F383700

General Info

Members Datasets Scaffolds Average Seq Length
280 208 560 159

Family's Representative Sequence

Representative Sequence 3300021441|Ga0213871_10017691|Ga0213871_100176912
Length 169
Sequence MAPDYLFRPMQIDDLPLIRRWLALPHVRQWWGDPAEQYALVSGDLNEPAIDQYVVETDGRAFAYLQCYELTAWNSGFGAQPEGTRGIDLFIGEPDMIGHGSALIGRFVRDGLQQGVRRIVTDPDPTNLRAIRAYEKAGFAPDRIVETPDGPALLMVHDIRPLVMTPFPS

Samples

Sample ID Description Type Environment
1 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
47 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
178 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
179 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
180 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
181 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
182 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
183 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
184 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
185 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
186 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
187 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
188 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
189 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
190 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
191 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
192 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
193 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
194 2904699407
195 2906610324
196 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
197 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
198 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
199 2922425934
200 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
201 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
202 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
203 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
204 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
205 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
206 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
207 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
208 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.61
Metatranscriptomes 0
Isolates 9.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.07
Nodule 8.21
Rhizoplane 11.07
Rhizosphere 66.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213871_10017691 3300021441 Bacteria 1734
2 JGI25404J52841_10022307 3300003659 Bacteria 1368
3 JGI25404J52841_10068123 3300003659 Bacteria 744
4 Ga0065715_10284941 3300005293 Bacteria 1029
5 Ga0070658_10073543 3300005327 Bacteria 2803
6 Ga0070658_11304009 3300005327 Bacteria 631
7 Ga0070683_100820612 3300005329 Bacteria 892
8 Ga0070682_100144957 3300005337 Bacteria 1623
9 Ga0068868_100019259 3300005338 Bacteria 5112
10 Ga0070669_100460263 3300005353 Bacteria 1050
11 Ga0070675_100314371 3300005354 Bacteria 1383
12 Ga0070671_100513106 3300005355 Bacteria 1032
13 Ga0070674_100904229 3300005356 Bacteria 769
14 Ga0070673_101939380 3300005364 Bacteria 559
15 Ga0070659_100028298 3300005366 Bacteria 4327
16 Ga0070659_100602799 3300005366 Bacteria 944
17 Ga0070710_10204404 3300005437 Bacteria 1249
18 Ga0070663_100001666 3300005455 Bacteria 12295
19 Ga0070678_100082654 3300005456 Bacteria 2439
20 Ga0070681_10046167 3300005458 Bacteria 4356
21 Ga0070681_10089770 3300005458 Bacteria 3024
22 Ga0070681_10105952 3300005458 Bacteria 2753
23 Ga0068867_100139727 3300005459 Bacteria 1892
24 Ga0070698_100127487 3300005471 Bacteria 2502
25 Ga0070679_100014541 3300005530 Bacteria 7561
26 Ga0070679_100074010 3300005530 Bacteria 3397
27 Ga0070679_100567912 3300005530 Bacteria 1078
28 Ga0070684_100388627 3300005535 Bacteria 1286
29 Ga0068853_100401988 3300005539 Bacteria 1282
30 Ga0068853_100751719 3300005539 Bacteria 932
31 Ga0070693_100082798 3300005547 Bacteria 1916
32 Ga0070693_100128464 3300005547 Bacteria 1581
33 Ga0070665_100200915 3300005548 Bacteria 1994
34 Ga0068855_100178353 3300005563 Bacteria 2403
35 Ga0068855_100192675 3300005563 Bacteria 2298
36 Ga0068855_100325551 3300005563 Bacteria 1698
37 Ga0070664_100383872 3300005564 Bacteria 1283
38 Ga0070664_100887078 3300005564 Bacteria 836
39 Ga0068857_101460929 3300005577 Bacteria 666
40 Ga0068854_100287827 3300005578 Bacteria 1325
41 Ga0068854_100918409 3300005578 Bacteria 770
42 Ga0068854_101180454 3300005578 Bacteria 685
43 Ga0068856_100089450 3300005614 Bacteria 3062
44 Ga0068856_101402929 3300005614 Bacteria 713
45 Ga0070702_100396541 3300005615 Bacteria 986
46 Ga0070702_101161935 3300005615 Bacteria 620
47 Ga0068852_100585507 3300005616 Bacteria 1119
48 Ga0068852_102185254 3300005616 Bacteria 575
49 Ga0068864_100211856 3300005618 Bacteria 1784
50 Ga0068851_10185108 3300005834 Bacteria 1155
51 Ga0068870_10057468 3300005840 Bacteria 2080
52 Ga0068863_100939625 3300005841 Bacteria 866
53 Ga0068858_101387223 3300005842 Bacteria 692
54 Ga0081540_1005183 3300005983 Bacteria 9759
55 Ga0081540_1007567 3300005983 Bacteria 7722
56 Ga0081540_1046515 3300005983 Bacteria 2190
57 Ga0081540_1059198 3300005983 Bacteria 1840
58 Ga0075363_100077797 3300006048 Bacteria 1811
59 Ga0070715_10368270 3300006163 Bacteria 790
60 Ga0070712_100014754 3300006175 Bacteria 5018
61 Ga0075362_10309743 3300006177 Bacteria 785
62 Ga0075367_10369432 3300006178 Bacteria 906
63 Ga0075367_10455559 3300006178 Bacteria 811
64 Ga0075366_10608345 3300006195 Bacteria 678
65 Ga0097621_100184967 3300006237 Bacteria 1802
66 Ga0068865_100082558 3300006881 Bacteria 2310
67 Ga0068865_100870407 3300006881 Bacteria 782
68 Ga0099824_1011583 3300006942 Bacteria 9925
69 Ga0099822_1000827 3300006943 Bacteria 32648
70 Ga0099794_10062140 3300007265 Bacteria 1816
71 Ga0099795_10045943 3300007788 Bacteria 1572
72 Ga0105240_10098058 3300009093 Bacteria 3570
73 Ga0105240_10222475 3300009093 Bacteria 2198
74 Ga0111539_11231310 3300009094 Bacteria 869
75 Ga0105245_10027626 3300009098 Bacteria 5000
76 Ga0105245_10159270 3300009098 Bacteria 2141
77 Ga0105247_10056420 3300009101 Bacteria 2425
78 Ga0105243_10396186 3300009148 Bacteria 1281
79 Ga0105243_11573028 3300009148 Bacteria 683
80 Ga0105241_10102037 3300009174 Bacteria 2282
81 Ga0105241_10929854 3300009174 Bacteria 809
82 Ga0105237_10075887 3300009545 Bacteria 3352
83 Ga0105237_10411164 3300009545 Bacteria 1358
84 Ga0105237_10762716 3300009545 Bacteria 974
85 Ga0105238_10035767 3300009551 Bacteria 5049
86 Ga0105238_10307064 3300009551 Bacteria 1571
87 Ga0105249_10789306 3300009553 Bacteria 1013
88 Ga0105239_10041875 3300010375 Bacteria 5019
89 Ga0105239_10177224 3300010375 Bacteria 2384
90 Ga0105239_10914556 3300010375 Bacteria 1007
91 Ga0105246_10107226 3300011119 Bacteria 2045
92 Ga0157370_10369690 3300013104 Bacteria 1321
93 Ga0157369_10215186 3300013105 Bacteria 2013
94 Ga0157369_10615457 3300013105 Bacteria 1121
95 Ga0157369_11123294 3300013105 Bacteria 803
96 Ga0157374_10066379 3300013296 Bacteria 3390
97 Ga0157374_10133546 3300013296 Bacteria 2404
98 Ga0157374_11857275 3300013296 Bacteria 628
99 Ga0163162_10151947 3300013306 Bacteria 2434
100 Ga0163162_11062407 3300013306 Bacteria 917
101 Ga0157372_10196401 3300013307 Bacteria 2337
102 Ga0157372_11745015 3300013307 Bacteria 716
103 Ga0157375_10087610 3300013308 Bacteria 3166
104 Ga0157375_12175303 3300013308 Bacteria 661
105 Ga0163163_10171454 3300014325 Bacteria 2217
106 Ga0157376_10033090 3300014969 Bacteria 4158
107 Ga0163161_10426142 3300017792 Bacteria 1068
108 Ga0213874_10016857 3300021377 Bacteria 1952
109 Ga0209148_1013245 3300025254 Bacteria 1487
110 Ga0209455_1002070 3300025272 Bacteria 8101
111 Ga0207656_10159318 3300025321 Bacteria 1073
112 Ga0207692_10381852 3300025898 Bacteria 875
113 Ga0207642_10263905 3300025899 Bacteria 983
114 Ga0207688_10116217 3300025901 Bacteria 1557
115 Ga0207685_10109638 3300025905 Bacteria 1194
116 Ga0207643_10098817 3300025908 Bacteria 1709
117 Ga0207705_10951354 3300025909 Bacteria 664
118 Ga0207707_10000100 3300025912 Bacteria 85682
119 Ga0207707_10113055 3300025912 Bacteria 2373
120 Ga0207695_10102608 3300025913 Bacteria 2853
121 Ga0207671_10130426 3300025914 Bacteria 1929
122 Ga0207671_10488871 3300025914 Bacteria 981
123 Ga0207693_10010186 3300025915 Bacteria 7635
124 Ga0207663_10376599 3300025916 Bacteria 1080
125 Ga0207660_10245481 3300025917 Bacteria 1412
126 Ga0207652_10002952 3300025921 Bacteria 14213
127 Ga0207652_10560576 3300025921 Bacteria 1026
128 Ga0207694_10032912 3300025924 Bacteria 3971
129 Ga0207694_11131541 3300025924 Bacteria 662
130 Ga0207687_10137189 3300025927 Bacteria 1851
131 Ga0207687_10145257 3300025927 Bacteria 1804
132 Ga0207644_10221110 3300025931 Bacteria 1501
133 Ga0207706_10311275 3300025933 Bacteria 1371
134 Ga0207704_10052638 3300025938 Bacteria 2469
135 Ga0207691_10223421 3300025940 Bacteria 1632
136 Ga0207661_10675224 3300025944 Bacteria 950
137 Ga0207679_10214032 3300025945 Bacteria 1618
138 Ga0207679_11039743 3300025945 Bacteria 751
139 Ga0207667_10097913 3300025949 Bacteria 3027
140 Ga0207667_10108548 3300025949 Bacteria 2863
141 Ga0207667_10119244 3300025949 Bacteria 2719
142 Ga0207651_10488930 3300025960 Bacteria 1062
143 Ga0207668_10420029 3300025972 Bacteria 1135
144 Ga0207640_10170753 3300025981 Bacteria 1620
145 Ga0207640_11041995 3300025981 Bacteria 721
146 Ga0207677_10033527 3300026023 Bacteria 3315
147 Ga0207639_10823414 3300026041 Bacteria 866
148 Ga0207639_11429918 3300026041 Bacteria 649
149 Ga0207678_10004832 3300026067 Bacteria 12098
150 Ga0207702_10138952 3300026078 Bacteria 2196
151 Ga0207702_10150838 3300026078 Bacteria 2114
152 Ga0207702_11068515 3300026078 Bacteria 801
153 Ga0207648_10371724 3300026089 Bacteria 1291
154 Ga0207676_10580490 3300026095 Bacteria 1074
155 Ga0207683_10368381 3300026121 Bacteria 1320
156 Ga0207698_10714866 3300026142 Bacteria 998
157 Ga0207698_11994319 3300026142 Bacteria 595
158 Ga0307408_100847203 3300031548 Bacteria 833
159 Ga0307508_10166736 3300031616 Bacteria 1806
160 Ga0307412_10111017 3300031911 Bacteria 1958
161 Ga0307416_101305794 3300032002 Bacteria 831
162 Ga0307415_100620948 3300032126 Bacteria 965
163 Ga0307507_10514444 3300033179 Bacteria 641
164 Ga0315911_1000008 3300033442 Bacteria 381285
165 Ga0373926_0198493 3300035083 Bacteria 772
166 Ga0373936_0283285 3300035113 Bacteria 745
167 Ga0373946_0227218 3300035171 Bacteria 903
168 Ga0373931_0350556 3300035691 Bacteria 924
169 Ga0373927_0024915 3300035695 Bacteria 3911
170 Ga0373927_0122272 3300035695 Bacteria 1699
171 Ga0373925_0070949 3300037068 Bacteria 2634
172 Ga0395900_0151500 3300037418 Bacteria 2369
173 Ga0395905_0502843 3300037471 Bacteria 1112
174 Ga0395901_0229844 3300038443 Bacteria 1937
175 Ga0436360_0755046 3300039438 Bacteria 2153
176 Ga0436361_0488418 3300039447 Bacteria 2209
177 Ga0436361_0668093 3300039447 Bacteria 1695
178 Ga0436363_0320221 3300039450 Bacteria 16971
179 Ga0436362_0128270 3300039453 Bacteria 549
180 Ga0451789_0968255 3300041443 Bacteria 951
181 Ga0451833_0908970 3300041491 Bacteria 627
182 Ga0451853_0378572 3300041512 Bacteria 704
183 Ga0466966_0206742 3300044684 Bacteria 1187
184 Ga0466959_0094139 3300045049 Bacteria 2149
185 Ga0466967_0221555 3300045976 Bacteria 1798
186 Ga0495603_0132661 3300046455 Bacteria 1450
187 Ga0495603_0186000 3300046455 Bacteria 1201
188 Ga0495629_0297010 3300046459 Bacteria 1107
189 Ga0495641_0352462 3300046461 Bacteria 665
190 Ga0495582_0230258 3300046473 Bacteria 1061
191 Ga0495639_0205929 3300046475 Bacteria 964
192 Ga0495652_0281965 3300046529 Bacteria 1216
193 Ga0495621_0414067 3300046539 Bacteria 573
194 Ga0495656_0087168 3300046615 Bacteria 1421
195 Ga0495668_0134571 3300046616 Bacteria 1353
196 Ga0495669_0123999 3300046684 Bacteria 1213
197 Ga0495649_0203384 3300046694 Bacteria 1028
198 Ga0495600_0112472 3300046809 Bacteria 1773
199 Ga0495581_0383906 3300047315 Bacteria 820
200 Ga0495604_0204430 3300047317 Bacteria 1368
201 Ga0495673_0020546 3300047469 Bacteria 3285
202 Ga0495681_0136485 3300047470 Bacteria 1040
203 Ga0496100_0009441 3300048903 Bacteria 5484
204 Ga0496100_0209536 3300048903 Bacteria 1425
205 Ga0496100_0507060 3300048903 Bacteria 930
206 Ga0496101_0014265 3300048904 Bacteria 5339
207 Ga0496102_0010497 3300048905 Bacteria 7974
208 Ga0496102_0151264 3300048905 Bacteria 2181
209 Ga0496102_0733301 3300048905 Bacteria 911
210 Ga0496104_0131769 3300048907 Bacteria 2401
211 Ga0496104_0262885 3300048907 Bacteria 1638
212 Ga0496105_0283645 3300048908 Bacteria 1335
213 Ga0496106_0001014 3300048909 Bacteria 20581
214 Ga0496106_0176436 3300048909 Bacteria 1695
215 Ga0496107_0017012 3300048910 Bacteria 5112
216 Ga0496107_0103397 3300048910 Bacteria 2090
217 Ga0496107_0478050 3300048910 Bacteria 925
218 Ga0496108_0029226 3300048911 Bacteria 4563
219 Ga0496108_1014735 3300048911 Bacteria 708
220 Ga0496109_0221685 3300048912 Bacteria 1778
221 Ga0496111_0298117 3300048914 Bacteria 1195
222 Ga0496112_0199693 3300048915 Bacteria 1959
223 Ga0496112_0858927 3300048915 Bacteria 831
224 Ga0496112_0924907 3300048915 Bacteria 793
225 Ga0496113_0407839 3300048916 Bacteria 1091
226 Ga0496113_0572229 3300048916 Bacteria 905
227 Ga0496114_0019628 3300048917 Bacteria 5477
228 Ga0496114_0709044 3300048917 Bacteria 882
229 Ga0496115_0155620 3300048918 Bacteria 1888
230 Ga0496115_0381763 3300048918 Bacteria 1146
231 Ga0496115_0476518 3300048918 Bacteria 1005
232 Ga0496119_0489967 3300048922 Bacteria 573
233 Ga0496121_0174246 3300048924 Bacteria 1559
234 Ga0496121_0253575 3300048924 Bacteria 1219
235 Ga0496121_0297805 3300048924 Bacteria 1096
236 Ga0496124_0025032 3300048927 Bacteria 5412
237 Ga0496125_0042012 3300048928 Bacteria 3901
238 Ga0496126_0358041 3300048929 Bacteria 1192
239 Ga0496126_0672002 3300048929 Bacteria 808
240 nmdc:mga03n38_51903_c1 3300050490 Bacteria 1833
241 nmdc:mga0k408_726204_c1 3300050493 Bacteria 581
242 nmdc:mga08y16_716574_c1 3300050511 Bacteria 999
243 Ga0495655_0024492 3300053083 Bacteria 1402
244 Ga0500651_0365997 3300053093 Bacteria 816
245 Ga0500566_0003924 3300053094 Bacteria 8868
246 Ga0500554_011337 3300053102 Bacteria 2205
247 Ga0500595_000265 3300053119 Bacteria 34660
248 Ga0500559_0084627 3300053136 Bacteria 1446
249 Ga0500638_000059 3300053162 Bacteria 20593
250 Ga0500637_0002081 3300053178 Bacteria 8764
251 Ga0500661_000282 3300055283 Bacteria 9220
252 2513658795 2513237096 Bacteria 8722461
253 2513860802 2513237137 Bacteria 9558895
254 2513888750 2513237141 Bacteria 8496279
255 2513921059 2513237145 Bacteria 8979722
256 2517888824 2517572143 Bacteria 9484767
257 2524467832 2524023210 Bacteria 9029266
258 2524537072 2524023228 Bacteria 10118060
259 2671119962 2667528175 Bacteria 7532676
260 2728754972 2728368998 Bacteria 8720350
261 2793072912 2791355197 Bacteria 8420563
262 2885376158 2885374607 Bacteria 8927485
263 2885385086 2885383462 Bacteria 9473874
264 2903748972 2903748898 Bacteria 9972761
265 2904694492 2904690495 Bacteria 9412302
266 2904708806
267 2906613856
268 2906642351 2906635258 Bacteria 8601019
269 2906667379 2906660503 Bacteria 8595048
270 2908747425 2908739725 Bacteria 8628932
271 2922434244
272 2935636611 2935630451 Bacteria 8169952
273 2941513247 2941507105 Bacteria 8166816
274 2941521098 2941515067 Bacteria 8166720
275 2941528965 2941523033 Bacteria 8169134
276 3005475043 3005474847 Bacteria 9259049
277 8006936253 8006933436 Bacteria 10410654
278 8006976198 8006973647 Bacteria 10679141
279 8056687410 8056681323 Bacteria 8472857
280 8056693384 8056689827 Bacteria 6712655
281 Ga0213871_10017691
282 JGI25404J52841_10022307
283 JGI25404J52841_10068123
284 Ga0065715_10284941
285 Ga0070658_10073543
286 Ga0070658_11304009
287 Ga0070683_100820612
288 Ga0070682_100144957
289 Ga0068868_100019259
290 Ga0070669_100460263
291 Ga0070675_100314371
292 Ga0070671_100513106
293 Ga0070674_100904229
294 Ga0070673_101939380
295 Ga0070659_100028298
296 Ga0070659_100602799
297 Ga0070710_10204404
298 Ga0070663_100001666
299 Ga0070678_100082654
300 Ga0070681_10046167
301 Ga0070681_10089770
302 Ga0070681_10105952
303 Ga0068867_100139727
304 Ga0070698_100127487
305 Ga0070679_100014541
306 Ga0070679_100074010
307 Ga0070679_100567912
308 Ga0070684_100388627
309 Ga0068853_100401988
310 Ga0068853_100751719
311 Ga0070693_100082798
312 Ga0070693_100128464
313 Ga0070665_100200915
314 Ga0068855_100178353
315 Ga0068855_100192675
316 Ga0068855_100325551
317 Ga0070664_100383872
318 Ga0070664_100887078
319 Ga0068857_101460929
320 Ga0068854_100287827
321 Ga0068854_100918409
322 Ga0068854_101180454
323 Ga0068856_100089450
324 Ga0068856_101402929
325 Ga0070702_100396541
326 Ga0070702_101161935
327 Ga0068852_100585507
328 Ga0068852_102185254
329 Ga0068864_100211856
330 Ga0068851_10185108
331 Ga0068870_10057468
332 Ga0068863_100939625
333 Ga0068858_101387223
334 Ga0081540_1005183
335 Ga0081540_1007567
336 Ga0081540_1046515
337 Ga0081540_1059198
338 Ga0075363_100077797
339 Ga0070715_10368270
340 Ga0070712_100014754
341 Ga0075362_10309743
342 Ga0075367_10369432
343 Ga0075367_10455559
344 Ga0075366_10608345
345 Ga0097621_100184967
346 Ga0068865_100082558
347 Ga0068865_100870407
348 Ga0099824_1011583
349 Ga0099822_1000827
350 Ga0099794_10062140
351 Ga0099795_10045943
352 Ga0105240_10098058
353 Ga0105240_10222475
354 Ga0111539_11231310
355 Ga0105245_10027626
356 Ga0105245_10159270
357 Ga0105247_10056420
358 Ga0105243_10396186
359 Ga0105243_11573028
360 Ga0105241_10102037
361 Ga0105241_10929854
362 Ga0105237_10075887
363 Ga0105237_10411164
364 Ga0105237_10762716
365 Ga0105238_10035767
366 Ga0105238_10307064
367 Ga0105249_10789306
368 Ga0105239_10041875
369 Ga0105239_10177224
370 Ga0105239_10914556
371 Ga0105246_10107226
372 Ga0157370_10369690
373 Ga0157369_10215186
374 Ga0157369_10615457
375 Ga0157369_11123294
376 Ga0157374_10066379
377 Ga0157374_10133546
378 Ga0157374_11857275
379 Ga0163162_10151947
380 Ga0163162_11062407
381 Ga0157372_10196401
382 Ga0157372_11745015
383 Ga0157375_10087610
384 Ga0157375_12175303
385 Ga0163163_10171454
386 Ga0157376_10033090
387 Ga0163161_10426142
388 Ga0213874_10016857
389 Ga0209148_1013245
390 Ga0209455_1002070
391 Ga0207656_10159318
392 Ga0207692_10381852
393 Ga0207642_10263905
394 Ga0207688_10116217
395 Ga0207685_10109638
396 Ga0207643_10098817
397 Ga0207705_10951354
398 Ga0207707_10000100
399 Ga0207707_10113055
400 Ga0207695_10102608
401 Ga0207671_10130426
402 Ga0207671_10488871
403 Ga0207693_10010186
404 Ga0207663_10376599
405 Ga0207660_10245481
406 Ga0207652_10002952
407 Ga0207652_10560576
408 Ga0207694_10032912
409 Ga0207694_11131541
410 Ga0207687_10137189
411 Ga0207687_10145257
412 Ga0207644_10221110
413 Ga0207706_10311275
414 Ga0207704_10052638
415 Ga0207691_10223421
416 Ga0207661_10675224
417 Ga0207679_10214032
418 Ga0207679_11039743
419 Ga0207667_10097913
420 Ga0207667_10108548
421 Ga0207667_10119244
422 Ga0207651_10488930
423 Ga0207668_10420029
424 Ga0207640_10170753
425 Ga0207640_11041995
426 Ga0207677_10033527
427 Ga0207639_10823414
428 Ga0207639_11429918
429 Ga0207678_10004832
430 Ga0207702_10138952
431 Ga0207702_10150838
432 Ga0207702_11068515
433 Ga0207648_10371724
434 Ga0207676_10580490
435 Ga0207683_10368381
436 Ga0207698_10714866
437 Ga0207698_11994319
438 Ga0307408_100847203
439 Ga0307508_10166736
440 Ga0307412_10111017
441 Ga0307416_101305794
442 Ga0307415_100620948
443 Ga0307507_10514444
444 Ga0315911_1000008
445 Ga0373926_0198493
446 Ga0373936_0283285
447 Ga0373946_0227218
448 Ga0373931_0350556
449 Ga0373927_0024915
450 Ga0373927_0122272
451 Ga0373925_0070949
452 Ga0395900_0151500
453 Ga0395905_0502843
454 Ga0395901_0229844
455 Ga0436360_0755046
456 Ga0436361_0488418
457 Ga0436361_0668093
458 Ga0436363_0320221
459 Ga0436362_0128270
460 Ga0451789_0968255
461 Ga0451833_0908970
462 Ga0451853_0378572
463 Ga0466966_0206742
464 Ga0466959_0094139
465 Ga0466967_0221555
466 Ga0495603_0132661
467 Ga0495603_0186000
468 Ga0495629_0297010
469 Ga0495641_0352462
470 Ga0495582_0230258
471 Ga0495639_0205929
472 Ga0495652_0281965
473 Ga0495621_0414067
474 Ga0495656_0087168
475 Ga0495668_0134571
476 Ga0495669_0123999
477 Ga0495649_0203384
478 Ga0495600_0112472
479 Ga0495581_0383906
480 Ga0495604_0204430
481 Ga0495673_0020546
482 Ga0495681_0136485
483 Ga0496100_0009441
484 Ga0496100_0209536
485 Ga0496100_0507060
486 Ga0496101_0014265
487 Ga0496102_0010497
488 Ga0496102_0151264
489 Ga0496102_0733301
490 Ga0496104_0131769
491 Ga0496104_0262885
492 Ga0496105_0283645
493 Ga0496106_0001014
494 Ga0496106_0176436
495 Ga0496107_0017012
496 Ga0496107_0103397
497 Ga0496107_0478050
498 Ga0496108_0029226
499 Ga0496108_1014735
500 Ga0496109_0221685
501 Ga0496111_0298117
502 Ga0496112_0199693
503 Ga0496112_0858927
504 Ga0496112_0924907
505 Ga0496113_0407839
506 Ga0496113_0572229
507 Ga0496114_0019628
508 Ga0496114_0709044
509 Ga0496115_0155620
510 Ga0496115_0381763
511 Ga0496115_0476518
512 Ga0496119_0489967
513 Ga0496121_0174246
514 Ga0496121_0253575
515 Ga0496121_0297805
516 Ga0496124_0025032
517 Ga0496125_0042012
518 Ga0496126_0358041
519 Ga0496126_0672002
520 nmdc:mga03n38_51903_c1
521 nmdc:mga0k408_726204_c1
522 nmdc:mga08y16_716574_c1
523 Ga0495655_0024492
524 Ga0500651_0365997
525 Ga0500566_0003924
526 Ga0500554_011337
527 Ga0500595_000265
528 Ga0500559_0084627
529 Ga0500638_000059
530 Ga0500637_0002081
531 Ga0500661_000282
532 2513658795
533 2513860802
534 2513888750
535 2513921059
536 2517888824
537 2524467832
538 2524537072
539 2671119962
540 2728754972
541 2793072912
542 2885376158
543 2885385086
544 2903748972
545 2904694492
546 2904708806
547 2906613856
548 2906642351
549 2906667379
550 2908747425
551 2922434244
552 2935636611
553 2941513247
554 2941521098
555 2941528965
556 3005475043
557 8006936253
558 8006976198
559 8056687410
560 8056693384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13523

Acetyltransf_8

Acetyltransferase (GNAT) domain

11

147

0.94

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

15

139

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qml-assembly1.cif.gz_A crystal structure of an uncharacterized protein (bh2621) from bacillus halodurans at 1.55 a resolution 0.9096 6 159
6bfh-assembly1.cif.gz_A structure of the kanamycin complex of aminoglycoside acetyltransferase aac(6')-im 0.8727 6 160
2qml-assembly1.cif.gz_A crystal structure of an uncharacterized protein (bh2621) from bacillus halodurans at 1.55 a resolution 0.8723 6 159
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.8658 119 160
2vqy-assembly1.cif.gz_A structure of aac(6')-ib in complex with parmomycin and acetylcoa. 0.8652 6 159
ID Description Score Start End Superfamily
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8821 99 159 3.40.630.30
6bfhA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8727 6 160 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8651 119 160 3.30.572.10
2qirA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8643 6 159 3.40.630.30
2qmlA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8534 6 156 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Q8R175-F1-model_v4 GNAT family N-acetyltransferase 0.9938 11 160 GO:0016410
GO:0046677
AF-A0A533IZH0-F1-model_v4 deleted 0.9776 6 126
AF-A0A4V1T8S9-F1-model_v4 GNAT family N-acetyltransferase 0.976 68 159 GO:0016410
GO:0046677
AF-A0A4Q8R175-F1-model_v4 GNAT family N-acetyltransferase 0.9744 11 160 GO:0016410
GO:0046677
AF-A0A840MZ10-F1-model_v4 Aminoglycoside 6'-N-acetyltransferase (EC 2.3.1.82) 0.9703 1 160 GO:0016410
GO:0046677

Map