F383908

General Info

Members Datasets Scaffolds Average Seq Length
280 178 560 166

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0469408|Ga0501031_0469408_15_620
Length 201
Sequence VQGVDVGEHLDPAIRRVADDLGLAGWDDLHRATVRCRRMIRRCTDDERGEILAIVNAAAQAYRGVIPADRWHEPYMPASELEAEIAAGVEFWGYEDDGELLGVMGIQAVQDVHLIRHAYVKPGSQRGGVGGALIEHLMESATRPVLVGTWAAAAWAIAFYRRHGFEQVSPEEKSRLLRRYWDIPERQVETSVVLRGRAARS

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 6.43
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0469408 3300049568 Unclassified 813
2 Ga0070683_100043869 3300005329 Bacteria 4122
3 Ga0070682_101066320 3300005337 Bacteria 674
4 Ga0070687_100328124 3300005343 Bacteria 980
5 Ga0070692_10011757 3300005345 Bacteria 4029
6 Ga0070674_100599573 3300005356 Bacteria 930
7 Ga0070688_100009135 3300005365 Bacteria 5407
8 Ga0070659_100408662 3300005366 Bacteria 1147
9 Ga0070659_101609843 3300005366 Bacteria 580
10 Ga0070703_10024982 3300005406 Bacteria 1769
11 Ga0070714_100171717 3300005435 Bacteria 1968
12 Ga0070713_100212314 3300005436 Bacteria 1753
13 Ga0070705_100066319 3300005440 Bacteria 2164
14 Ga0070705_101099775 3300005440 Bacteria 650
15 Ga0070700_100051351 3300005441 Bacteria 2566
16 Ga0070700_100271122 3300005441 Bacteria 1226
17 Ga0070700_100509525 3300005441 Bacteria 927
18 Ga0070678_100731822 3300005456 Bacteria 893
19 Ga0070685_10047377 3300005466 Bacteria 2472
20 Ga0070698_100028595 3300005471 Bacteria 5789
21 Ga0070698_100579271 3300005471 Bacteria 1062
22 Ga0070684_100261112 3300005535 Bacteria 1584
23 Ga0068853_100047747 3300005539 Bacteria 3674
24 Ga0070686_100053443 3300005544 Bacteria 2579
25 Ga0070695_100213204 3300005545 Bacteria 1387
26 Ga0070695_100213725 3300005545 Bacteria 1386
27 Ga0070695_100308680 3300005545 Bacteria 1172
28 Ga0070693_100098931 3300005547 Bacteria 1773
29 Ga0070704_100579772 3300005549 Bacteria 983
30 Ga0070704_100688339 3300005549 Bacteria 906
31 Ga0068857_100107761 3300005577 Bacteria 2503
32 Ga0068856_100294007 3300005614 Bacteria 1641
33 Ga0068864_100711307 3300005618 Bacteria 982
34 Ga0068861_101228349 3300005719 Bacteria 726
35 Ga0081455_10083808 3300005937 Bacteria 2604
36 Ga0081538_10000002 3300005981 Bacteria 242010
37 Ga0081538_10052264 3300005981 Bacteria 2443
38 Ga0081539_10002554 3300005985 Bacteria 25258
39 Ga0075363_100127430 3300006048 Bacteria 1426
40 Ga0075432_10006385 3300006058 Bacteria 4010
41 Ga0070716_100213488 3300006173 Unclassified 1291
42 Ga0075367_10110599 3300006178 Bacteria 1686
43 Ga0097621_100134485 3300006237 Bacteria 2107
44 Ga0097621_100162208 3300006237 Bacteria 1922
45 Ga0068871_100114031 3300006358 Bacteria 2276
46 Ga0075428_100047082 3300006844 Bacteria 4737
47 Ga0075428_101524620 3300006844 Bacteria 700
48 Ga0075430_100369528 3300006846 Bacteria 1184
49 Ga0075430_100585991 3300006846 Bacteria 920
50 Ga0075431_100095855 3300006847 Bacteria 3063
51 Ga0075431_100930600 3300006847 Unclassified 838
52 Ga0075433_10234066 3300006852 Bacteria 1631
53 Ga0075434_100020851 3300006871 Bacteria 6363
54 Ga0075434_100358193 3300006871 Bacteria 1480
55 Ga0111539_10088606 3300009094 Bacteria 3636
56 Ga0111539_10580207 3300009094 Bacteria 1306
57 Ga0111539_11111611 3300009094 Bacteria 918
58 Ga0111539_11715046 3300009094 Bacteria 728
59 Ga0111539_12496614 3300009094 Bacteria 599
60 Ga0114129_10247933 3300009147 Bacteria 2392
61 Ga0114129_10372053 3300009147 Bacteria 1888
62 Ga0114129_11751639 3300009147 Bacteria 757
63 Ga0105243_10488597 3300009148 Bacteria 1164
64 Ga0105241_10183792 3300009174 Bacteria 1736
65 Ga0105242_10143765 3300009176 Bacteria 2073
66 Ga0105249_10905991 3300009553 Bacteria 949
67 Ga0105246_10129694 3300011119 Bacteria 1881
68 Ga0157378_10863713 3300013297 Bacteria 934
69 Ga0157372_10113411 3300013307 Bacteria 3106
70 Ga0157375_10138165 3300013308 Bacteria 2562
71 Ga0157377_10362046 3300014745 Bacteria 976
72 Ga0157376_10793118 3300014969 Bacteria 959
73 Ga0163161_10238945 3300017792 Bacteria 1412
74 Ga0213876_10010046 3300021384 Bacteria 5087
75 Ga0207642_10035248 3300025899 Bacteria 2135
76 Ga0207654_10442795 3300025911 Bacteria 910
77 Ga0207662_10407544 3300025918 Bacteria 923
78 Ga0207694_10138428 3300025924 Bacteria 1956
79 Ga0207700_10198304 3300025928 Bacteria 1690
80 Ga0207664_10211752 3300025929 Bacteria 1677
81 Ga0207644_10629929 3300025931 Bacteria 892
82 Ga0207686_10668517 3300025934 Bacteria 823
83 Ga0207670_10167419 3300025936 Bacteria 1645
84 Ga0207669_10223288 3300025937 Bacteria 1384
85 Ga0207679_10581941 3300025945 Bacteria 1007
86 Ga0207667_10324503 3300025949 Bacteria 1572
87 Ga0207640_10392323 3300025981 Bacteria 1128
88 Ga0207640_10822577 3300025981 Bacteria 806
89 Ga0207703_10972395 3300026035 Bacteria 814
90 Ga0207708_10006026 3300026075 Bacteria 8984
91 Ga0207708_10200435 3300026075 Bacteria 1592
92 Ga0207708_10479497 3300026075 Bacteria 1040
93 Ga0207708_10734531 3300026075 Bacteria 846
94 Ga0207648_10252184 3300026089 Unclassified 1573
95 Ga0207676_10665670 3300026095 Bacteria 1006
96 Ga0207674_10063942 3300026116 Bacteria 3712
97 Ga0207675_101067321 3300026118 Bacteria 827
98 Ga0207698_10927238 3300026142 Bacteria 879
99 Ga0207428_10125628 3300027907 Bacteria 1965
100 Ga0207428_10188131 3300027907 Bacteria 1557
101 Ga0265323_10070110 3300028653 Bacteria 1200
102 Ga0307515_10477155 3300028794 Bacteria 860
103 Ga0265338_10010742 3300028800 Bacteria 10685
104 Ga0265324_10038208 3300029957 Bacteria 1666
105 Ga0265316_10153758 3300031344 Bacteria 1722
106 Ga0307513_10085402 3300031456 Bacteria 3239
107 Ga0265314_10062627 3300031711 Bacteria 2527
108 Ga0307405_10052110 3300031731 Bacteria 2543
109 Ga0307413_10069692 3300031824 Bacteria 2208
110 Ga0307413_10167806 3300031824 Bacteria 1550
111 Ga0307410_10057395 3300031852 Bacteria 2651
112 Ga0307410_10158329 3300031852 Bacteria 1694
113 Ga0307406_10017540 3300031901 Bacteria 4170
114 Ga0307407_10027128 3300031903 Bacteria 3043
115 Ga0307407_10088080 3300031903 Bacteria 1896
116 Ga0307407_10091714 3300031903 Bacteria 1864
117 Ga0307407_10681097 3300031903 Bacteria 773
118 Ga0307412_10013154 3300031911 Bacteria 4844
119 Ga0307412_10120941 3300031911 Bacteria 1885
120 Ga0307409_100035761 3300031995 Bacteria 3642
121 Ga0307409_100235129 3300031995 Bacteria 1664
122 Ga0307409_100997868 3300031995 Bacteria 855
123 Ga0307409_101070630 3300031995 Bacteria 827
124 Ga0307416_100401227 3300032002 Bacteria 1409
125 Ga0307416_100415662 3300032002 Bacteria 1387
126 Ga0307416_100548427 3300032002 Unclassified 1229
127 Ga0307414_10799530 3300032004 Bacteria 860
128 Ga0307414_11066966 3300032004 Bacteria 745
129 Ga0307415_100053943 3300032126 Bacteria 2742
130 Ga0307415_100305346 3300032126 Bacteria 1320
131 Ga0307415_100331658 3300032126 Bacteria 1273
132 Ga0307415_100644964 3300032126 Bacteria 948
133 Ga0307415_101468084 3300032126 Unclassified 651
134 Ga0316583_10064312 3300032133 Bacteria 1284
135 Ga0373959_0013736 3300034820 Bacteria 1465
136 Ga0373932_0070473 3300035112 Bacteria 1083
137 Ga0373960_0088790 3300035121 Bacteria 985
138 Ga0373927_0288079 3300035695 Bacteria 1081
139 Ga0395898_0647726 3300037466 Unclassified 999
140 Ga0436364_0500133 3300037853 Unclassified 2295
141 Ga0395901_0716858 3300038443 Bacteria 996
142 Ga0436365_0551324 3300039437 Bacteria 20433
143 Ga0439447_009436 3300041407 Bacteria 2960
144 Ga0451807_2313772 3300041486 Bacteria 602
145 Ga0451849_0828638 3300041505 Bacteria 668
146 Ga0466972_0000102 3300044658 Bacteria 75316
147 Ga0466965_0639319 3300044683 Bacteria 607
148 Ga0466966_0188534 3300044684 Bacteria 1250
149 Ga0466963_0046061 3300044694 Bacteria 2874
150 Ga0466963_0056740 3300044694 Bacteria 2606
151 Ga0466963_0355432 3300044694 Bacteria 1032
152 Ga0466971_0015377 3300044719 Bacteria 3367
153 Ga0466957_0082532 3300044842 Bacteria 2004
154 Ga0466957_0154296 3300044842 Bacteria 1487
155 Ga0466957_0539114 3300044842 Bacteria 812
156 Ga0466959_0688781 3300045049 Bacteria 685
157 Ga0466959_0740792 3300045049 Bacteria 658
158 Ga0451576_0778189 3300045051 Bacteria 1005
159 Ga0466958_0010455 3300045836 Bacteria 5198
160 Ga0466967_0326018 3300045976 Bacteria 1482
161 Ga0466967_0411262 3300045976 Bacteria 1317
162 Ga0466967_0846532 3300045976 Unclassified 909
163 Ga0466967_1945642 3300045976 Unclassified 585
164 Ga0495629_0071853 3300046459 Bacteria 2415
165 Ga0495582_0562255 3300046473 Bacteria 660
166 Ga0495616_0079696 3300046513 Bacteria 1569
167 Ga0495631_0098027 3300046518 Bacteria 1262
168 Ga0495632_0179041 3300046519 Unclassified 972
169 Ga0495668_0000831 3300046616 Bacteria 35107
170 Ga0495668_0397003 3300046616 Bacteria 758
171 Ga0495647_0075497 3300046681 Bacteria 1357
172 Ga0495670_0682494 3300046691 Unclassified 560
173 Ga0495671_0221971 3300046692 Bacteria 915
174 Ga0495581_0616644 3300047315 Bacteria 628
175 Ga0495676_0250314 3300047321 Bacteria 1209
176 Ga0496101_0501004 3300048904 Bacteria 959
177 Ga0496104_0009884 3300048907 Bacteria 8515
178 Ga0496104_0638948 3300048907 Bacteria 973
179 Ga0496104_1240905 3300048907 Bacteria 649
180 Ga0496105_0028310 3300048908 Bacteria 4583
181 Ga0496105_0524131 3300048908 Bacteria 928
182 Ga0496107_0747964 3300048910 Bacteria 717
183 Ga0496108_0113714 3300048911 Bacteria 2317
184 Ga0496108_0448784 3300048911 Bacteria 1127
185 Ga0496108_0687301 3300048911 Bacteria 888
186 Ga0496109_0072127 3300048912 Bacteria 3171
187 Ga0496109_0085780 3300048912 Bacteria 2907
188 Ga0496110_0347443 3300048913 Bacteria 1351
189 Ga0496111_0084679 3300048914 Bacteria 2318
190 Ga0496112_0014492 3300048915 Bacteria 7319
191 Ga0496112_0410020 3300048915 Bacteria 1294
192 Ga0496113_0241541 3300048916 Bacteria 1441
193 Ga0496126_0010299 3300048929 Bacteria 9818
194 Ga0501292_083427 3300049515 Bacteria 611
195 Ga0501031_0021870 3300049568 Bacteria 4167
196 Ga0501031_0617445 3300049568 Bacteria 697
197 Ga0501033_0072972 3300049570 Bacteria 2520
198 Ga0501033_0407982 3300049570 Bacteria 947
199 Ga0501033_0420825 3300049570 Bacteria 930
200 Ga0501036_0073365 3300049572 Bacteria 2893
201 Ga0501036_0462046 3300049572 Unclassified 1057
202 Ga0501037_0270423 3300049573 Bacteria 1186
203 Ga0501038_0027837 3300049574 Bacteria 5023
204 Ga0501039_0013236 3300049575 Bacteria 6307
205 Ga0501039_0164214 3300049575 Bacteria 1746
206 Ga0501040_0008323 3300049576 Bacteria 6745
207 Ga0501040_0075808 3300049576 Bacteria 2325
208 Ga0501041_0014533 3300049577 Bacteria 4675
209 Ga0501041_0028925 3300049577 Bacteria 3343
210 Ga0501041_0123355 3300049577 Unclassified 1611
211 Ga0501041_0412352 3300049577 Bacteria 856
212 Ga0501042_0008174 3300049578 Bacteria 6893
213 Ga0501042_0106937 3300049578 Bacteria 2014
214 Ga0501042_0267815 3300049578 Bacteria 1233
215 Ga0501043_0806415 3300049579 Bacteria 679
216 Ga0501048_0005451 3300049582 Bacteria 9676
217 Ga0501048_0054023 3300049582 Bacteria 2854
218 Ga0501067_0006991 3300049583 Bacteria 6262
219 Ga0501067_0156943 3300049583 Bacteria 1268
220 Ga0501068_0000157 3300049584 Bacteria 31218
221 Ga0501068_0023765 3300049584 Bacteria 3594
222 Ga0501068_0313224 3300049584 Bacteria 1005
223 Ga0501069_0001140 3300049585 Bacteria 12839
224 Ga0501070_0020433 3300049586 Bacteria 5555
225 Ga0501071_0029639 3300049587 Bacteria 3864
226 Ga0501071_0053640 3300049587 Bacteria 2908
227 Ga0501071_0071662 3300049587 Bacteria 2527
228 Ga0501072_0012891 3300049588 Bacteria 6393
229 Ga0501072_0095719 3300049588 Bacteria 2360
230 Ga0501072_0156983 3300049588 Bacteria 1814
231 Ga0501073_0595503 3300049589 Bacteria 764
232 Ga0501074_0057547 3300049590 Bacteria 2800
233 Ga0501074_0100275 3300049590 Unclassified 2073
234 Ga0501075_0002182 3300049591 Bacteria 12942
235 Ga0501075_0089235 3300049591 Bacteria 2338
236 Ga0501075_0256317 3300049591 Bacteria 1333
237 Ga0501076_0004049 3300049592 Bacteria 10360
238 Ga0501076_0027172 3300049592 Bacteria 4439
239 Ga0501076_0089616 3300049592 Bacteria 2473
240 Ga0501076_0210455 3300049592 Bacteria 1589
241 Ga0501077_0007167 3300049593 Bacteria 6875
242 Ga0501249_029504 3300049679 Bacteria 1220
243 Ga0501079_0012519 3300049741 Bacteria 6475
244 Ga0501079_0016959 3300049741 Bacteria 5564
245 Ga0501079_0177020 3300049741 Unclassified 1664
246 Ga0501079_0262752 3300049741 Bacteria 1349
247 Ga0501079_0743453 3300049741 Bacteria 772
248 Ga0501080_0049908 3300049742 Bacteria 3895
249 Ga0501080_0153857 3300049742 Unclassified 2125
250 Ga0501081_0010926 3300049743 Bacteria 5934
251 Ga0501045_0015020 3300049824 Bacteria 5496
252 nmdc:mga0yw44_774676_c1 3300050492 Bacteria 651
253 nmdc:mga06z11_74164_c1 3300050494 Bacteria 1808
254 nmdc:mga05p37_313590_c1 3300050507 Bacteria 1858
255 nmdc:mga0qj67_676846_c1 3300050509 Bacteria 822
256 nmdc:mga06r32_109840_c1 3300050510 Bacteria 2712
257 nmdc:mga08y16_114032_c1 3300050511 Bacteria 2813
258 nmdc:mga08y16_181972_c1 3300050511 Bacteria 2182
259 nmdc:mga08y16_374685_c1 3300050511 Bacteria 1460
260 nmdc:mga08y16_617514_c1 3300050511 Bacteria 1091
261 nmdc:mga08y16_862101_c1 3300050511 Bacteria 894
262 nmdc:mga0n895_27559_c1 3300050512 Bacteria 5399
263 nmdc:mga0n895_91156_c1 3300050512 Bacteria 3050
264 nmdc:mga0rr50_251660_c1 3300050513 Bacteria 1467
265 nmdc:mga0rr50_25845_c1 3300050513 Bacteria 4088
266 nmdc:mga0rr50_894626_c1 3300050513 Bacteria 757
267 nmdc:mga08x19_467741_c1 3300050514 Bacteria 888
268 nmdc:mga0a205_16237_c1 3300050515 Bacteria 6972
269 nmdc:mga0a205_384776_c1 3300050515 Bacteria 1268
270 Ga0500578_0269873 3300053086 Bacteria 1018
271 Ga0501084_0003545 3300054114 Bacteria 12672
272 Ga0501084_0060722 3300054114 Bacteria 3164
273 Ga0501084_0321340 3300054114 Bacteria 1307
274 Ga0501084_0564419 3300054114 Unclassified 962
275 Ga0501084_0677904 3300054114 Bacteria 870
276 Ga0501082_0297464 3300060353 Unclassified 1405
277 Ga0466962_0045728 3300061719 Bacteria 2092
278 Ga0530510_0007511 3300061734 Bacteria 7593
279 Ga0530510_0080937 3300061734 Bacteria 2364
280 Ga0530510_0541094 3300061734 Bacteria 884
281 Ga0501031_0469408
282 Ga0070683_100043869
283 Ga0070682_101066320
284 Ga0070687_100328124
285 Ga0070692_10011757
286 Ga0070674_100599573
287 Ga0070688_100009135
288 Ga0070659_100408662
289 Ga0070659_101609843
290 Ga0070703_10024982
291 Ga0070714_100171717
292 Ga0070713_100212314
293 Ga0070705_100066319
294 Ga0070705_101099775
295 Ga0070700_100051351
296 Ga0070700_100271122
297 Ga0070700_100509525
298 Ga0070678_100731822
299 Ga0070685_10047377
300 Ga0070698_100028595
301 Ga0070698_100579271
302 Ga0070684_100261112
303 Ga0068853_100047747
304 Ga0070686_100053443
305 Ga0070695_100213204
306 Ga0070695_100213725
307 Ga0070695_100308680
308 Ga0070693_100098931
309 Ga0070704_100579772
310 Ga0070704_100688339
311 Ga0068857_100107761
312 Ga0068856_100294007
313 Ga0068864_100711307
314 Ga0068861_101228349
315 Ga0081455_10083808
316 Ga0081538_10000002
317 Ga0081538_10052264
318 Ga0081539_10002554
319 Ga0075363_100127430
320 Ga0075432_10006385
321 Ga0070716_100213488
322 Ga0075367_10110599
323 Ga0097621_100134485
324 Ga0097621_100162208
325 Ga0068871_100114031
326 Ga0075428_100047082
327 Ga0075428_101524620
328 Ga0075430_100369528
329 Ga0075430_100585991
330 Ga0075431_100095855
331 Ga0075431_100930600
332 Ga0075433_10234066
333 Ga0075434_100020851
334 Ga0075434_100358193
335 Ga0111539_10088606
336 Ga0111539_10580207
337 Ga0111539_11111611
338 Ga0111539_11715046
339 Ga0111539_12496614
340 Ga0114129_10247933
341 Ga0114129_10372053
342 Ga0114129_11751639
343 Ga0105243_10488597
344 Ga0105241_10183792
345 Ga0105242_10143765
346 Ga0105249_10905991
347 Ga0105246_10129694
348 Ga0157378_10863713
349 Ga0157372_10113411
350 Ga0157375_10138165
351 Ga0157377_10362046
352 Ga0157376_10793118
353 Ga0163161_10238945
354 Ga0213876_10010046
355 Ga0207642_10035248
356 Ga0207654_10442795
357 Ga0207662_10407544
358 Ga0207694_10138428
359 Ga0207700_10198304
360 Ga0207664_10211752
361 Ga0207644_10629929
362 Ga0207686_10668517
363 Ga0207670_10167419
364 Ga0207669_10223288
365 Ga0207679_10581941
366 Ga0207667_10324503
367 Ga0207640_10392323
368 Ga0207640_10822577
369 Ga0207703_10972395
370 Ga0207708_10006026
371 Ga0207708_10200435
372 Ga0207708_10479497
373 Ga0207708_10734531
374 Ga0207648_10252184
375 Ga0207676_10665670
376 Ga0207674_10063942
377 Ga0207675_101067321
378 Ga0207698_10927238
379 Ga0207428_10125628
380 Ga0207428_10188131
381 Ga0265323_10070110
382 Ga0307515_10477155
383 Ga0265338_10010742
384 Ga0265324_10038208
385 Ga0265316_10153758
386 Ga0307513_10085402
387 Ga0265314_10062627
388 Ga0307405_10052110
389 Ga0307413_10069692
390 Ga0307413_10167806
391 Ga0307410_10057395
392 Ga0307410_10158329
393 Ga0307406_10017540
394 Ga0307407_10027128
395 Ga0307407_10088080
396 Ga0307407_10091714
397 Ga0307407_10681097
398 Ga0307412_10013154
399 Ga0307412_10120941
400 Ga0307409_100035761
401 Ga0307409_100235129
402 Ga0307409_100997868
403 Ga0307409_101070630
404 Ga0307416_100401227
405 Ga0307416_100415662
406 Ga0307416_100548427
407 Ga0307414_10799530
408 Ga0307414_11066966
409 Ga0307415_100053943
410 Ga0307415_100305346
411 Ga0307415_100331658
412 Ga0307415_100644964
413 Ga0307415_101468084
414 Ga0316583_10064312
415 Ga0373959_0013736
416 Ga0373932_0070473
417 Ga0373960_0088790
418 Ga0373927_0288079
419 Ga0395898_0647726
420 Ga0436364_0500133
421 Ga0395901_0716858
422 Ga0436365_0551324
423 Ga0439447_009436
424 Ga0451807_2313772
425 Ga0451849_0828638
426 Ga0466972_0000102
427 Ga0466965_0639319
428 Ga0466966_0188534
429 Ga0466963_0046061
430 Ga0466963_0056740
431 Ga0466963_0355432
432 Ga0466971_0015377
433 Ga0466957_0082532
434 Ga0466957_0154296
435 Ga0466957_0539114
436 Ga0466959_0688781
437 Ga0466959_0740792
438 Ga0451576_0778189
439 Ga0466958_0010455
440 Ga0466967_0326018
441 Ga0466967_0411262
442 Ga0466967_0846532
443 Ga0466967_1945642
444 Ga0495629_0071853
445 Ga0495582_0562255
446 Ga0495616_0079696
447 Ga0495631_0098027
448 Ga0495632_0179041
449 Ga0495668_0000831
450 Ga0495668_0397003
451 Ga0495647_0075497
452 Ga0495670_0682494
453 Ga0495671_0221971
454 Ga0495581_0616644
455 Ga0495676_0250314
456 Ga0496101_0501004
457 Ga0496104_0009884
458 Ga0496104_0638948
459 Ga0496104_1240905
460 Ga0496105_0028310
461 Ga0496105_0524131
462 Ga0496107_0747964
463 Ga0496108_0113714
464 Ga0496108_0448784
465 Ga0496108_0687301
466 Ga0496109_0072127
467 Ga0496109_0085780
468 Ga0496110_0347443
469 Ga0496111_0084679
470 Ga0496112_0014492
471 Ga0496112_0410020
472 Ga0496113_0241541
473 Ga0496126_0010299
474 Ga0501292_083427
475 Ga0501031_0021870
476 Ga0501031_0617445
477 Ga0501033_0072972
478 Ga0501033_0407982
479 Ga0501033_0420825
480 Ga0501036_0073365
481 Ga0501036_0462046
482 Ga0501037_0270423
483 Ga0501038_0027837
484 Ga0501039_0013236
485 Ga0501039_0164214
486 Ga0501040_0008323
487 Ga0501040_0075808
488 Ga0501041_0014533
489 Ga0501041_0028925
490 Ga0501041_0123355
491 Ga0501041_0412352
492 Ga0501042_0008174
493 Ga0501042_0106937
494 Ga0501042_0267815
495 Ga0501043_0806415
496 Ga0501048_0005451
497 Ga0501048_0054023
498 Ga0501067_0006991
499 Ga0501067_0156943
500 Ga0501068_0000157
501 Ga0501068_0023765
502 Ga0501068_0313224
503 Ga0501069_0001140
504 Ga0501070_0020433
505 Ga0501071_0029639
506 Ga0501071_0053640
507 Ga0501071_0071662
508 Ga0501072_0012891
509 Ga0501072_0095719
510 Ga0501072_0156983
511 Ga0501073_0595503
512 Ga0501074_0057547
513 Ga0501074_0100275
514 Ga0501075_0002182
515 Ga0501075_0089235
516 Ga0501075_0256317
517 Ga0501076_0004049
518 Ga0501076_0027172
519 Ga0501076_0089616
520 Ga0501076_0210455
521 Ga0501077_0007167
522 Ga0501249_029504
523 Ga0501079_0012519
524 Ga0501079_0016959
525 Ga0501079_0177020
526 Ga0501079_0262752
527 Ga0501079_0743453
528 Ga0501080_0049908
529 Ga0501080_0153857
530 Ga0501081_0010926
531 Ga0501045_0015020
532 nmdc:mga0yw44_774676_c1
533 nmdc:mga06z11_74164_c1
534 nmdc:mga05p37_313590_c1
535 nmdc:mga0qj67_676846_c1
536 nmdc:mga06r32_109840_c1
537 nmdc:mga08y16_114032_c1
538 nmdc:mga08y16_181972_c1
539 nmdc:mga08y16_374685_c1
540 nmdc:mga08y16_617514_c1
541 nmdc:mga08y16_862101_c1
542 nmdc:mga0n895_27559_c1
543 nmdc:mga0n895_91156_c1
544 nmdc:mga0rr50_251660_c1
545 nmdc:mga0rr50_25845_c1
546 nmdc:mga0rr50_894626_c1
547 nmdc:mga08x19_467741_c1
548 nmdc:mga0a205_16237_c1
549 nmdc:mga0a205_384776_c1
550 Ga0500578_0269873
551 Ga0501084_0003545
552 Ga0501084_0060722
553 Ga0501084_0321340
554 Ga0501084_0564419
555 Ga0501084_0677904
556 Ga0501082_0297464
557 Ga0466962_0045728
558 Ga0530510_0007511
559 Ga0530510_0080937
560 Ga0530510_0541094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

56

178

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

51

165

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

87

167

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.8408 106 158
2evn-assembly1.cif.gz_A nmr solution structures of at1g77540 0.8284 64 109
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.8167 106 158
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8116 1 131
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8092 1 131
ID Description Score Start End Superfamily
3pp9C00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8793 50 131 3.40.630.30
af_Q6ES10_187_273_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8743 62 102 3.40.630.30
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8557 54 131 3.40.630.30
af_Q2G1V1_1_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8469 1 131 3.40.630.30
af_Q3Y3Z9_160_298_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.8455 1 98 3.40.630.90
ID Description Score Start End GO Terms
AF-A0A831NZJ2-F1-model_v4 N-acetyltransferase 0.9888 57 158 GO:0016747
AF-A0A524ALY6-F1-model_v4 N-acetyltransferase 0.9787 38 158 GO:0016747
AF-A0A2S6QC87-F1-model_v4 N-acetyltransferase domain-containing protein 0.9763 1 158 GO:0016747
AF-A0A382QNW2-F1-model_v4 N-acetyltransferase domain-containing protein 0.9762 55 158 GO:0016747
AF-A0A7Y8L4Y3-F1-model_v4 GNAT family N-acetyltransferase 0.9756 2 159 GO:0016747

Map