_10252133
417 Ga0207649_10126901
418 Ga0207649_10476617
419 Ga0207646_10152122
420 Ga0207646_10221190
421 Ga0207650_10110630
422 Ga0207650_10138542
423 Ga0207650_11437203
424 Ga0207659_10139569
425 Ga0207687_10724768
426 Ga0207644_10169182
427 Ga0207690_10324890
428 Ga0207706_10704826
429 Ga0207706_11100659
430 Ga0207709_10428279
431 Ga0207670_10123161
432 Ga0207670_10294081
433 Ga0207704_10494478
434 Ga0207691_10094460
435 Ga0207711_11027614
436 Ga0207661_10050484
437 Ga0207679_10016331
438 Ga0207679_10776074
439 Ga0207679_11070301
440 Ga0207679_12037523
441 Ga0207651_10268116
442 Ga0207651_10347004
443 Ga0207651_10406080
444 Ga0207703_10745526
445 Ga0207641_10060486
446 Ga0207676_11176447
447 Ga0207674_10050757
448 Ga0207674_11130403
449 Ga0207675_100293702
450 Ga0207683_10615944
451 Ga0207428_10090390
452 Ga0268266_10974164
453 Ga0268265_10026615
454 Ga0316177_1009561
455 Ga0265340_10033220
456 Ga0307408_100266320
457 Ga0265314_10000216
458 Ga0307405_10163429
459 Ga0307410_10147593
460 Ga0307410_10861581
461 Ga0307406_11062670
462 Ga0307407_10084446
463 Ga0307412_10182001
464 Ga0307409_100678315
465 Ga0307409_102186410
466 Ga0307414_10503994
467 Ga0307414_11598565
468 Ga0307414_12213613
469 Ga0307411_10580579
470 Ga0307411_11738644
471 Ga0307415_101165602
472 Ga0373934_0073336
473 Ga0373949_0186986
474 Ga0373923_0034137
475 Ga0373939_0098983
476 Ga0373941_0124448
477 Ga0373941_0488373
478 Ga0373953_0043671
479 Ga0373954_0001265
480 Ga0373957_0129646
481 Ga0373957_0242424
482 Ga0373946_0095402
483 Ga0373955_0014494
484 Ga0373961_0125265
485 Ga0373962_0139626
486 Ga0373935_0511987
487 Ga0373933_0068805
488 Ga0373947_0729568
489 Ga0373947_0884515
490 Ga0373937_0008250
491 Ga0373925_0197980
492 Ga0395899_0227345
493 Ga0395900_0657242
494 Ga0395905_0336098
495 Ga0395901_0076832
496 Ga0436365_0831983
497 Ga0439431_0127580
498 Ga0439441_126238
499 Ga0439441_133466
500 Ga0439443_048921
501 Ga0439434_0301245
502 Ga0439440_0044302
503 Ga0466965_0586127
504 Ga0451576_0089873
505 Ga0451576_0850850
506 Ga0495603_0085436
507 Ga0495664_0824075
508 Ga0495584_0229804
509 Ga0495594_0114324
510 Ga0495608_0509771
511 Ga0495643_0002074
512 Ga0495598_0082418
513 Ga0495621_0000522
514 Ga0495621_0243249
515 Ga0495645_0400270
516 Ga0495633_0304534
517 Ga0495659_0080264
518 Ga0495659_0140533
519 Ga0495588_0023313
520 Ga0495669_0100470
521 Ga0495670_0325674
522 Ga0495672_0343428
523 Ga0496108_1343737
524 Ga0501040_0098007
525 Ga0501042_0025304
526 Ga0501046_1009919
527 Ga0501072_0013846
528 Ga0501072_0784674
529 Ga0501075_0035609
530 Ga0501076_0171558
531 Ga0501077_0508482
532 Ga0501227_003551
533 Ga0501079_0178482
534 Ga0501080_0491042
535 Ga0501081_0248618
536 Ga0501081_0351504
537 Ga0501083_0472408
538 Ga0501045_0133117
539 nmdc:mga0k408_139362_c1
540 nmdc:mga05p37_292779_c1
541 nmdc:mga05p37_3371_c1
542 nmdc:mga05p37_590485_c1
543 nmdc:mga05p37_935065_c1
544 nmdc:mga09592_1009759_c1
545 nmdc:mga09592_190703_c1
546 nmdc:mga0qj67_2001_c1
547 nmdc:mga0qj67_243086_c1
548 nmdc:mga06r32_22672_c1
549 nmdc:mga08y16_1245_c1
550 nmdc:mga0n895_20786_c1
551 nmdc:mga0n895_2152830_c1
552 nmdc:mga0n895_416326_c1
553 nmdc:mga0rr50_237071_c1
554 nmdc:mga0rr50_28450_c1
555 nmdc:mga0rr50_576347_c1
556 nmdc:mga08x19_883788_c1
557 nmdc:mga0a205_208635_c1
558 Ga0501084_0423321
559 Ga0530510_0107856
560 Ga0530510_0265067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

21

106

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.8566 1 89
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.8382 1 87
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.7655 1 89
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7652 1 85
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7574 1 85
ID Description Score Start End Superfamily
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8519 1 89 3.30.70.1060
af_Q5A784_25_117_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7855 2 83 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7754 3 85 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7738 1 89 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7098 3 85 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A7X8AK89-F1-model_v4 YCII-related domain-containing protein 0.9866 2 90 GO:0016020
AF-A0A3N5XNI3-F1-model_v4 YCII-related domain-containing protein 0.9864 1 90
AF-A0A2Z6U2R5-F1-model_v4 deleted 0.9849 1 93
AF-A0A6P2I0U2-F1-model_v4 deleted 0.9831 1 93
AF-A0A4S4NK76-F1-model_v4 YCII-related domain-containing protein 0.9822 2 90

Map