F383854

General Info

Members Datasets Scaffolds Average Seq Length
280 164 560 172

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0968859|Ga0451576_0968859_244_873
Length 209
Sequence MRLSCRDVTNRPVQSNDGSYCSRHDKLKHIGHRKGRIMDLTDVKHLFDYTEWANELAMEAAGKLPNDQLRRDFGISHKSIFGTLLHMAGAEWIWLERWNGRSPAKAEAWSQWTTESCADLPMLKERWNGVIHNRNRYVSQLADSNLADELAFKLLSGDPSSMRLVHQMQHVVNHSTMHRGQVVGMIRQLGIDPPSTDLLFYVRRDISPK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
145 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
146 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
149 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
150 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
151 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
152 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
153 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
154 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
155 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
158 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
159 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
160 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.29
Stem 0
Stem Tuber 0
Unclassified 28.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0968859 3300045051 Unclassified 892
2 Ga0065712_10004609 3300005290 Bacteria 5426
3 Ga0065715_10109296 3300005293 Bacteria 2674
4 Ga0065715_10168167 3300005293 Unclassified 1569
5 Ga0065707_10002031 3300005295 Bacteria 6587
6 Ga0065707_10243777 3300005295 Bacteria 1147
7 Ga0070676_10030114 3300005328 Bacteria 3093
8 Ga0070690_100680773 3300005330 Unclassified 788
9 Ga0070677_10047055 3300005333 Bacteria 1727
10 Ga0070677_10714758 3300005333 Unclassified 565
11 Ga0068869_100006674 3300005334 Bacteria 7330
12 Ga0068869_100015000 3300005334 Bacteria 5184
13 Ga0068869_100115472 3300005334 Bacteria 2047
14 Ga0068869_100367736 3300005334 Unclassified 1176
15 Ga0068869_100550234 3300005334 Bacteria 969
16 Ga0070680_100050160 3300005336 Bacteria 3404
17 Ga0070682_100063356 3300005337 Bacteria 2344
18 Ga0070689_100001880 3300005340 Bacteria 13550
19 Ga0070687_100029182 3300005343 Unclassified 2684
20 Ga0070692_10001359 3300005345 Bacteria 8821
21 Ga0070692_10592475 3300005345 Bacteria 732
22 Ga0070669_100123932 3300005353 Bacteria 1975
23 Ga0070675_100446533 3300005354 Bacteria 1159
24 Ga0070673_100174215 3300005364 Bacteria 1838
25 Ga0070659_100179667 3300005366 Bacteria 1736
26 Ga0070667_100149186 3300005367 Bacteria 2053
27 Ga0070709_10486585 3300005434 Unclassified 935
28 Ga0070705_100170188 3300005440 Bacteria 1465
29 Ga0070705_100287318 3300005440 Unclassified 1172
30 Ga0070705_100561505 3300005440 Unclassified 877
31 Ga0070700_100064718 3300005441 Bacteria 2316
32 Ga0070700_100812160 3300005441 Unclassified 754
33 Ga0070694_100005639 3300005444 Bacteria 7586
34 Ga0070694_100091030 3300005444 Bacteria 2140
35 Ga0070694_101212702 3300005444 Unclassified 633
36 Ga0070708_100113623 3300005445 Bacteria 2491
37 Ga0070708_100935772 3300005445 Unclassified 813
38 Ga0070678_100143675 3300005456 Bacteria 1913
39 Ga0070662_100014331 3300005457 Bacteria 5294
40 Ga0070681_10001093 3300005458 Bacteria 23170
41 Ga0068867_100115246 3300005459 Bacteria 2070
42 Ga0070685_10741134 3300005466 Unclassified 719
43 Ga0070706_100087986 3300005467 Bacteria 2880
44 Ga0070706_100216897 3300005467 Bacteria 1786
45 Ga0070707_100149753 3300005468 Bacteria 2272
46 Ga0070698_100001290 3300005471 Bacteria 27930
47 Ga0070698_100085770 3300005471 Bacteria 3135
48 Ga0070698_100219314 3300005471 Bacteria 1836
49 Ga0070698_100374393 3300005471 Bacteria 1356
50 Ga0070699_100001232 3300005518 Bacteria 23609
51 Ga0070699_100201453 3300005518 Bacteria 1770
52 Ga0070699_101366137 3300005518 Bacteria 650
53 Ga0070679_100002210 3300005530 Bacteria 17565
54 Ga0070697_100000330 3300005536 Bacteria 37281
55 Ga0070697_100042385 3300005536 Bacteria 3683
56 Ga0070697_100151781 3300005536 Bacteria 1953
57 Ga0070672_100016193 3300005543 Bacteria 5333
58 Ga0070695_100262996 3300005545 Bacteria 1261
59 Ga0070696_100053655 3300005546 Unclassified 2807
60 Ga0070696_100090572 3300005546 Bacteria 2176
61 Ga0070696_100110537 3300005546 Bacteria 1979
62 Ga0070696_100225658 3300005546 Unclassified 1407
63 Ga0070696_100421665 3300005546 Unclassified 1048
64 Ga0070693_100434292 3300005547 Unclassified 918
65 Ga0070704_100116162 3300005549 Bacteria 2046
66 Ga0070664_100088162 3300005564 Bacteria 2683
67 Ga0068857_100241542 3300005577 Bacteria 1654
68 Ga0068854_100196735 3300005578 Bacteria 1582
69 Ga0068854_100230983 3300005578 Unclassified 1468
70 Ga0070702_100373446 3300005615 Unclassified 1012
71 Ga0070702_100703728 3300005615 Bacteria 770
72 Ga0068859_100256325 3300005617 Bacteria 1840
73 Ga0068864_100017282 3300005618 Bacteria 6012
74 Ga0068864_100146324 3300005618 Bacteria 2136
75 Ga0068864_100208393 3300005618 Bacteria 1799
76 Ga0068864_100846778 3300005618 Bacteria 901
77 Ga0068864_101245068 3300005618 Unclassified 743
78 Ga0068861_100120804 3300005719 Bacteria 2113
79 Ga0068861_100184010 3300005719 Bacteria 1741
80 Ga0068861_100711763 3300005719 Unclassified 934
81 Ga0068861_101615869 3300005719 Unclassified 639
82 Ga0068870_10007053 3300005840 Bacteria 4990
83 Ga0068870_10078819 3300005840 Bacteria 1815
84 Ga0068870_10315827 3300005840 Unclassified 991
85 Ga0068860_100034448 3300005843 Bacteria 4857
86 Ga0068860_100067468 3300005843 Bacteria 3399
87 Ga0068862_100018536 3300005844 Bacteria 5797
88 Ga0068862_100035489 3300005844 Unclassified 4223
89 Ga0068862_100382865 3300005844 Bacteria 1312
90 Ga0068862_100494194 3300005844 Bacteria 1160
91 Ga0068862_100738493 3300005844 Bacteria 957
92 Ga0081455_10284186 3300005937 Bacteria 1194
93 Ga0070715_10000016 3300006163 Bacteria 134692
94 Ga0070716_100000002 3300006173 Bacteria 396037
95 Ga0070716_101001438 3300006173 Unclassified 661
96 Ga0097621_100356772 3300006237 Unclassified 1301
97 Ga0075433_10081119 3300006852 Bacteria 2860
98 Ga0075433_10217290 3300006852 Unclassified 1698
99 Ga0075433_10221486 3300006852 Unclassified 1681
100 Ga0075433_10495061 3300006852 Bacteria 1076
101 Ga0075433_10787611 3300006852 Bacteria 831
102 Ga0075434_100339879 3300006871 Bacteria 1522
103 Ga0075434_101384142 3300006871 Unclassified 714
104 Ga0075434_101440058 3300006871 Unclassified 699
105 Ga0075429_100776614 3300006880 Unclassified 839
106 Ga0075429_100924944 3300006880 Unclassified 763
107 Ga0068865_100208367 3300006881 Bacteria 1522
108 Ga0075436_100198937 3300006914 Bacteria 1419
109 Ga0097620_100256337 3300006931 Bacteria 1840
110 Ga0075435_100013129 3300007076 Bacteria 6153
111 Ga0075435_100795180 3300007076 Unclassified 823
112 Ga0099794_10065117 3300007265 Bacteria 1777
113 Ga0099794_10071268 3300007265 Bacteria 1702
114 Ga0099795_10280798 3300007788 Unclassified 727
115 Ga0105240_10192639 3300009093 Unclassified 2396
116 Ga0105240_10412623 3300009093 Bacteria 1519
117 Ga0111539_10037968 3300009094 Bacteria 5810
118 Ga0111539_10160514 3300009094 Bacteria 2629
119 Ga0105247_10471998 3300009101 Bacteria 909
120 Ga0114129_10010499 3300009147 Bacteria 13212
121 Ga0114129_10560459 3300009147 Unclassified 1485
122 Ga0114129_10920875 3300009147 Unclassified 1106
123 Ga0114129_11021448 3300009147 Unclassified 1040
124 Ga0105243_10047830 3300009148 Bacteria 3370
125 Ga0105243_10112131 3300009148 Bacteria 2284
126 Ga0105243_10121233 3300009148 Unclassified 2205
127 Ga0105243_10240927 3300009148 Bacteria 1609
128 Ga0105243_10288295 3300009148 Unclassified 1482
129 Ga0105243_10809117 3300009148 Unclassified 924
130 Ga0105241_10044183 3300009174 Bacteria 3376
131 Ga0105242_10455838 3300009176 Unclassified 1207
132 Ga0105242_10467387 3300009176 Bacteria 1192
133 Ga0105248_11190925 3300009177 Bacteria 861
134 Ga0105248_11503709 3300009177 Unclassified 762
135 Ga0105248_11888213 3300009177 Unclassified 678
136 Ga0105237_11090745 3300009545 Unclassified 805
137 Ga0105249_10503873 3300009553 Bacteria 1256
138 Ga0105249_10909780 3300009553 Unclassified 947
139 Ga0105239_10761497 3300010375 Bacteria 1108
140 Ga0105246_10017865 3300011119 Bacteria 4513
141 Ga0105246_10454548 3300011119 Bacteria 1077
142 Ga0105246_10543228 3300011119 Unclassified 994
143 Ga0157373_10007604 3300013100 Bacteria 8054
144 Ga0157371_10250377 3300013102 Unclassified 1275
145 Ga0157374_10529367 3300013296 Unclassified 1185
146 Ga0157378_10083290 3300013297 Bacteria 2894
147 Ga0157378_10196342 3300013297 Bacteria 1906
148 Ga0157378_10412262 3300013297 Bacteria 1333
149 Ga0157378_10541261 3300013297 Bacteria 1168
150 Ga0157378_10567441 3300013297 Bacteria 1142
151 Ga0157378_11735850 3300013297 Bacteria 672
152 Ga0163162_10216814 3300013306 Bacteria 2044
153 Ga0163162_10775930 3300013306 Unclassified 1077
154 Ga0163162_12300533 3300013306 Unclassified 619
155 Ga0157372_10003470 3300013307 Bacteria 17007
156 Ga0157375_10203077 3300013308 Bacteria 2138
157 Ga0163163_10031573 3300014325 Bacteria 5113
158 Ga0163163_10052334 3300014325 Bacteria 4029
159 Ga0163163_10079494 3300014325 Bacteria 3277
160 Ga0163163_10549298 3300014325 Bacteria 1218
161 Ga0157380_10026979 3300014326 Bacteria 4364
162 Ga0157380_10132556 3300014326 Bacteria 2128
163 Ga0157380_10945326 3300014326 Unclassified 891
164 Ga0157380_11269955 3300014326 Bacteria 782
165 Ga0157377_10362418 3300014745 Unclassified 976
166 Ga0157379_10464326 3300014968 Bacteria 1170
167 Ga0157376_10276080 3300014969 Bacteria 1581
168 Ga0163161_10007550 3300017792 Bacteria 7519
169 Ga0213876_10000599 3300021384 Bacteria 26722
170 Ga0207697_10098725 3300025315 Bacteria 1243
171 Ga0207685_10000055 3300025905 Bacteria 35384
172 Ga0207699_10505404 3300025906 Unclassified 873
173 Ga0207645_10015784 3300025907 Bacteria 5007
174 Ga0207643_10004031 3300025908 Bacteria 7904
175 Ga0207643_10009255 3300025908 Bacteria 5291
176 Ga0207643_10346891 3300025908 Unclassified 931
177 Ga0207684_10040228 3300025910 Bacteria 3964
178 Ga0207654_10086819 3300025911 Bacteria 1897
179 Ga0207654_10698634 3300025911 Bacteria 729
180 Ga0207707_10000015 3300025912 Bacteria 259670
181 Ga0207695_10195628 3300025913 Bacteria 1938
182 Ga0207660_10009486 3300025917 Bacteria 6300
183 Ga0207660_10018900 3300025917 Bacteria 4602
184 Ga0207662_10393717 3300025918 Unclassified 938
185 Ga0207662_10520867 3300025918 Bacteria 821
186 Ga0207652_10002007 3300025921 Bacteria 17575
187 Ga0207646_10144465 3300025922 Bacteria 2144
188 Ga0207681_10230126 3300025923 Bacteria 1438
189 Ga0207681_10448677 3300025923 Unclassified 1049
190 Ga0207650_10282770 3300025925 Bacteria 1351
191 Ga0207687_10110752 3300025927 Bacteria 2037
192 Ga0207644_10352797 3300025931 Unclassified 1195
193 Ga0207690_10994065 3300025932 Unclassified 698
194 Ga0207706_10021612 3300025933 Bacteria 5778
195 Ga0207686_10068672 3300025934 Bacteria 2271
196 Ga0207686_10249216 3300025934 Bacteria 1297
197 Ga0207709_10080139 3300025935 Bacteria 2102
198 Ga0207709_10426152 3300025935 Unclassified 1020
199 Ga0207670_10004439 3300025936 Bacteria 7556
200 Ga0207704_10675114 3300025938 Bacteria 853
201 Ga0207665_10000004 3300025939 Bacteria 218220
202 Ga0207691_10012596 3300025940 Bacteria 8107
203 Ga0207689_10020149 3300025942 Bacteria 5618
204 Ga0207689_10027734 3300025942 Bacteria 4739
205 Ga0207689_10084164 3300025942 Bacteria 2615
206 Ga0207689_10323487 3300025942 Bacteria 1280
207 Ga0207689_10770182 3300025942 Unclassified 812
208 Ga0207689_11243704 3300025942 Unclassified 626
209 Ga0207679_10253228 3300025945 Bacteria 1498
210 Ga0207679_10845742 3300025945 Unclassified 836
211 Ga0207651_10340427 3300025960 Unclassified 1260
212 Ga0207651_10355148 3300025960 Unclassified 1235
213 Ga0207712_10084831 3300025961 Bacteria 2316
214 Ga0207640_10180260 3300025981 Unclassified 1583
215 Ga0207640_10208948 3300025981 Unclassified 1485
216 Ga0207640_10816243 3300025981 Unclassified 809
217 Ga0207658_10367299 3300025986 Unclassified 1257
218 Ga0207677_10588021 3300026023 Unclassified 975
219 Ga0207703_10822522 3300026035 Unclassified 887
220 Ga0207708_10023126 3300026075 Bacteria 4696
221 Ga0207708_10065414 3300026075 Bacteria 2779
222 Ga0207641_11104203 3300026088 Bacteria 792
223 Ga0207648_10151668 3300026089 Bacteria 2045
224 Ga0207648_11261969 3300026089 Bacteria 694
225 Ga0207676_10007689 3300026095 Bacteria 7657
226 Ga0207676_10028526 3300026095 Bacteria 4171
227 Ga0207676_10241555 3300026095 Bacteria 1620
228 Ga0207676_10338129 3300026095 Bacteria 1388
229 Ga0207676_10450490 3300026095 Bacteria 1213
230 Ga0207674_10139936 3300026116 Bacteria 2380
231 Ga0207675_100071321 3300026118 Bacteria 3248
232 Ga0207675_100383306 3300026118 Bacteria 1383
233 Ga0207675_101278183 3300026118 Unclassified 754
234 Ga0207683_10054601 3300026121 Bacteria 3503
235 Ga0207428_10311800 3300027907 Bacteria 1163
236 Ga0268265_10111088 3300028380 Bacteria 2238
237 Ga0268265_10127594 3300028380 Bacteria 2108
238 Ga0268265_10561131 3300028380 Bacteria 1085
239 Ga0268265_12114185 3300028380 Unclassified 570
240 Ga0268264_10092599 3300028381 Bacteria 2609
241 Ga0268264_11061427 3300028381 Bacteria 818
242 Ga0307412_10296020 3300031911 Bacteria 1277
243 Ga0395905_1226514 3300037471 Bacteria 654
244 Ga0242420_000359 3300038996 Bacteria 5019
245 Ga0436365_0897134 3300039437 Bacteria 23856
246 Ga0439453_0057304 3300041408 Unclassified 800
247 Ga0453683_0083082 3300044673 Bacteria 2007
248 Ga0495662_0033135 3300046476 Bacteria 2497
249 Ga0495630_0173409 3300046517 Bacteria 1644
250 Ga0495586_0045280 3300046535 Bacteria 2371
251 Ga0495621_0099742 3300046539 Unclassified 1104
252 Ga0495636_0036674 3300047318 Bacteria 2023
253 Ga0495684_0713527 3300047471 Bacteria 664
254 Ga0501291_116874 3300049514 Bacteria 574
255 Ga0501292_032052 3300049515 Bacteria 886
256 Ga0501296_025498 3300049519 Unclassified 775
257 Ga0501298_077790 3300049521 Bacteria 725
258 Ga0501202_062272 3300049652 Bacteria 846
259 Ga0501217_044969 3300049661 Bacteria 1136
260 Ga0501223_050242 3300049663 Bacteria 809
261 Ga0501224_011870 3300049664 Unclassified 1282
262 Ga0501230_116837 3300049667 Bacteria 587
263 Ga0501233_037972 3300049668 Bacteria 1120
264 Ga0501236_007758 3300049670 Unclassified 1349
265 Ga0501240_039117 3300049673 Bacteria 783
266 Ga0501225_0010520 3300049705 Bacteria 2619
267 Ga0501229_004633 3300049706 Bacteria 1673
268 Ga0501241_040101 3300049758 Bacteria 905
269 Ga0501279_042066 3300049775 Bacteria 704
270 Ga0501212_006200 3300049851 Unclassified 1606
271 nmdc:mga05p37_202770_c1 3300050507 Bacteria 2401
272 nmdc:mga05p37_315639_c2 3300050507 Bacteria 1325
273 nmdc:mga05p37_775201_c1 3300050507 Bacteria 1053
274 nmdc:mga09592_432647_c1 3300050508 Bacteria 1136
275 nmdc:mga08y16_21643_c1 3300050511 Bacteria 6789
276 nmdc:mga0a205_234772_c1 3300050515 Bacteria 1716
277 nmdc:mga0a205_25289_c1 3300050515 Bacteria 5654
278 nmdc:mga0a205_494667_c1 3300050515 Bacteria 1080
279 nmdc:mga0a205_654104_c1 3300050515 Bacteria 902
280 nmdc:mga0a205_840827_c1 3300050515 Unclassified 765
281 Ga0451576_0968859
282 Ga0065712_10004609
283 Ga0065715_10109296
284 Ga0065715_10168167
285 Ga0065707_10002031
286 Ga0065707_10243777
287 Ga0070676_10030114
288 Ga0070690_100680773
289 Ga0070677_10047055
290 Ga0070677_10714758
291 Ga0068869_100006674
292 Ga0068869_100015000
293 Ga0068869_100115472
294 Ga0068869_100367736
295 Ga0068869_100550234
296 Ga0070680_100050160
297 Ga0070682_100063356
298 Ga0070689_100001880
299 Ga0070687_100029182
300 Ga0070692_10001359
301 Ga0070692_10592475
302 Ga0070669_100123932
303 Ga0070675_100446533
304 Ga0070673_100174215
305 Ga0070659_100179667
306 Ga0070667_100149186
307 Ga0070709_10486585
308 Ga0070705_100170188
309 Ga0070705_100287318
310 Ga0070705_100561505
311 Ga0070700_100064718
312 Ga0070700_100812160
313 Ga0070694_100005639
314 Ga0070694_100091030
315 Ga0070694_101212702
316 Ga0070708_100113623
317 Ga0070708_100935772
318 Ga0070678_100143675
319 Ga0070662_100014331
320 Ga0070681_10001093
321 Ga0068867_100115246
322 Ga0070685_10741134
323 Ga0070706_100087986
324 Ga0070706_100216897
325 Ga0070707_100149753
326 Ga0070698_100001290
327 Ga0070698_100085770
328 Ga0070698_100219314
329 Ga0070698_100374393
330 Ga0070699_100001232
331 Ga0070699_100201453
332 Ga0070699_101366137
333 Ga0070679_100002210
334 Ga0070697_100000330
335 Ga0070697_100042385
336 Ga0070697_100151781
337 Ga0070672_100016193
338 Ga0070695_100262996
339 Ga0070696_100053655
340 Ga0070696_100090572
341 Ga0070696_100110537
342 Ga0070696_100225658
343 Ga0070696_100421665
344 Ga0070693_100434292
345 Ga0070704_100116162
346 Ga0070664_100088162
347 Ga0068857_100241542
348 Ga0068854_100196735
349 Ga0068854_100230983
350 Ga0070702_100373446
351 Ga0070702_100703728
352 Ga0068859_100256325
353 Ga0068864_100017282
354 Ga0068864_100146324
355 Ga0068864_100208393
356 Ga0068864_100846778
357 Ga0068864_101245068
358 Ga0068861_100120804
359 Ga0068861_100184010
360 Ga0068861_100711763
361 Ga0068861_101615869
362 Ga0068870_10007053
363 Ga0068870_10078819
364 Ga0068870_10315827
365 Ga0068860_100034448
366 Ga0068860_100067468
367 Ga0068862_100018536
368 Ga0068862_100035489
369 Ga0068862_100382865
370 Ga0068862_100494194
371 Ga0068862_100738493
372 Ga0081455_10284186
373 Ga0070715_10000016
374 Ga0070716_100000002
375 Ga0070716_101001438
376 Ga0097621_100356772
377 Ga0075433_10081119
378 Ga0075433_10217290
379 Ga0075433_10221486
380 Ga0075433_10495061
381 Ga0075433_10787611
382 Ga0075434_100339879
383 Ga0075434_101384142
384 Ga0075434_101440058
385 Ga0075429_100776614
386 Ga0075429_100924944
387 Ga0068865_100208367
388 Ga0075436_100198937
389 Ga0097620_100256337
390 Ga0075435_100013129
391 Ga0075435_100795180
392 Ga0099794_10065117
393 Ga0099794_10071268
394 Ga0099795_10280798
395 Ga0105240_10192639
396 Ga0105240_10412623
397 Ga0111539_10037968
398 Ga0111539_10160514
399 Ga0105247_10471998
400 Ga0114129_10010499
401 Ga0114129_10560459
402 Ga0114129_10920875
403 Ga0114129_11021448
404 Ga0105243_10047830
405 Ga0105243_10112131
406 Ga0105243_10121233
407 Ga0105243_10240927
408 Ga0105243_10288295
409 Ga0105243_10809117
410 Ga0105241_10044183
411 Ga0105242_10455838
412 Ga0105242_10467387
413 Ga0105248_11190925
414 Ga0105248_11503709
415 Ga0105248_11888213
416 Ga0105237_11090745
417 Ga0105249_10503873
418 Ga0105249_10909780
419 Ga0105239_10761497
420 Ga0105246_10017865
421 Ga0105246_10454548
422 Ga0105246_10543228
423 Ga0157373_10007604
424 Ga0157371_10250377
425 Ga0157374_10529367
426 Ga0157378_10083290
427 Ga0157378_10196342
428 Ga0157378_10412262
429 Ga0157378_10541261
430 Ga0157378_10567441
431 Ga0157378_11735850
432 Ga0163162_10216814
433 Ga0163162_10775930
434 Ga0163162_12300533
435 Ga0157372_10003470
436 Ga0157375_10203077
437 Ga0163163_10031573
438 Ga0163163_10052334
439 Ga0163163_10079494
440 Ga0163163_10549298
441 Ga0157380_10026979
442 Ga0157380_10132556
443 Ga0157380_10945326
444 Ga0157380_11269955
445 Ga0157377_10362418
446 Ga0157379_10464326
447 Ga0157376_10276080
448 Ga0163161_10007550
449 Ga0213876_10000599
450 Ga0207697_10098725
451 Ga0207685_10000055
452 Ga0207699_10505404
453 Ga0207645_10015784
454 Ga0207643_10004031
455 Ga0207643_10009255
456 Ga0207643_10346891
457 Ga0207684_10040228
458 Ga0207654_10086819
459 Ga0207654_10698634
460 Ga0207707_10000015
461 Ga0207695_10195628
462 Ga0207660_10009486
463 Ga0207660_10018900
464 Ga0207662_10393717
465 Ga0207662_10520867
466 Ga0207652_10002007
467 Ga0207646_10144465
468 Ga0207681_10230126
469 Ga0207681_10448677
470 Ga0207650_10282770
471 Ga0207687_10110752
472 Ga0207644_10352797
473 Ga0207690_10994065
474 Ga0207706_10021612
475 Ga0207686_10068672
476 Ga0207686_10249216
477 Ga0207709_10080139
478 Ga0207709_10426152
479 Ga0207670_10004439
480 Ga0207704_10675114
481 Ga0207665_10000004
482 Ga0207691_10012596
483 Ga0207689_10020149
484 Ga0207689_10027734
485 Ga0207689_10084164
486 Ga0207689_10323487
487 Ga0207689_10770182
488 Ga0207689_11243704
489 Ga0207679_10253228
490 Ga0207679_10845742
491 Ga0207651_10340427
492 Ga0207651_10355148
493 Ga0207712_10084831
494 Ga0207640_10180260
495 Ga0207640_10208948
496 Ga0207640_10816243
497 Ga0207658_10367299
498 Ga0207677_10588021
499 Ga0207703_10822522
500 Ga0207708_10023126
501 Ga0207708_10065414
502 Ga0207641_11104203
503 Ga0207648_10151668
504 Ga0207648_11261969
505 Ga0207676_10007689
506 Ga0207676_10028526
507 Ga0207676_10241555
508 Ga0207676_10338129
509 Ga0207676_10450490
510 Ga0207674_10139936
511 Ga0207675_100071321
512 Ga0207675_100383306
513 Ga0207675_101278183
514 Ga0207683_10054601
515 Ga0207428_10311800
516 Ga0268265_10111088
517 Ga0268265_10127594
518 Ga0268265_10561131
519 Ga0268265_12114185
520 Ga0268264_10092599
521 Ga0268264_11061427
522 Ga0307412_10296020
523 Ga0395905_1226514
524 Ga0242420_000359
525 Ga0436365_0897134
526 Ga0439453_0057304
527 Ga0453683_0083082
528 Ga0495662_0033135
529 Ga0495630_0173409
530 Ga0495586_0045280
531 Ga0495621_0099742
532 Ga0495636_0036674
533 Ga0495684_0713527
534 Ga0501291_116874
535 Ga0501292_032052
536 Ga0501296_025498
537 Ga0501298_077790
538 Ga0501202_062272
539 Ga0501217_044969
540 Ga0501223_050242
541 Ga0501224_011870
542 Ga0501230_116837
543 Ga0501233_037972
544 Ga0501236_007758
545 Ga0501240_039117
546 Ga0501225_0010520
547 Ga0501229_004633
548 Ga0501241_040101
549 Ga0501279_042066
550 Ga0501212_006200
551 nmdc:mga05p37_202770_c1
552 nmdc:mga05p37_315639_c2
553 nmdc:mga05p37_775201_c1
554 nmdc:mga09592_432647_c1
555 nmdc:mga08y16_21643_c1
556 nmdc:mga0a205_234772_c1
557 nmdc:mga0a205_25289_c1
558 nmdc:mga0a205_494667_c1
559 nmdc:mga0a205_654104_c1
560 nmdc:mga0a205_840827_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

49

182

0.92

PF05163

DinB

DinB family

38

207

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe9-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.8847 3 160
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8459 6 158
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8379 6 149
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8259 6 158
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8071 6 149
ID Description Score Start End Superfamily
af_Q59000_198_384_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8683 111 145 3.40.50.10490
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7971 6 154 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7901 9 160 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7718 6 154 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7318 11 148 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1Q7R0T4-F1-model_v4 Damage-inducible protein DinB 0.9748 1 167
AF-A0A2M8PSL7-F1-model_v4 Damage-inducible protein DinB 0.9689 1 167
AF-A0A7V1Q396-F1-model_v4 DUF664 domain-containing protein 0.967 1 168
AF-A0A2V9MEX3-F1-model_v4 Damage-inducible protein DinB 0.967 1 168
AF-A0A7Y4UGD4-F1-model_v4 DUF664 domain-containing protein 0.9659 1 165

Map