F383459

General Info

Members Datasets Scaffolds Average Seq Length
280 155 560 61

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101310685|Ga0070683_1013106852
Length 72
Sequence VPVSKPSKERLELDMYFTDRGIEELAERRGEEEVSLAWLADRLSEFTDVHPEFENAVERLATWLARLDDPED

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
44 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
45 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
46 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
47 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
48 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
138 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.57
Metatranscriptomes 6.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.36
Nodule 0
Rhizoplane 3.93
Rhizosphere 84.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101310685 3300005329 Bacteria 696
2 Ga0070658_11931993 3300005327 Bacteria 510
3 Ga0070683_101164854 3300005329 Bacteria 741
4 Ga0070683_101818410 3300005329 Bacteria 585
5 Ga0070683_102355389 3300005329 Bacteria 510
6 Ga0070680_100645611 3300005336 Bacteria 909
7 Ga0070682_101690356 3300005337 Bacteria 549
8 Ga0070661_100865954 3300005344 Bacteria 744
9 Ga0070661_101012161 3300005344 Bacteria 689
10 Ga0070692_10899799 3300005345 Bacteria 612
11 Ga0070674_100399143 3300005356 Bacteria 1123
12 Ga0070659_100158724 3300005366 Bacteria 1848
13 Ga0070659_101280781 3300005366 Bacteria 650
14 Ga0070667_101168653 3300005367 Bacteria 720
15 Ga0070709_10517236 3300005434 Bacteria 909
16 Ga0070709_10825261 3300005434 Bacteria 729
17 Ga0070714_100335521 3300005435 Bacteria 1417
18 Ga0070713_100034528 3300005436 Bacteria 4064
19 Ga0070710_10564518 3300005437 Bacteria 788
20 Ga0070710_10767378 3300005437 Bacteria 686
21 Ga0070708_101179107 3300005445 Bacteria 717
22 Ga0070663_101853465 3300005455 Bacteria 541
23 Ga0070706_100322064 3300005467 Bacteria 1441
24 Ga0070707_100239377 3300005468 Bacteria 1766
25 Ga0070698_100014104 3300005471 Bacteria 8450
26 Ga0070699_100754666 3300005518 Bacteria 890
27 Ga0070684_100484080 3300005535 Bacteria 1145
28 Ga0070684_100507775 3300005535 Bacteria 1117
29 Ga0070684_101024431 3300005535 Bacteria 775
30 Ga0070684_101521075 3300005535 Bacteria 631
31 Ga0070696_100739377 3300005546 Bacteria 805
32 Ga0070664_100737357 3300005564 Bacteria 919
33 Ga0068856_101578583 3300005614 Bacteria 669
34 Ga0068856_102382248 3300005614 Bacteria 537
35 Ga0070702_100888857 3300005615 Bacteria 696
36 Ga0068864_102170848 3300005618 Bacteria 562
37 Ga0068862_100581480 3300005844 Bacteria 1073
38 Ga0070717_10263763 3300006028 Bacteria 1524
39 Ga0075365_10027740 3300006038 Bacteria 3606
40 Ga0075365_10033747 3300006038 Bacteria 3300
41 Ga0075365_10104055 3300006038 Bacteria 1946
42 Ga0075365_10176477 3300006038 Bacteria 1493
43 Ga0075365_10190141 3300006038 Bacteria 1437
44 Ga0075365_10190511 3300006038 Bacteria 1435
45 Ga0075365_10203719 3300006038 Bacteria 1386
46 Ga0075365_10263667 3300006038 Bacteria 1211
47 Ga0075365_10432128 3300006038 Bacteria 930
48 Ga0075365_10445550 3300006038 Bacteria 914
49 Ga0075365_10646786 3300006038 Bacteria 747
50 Ga0075365_10741606 3300006038 Bacteria 694
51 Ga0075365_10771953 3300006038 Bacteria 679
52 Ga0075365_10828815 3300006038 Bacteria 653
53 Ga0075365_10960148 3300006038 Bacteria 602
54 Ga0075363_100019568 3300006048 Bacteria 3385
55 Ga0075363_100037371 3300006048 Bacteria 2550
56 Ga0075363_100200857 3300006048 Bacteria 1139
57 Ga0075364_10026614 3300006051 Bacteria 3690
58 Ga0075364_10278984 3300006051 Bacteria 1137
59 Ga0075364_10564760 3300006051 Bacteria 778
60 Ga0070712_100801135 3300006175 Bacteria 808
61 Ga0075362_10107942 3300006177 Bacteria 1308
62 Ga0075367_10078617 3300006178 Bacteria 1992
63 Ga0075367_10242868 3300006178 Bacteria 1129
64 Ga0075370_10042051 3300006353 Bacteria 2581
65 Ga0075370_10049867 3300006353 Bacteria 2374
66 Ga0075370_10084545 3300006353 Bacteria 1826
67 Ga0075428_100167970 3300006844 Bacteria 2379
68 Ga0105245_11098201 3300009098 Bacteria 842
69 Ga0105245_11136441 3300009098 Bacteria 828
70 Ga0105245_12398774 3300009098 Bacteria 581
71 Ga0105247_10019872 3300009101 Bacteria 4035
72 Ga0105243_11102671 3300009148 Bacteria 802
73 Ga0105243_11506808 3300009148 Bacteria 696
74 Ga0105243_12576565 3300009148 Bacteria 548
75 Ga0105241_11410249 3300009174 Bacteria 667
76 Ga0105238_12645958 3300009551 Bacteria 538
77 Ga0105239_10283275 3300010375 Bacteria 1866
78 Ga0105239_12323688 3300010375 Bacteria 624
79 Ga0105246_11436188 3300011119 Bacteria 645
80 Ga0157343_1024183 3300012488 Bacteria 572
81 Ga0157329_1004034 3300012491 Bacteria 932
82 Ga0157341_1045010 3300012494 Bacteria 523
83 Ga0157339_1030777 3300012505 Bacteria 627
84 Ga0157316_1006548 3300012510 Bacteria 959
85 Ga0157326_1037861 3300012513 Bacteria 666
86 Ga0157371_10368244 3300013102 Bacteria 1048
87 Ga0157371_10604980 3300013102 Bacteria 816
88 Ga0157369_10311175 3300013105 Bacteria 1638
89 Ga0157369_12308069 3300013105 Bacteria 545
90 Ga0157372_11159012 3300013307 Bacteria 894
91 Ga0157372_11797300 3300013307 Bacteria 705
92 Ga0163163_11877289 3300014325 Bacteria 659
93 Ga0157380_11619097 3300014326 Bacteria 703
94 Ga0157377_10889486 3300014745 Bacteria 665
95 Ga0157377_11462241 3300014745 Bacteria 542
96 Ga0197907_10225339 3300020069 Bacteria 1898
97 Ga0206356_11428032 3300020070 Bacteria 1391
98 Ga0206349_1668064 3300020075 Bacteria 651
99 Ga0206351_10594626 3300020077 Bacteria 1589
100 Ga0206352_10291063 3300020078 Bacteria 577
101 Ga0206350_10233104 3300020080 Bacteria 1747
102 Ga0206350_10655963 3300020080 Bacteria 1775
103 Ga0206354_10812046 3300020081 Bacteria 4298
104 Ga0206354_11011498 3300020081 Bacteria 1155
105 Ga0206353_10531266 3300020082 Bacteria 587
106 Ga0206353_11202123 3300020082 Bacteria 947
107 Ga0206353_11296763 3300020082 Bacteria 6061
108 Ga0154015_1525675 3300020610 Bacteria 669
109 Ga0224712_10079974 3300022467 Bacteria 1347
110 Ga0224712_10187532 3300022467 Bacteria 935
111 Ga0207688_10099586 3300025901 Bacteria 1677
112 Ga0207680_10676831 3300025903 Bacteria 739
113 Ga0207699_11138651 3300025906 Bacteria 578
114 Ga0207705_10763719 3300025909 Bacteria 751
115 Ga0207705_11444986 3300025909 Bacteria 522
116 Ga0207657_10570355 3300025919 Bacteria 884
117 Ga0207652_10977745 3300025921 Bacteria 745
118 Ga0207700_11485875 3300025928 Bacteria 601
119 Ga0207664_10495662 3300025929 Bacteria 1093
120 Ga0207664_11632995 3300025929 Bacteria 567
121 Ga0207690_10711968 3300025932 Bacteria 826
122 Ga0207669_11742642 3300025937 Bacteria 532
123 Ga0207661_10050303 3300025944 Bacteria 3320
124 Ga0207661_10804988 3300025944 Bacteria 865
125 Ga0207661_12016705 3300025944 Bacteria 523
126 Ga0207679_10882082 3300025945 Bacteria 818
127 Ga0207667_10350949 3300025949 Bacteria 1504
128 Ga0207702_11940198 3300026078 Bacteria 580
129 Ga0207676_12260804 3300026095 Bacteria 542
130 Ga0207676_12304595 3300026095 Bacteria 536
131 Ga0207675_101003167 3300026118 Bacteria 853
132 Ga0207698_11574636 3300026142 Bacteria 672
133 Ga0307511_10002269 3300030521 Bacteria 20107
134 Ga0316182_1261216 3300030745 Bacteria 1108
135 Ga0307408_100170941 3300031548 Bacteria 1735
136 Ga0307408_100280538 3300031548 Bacteria 1387
137 Ga0307408_102301872 3300031548 Bacteria 522
138 Ga0307508_10163542 3300031616 Bacteria 1829
139 Ga0307405_10123030 3300031731 Bacteria 1778
140 Ga0307405_11566834 3300031731 Bacteria 580
141 Ga0307410_10058604 3300031852 Bacteria 2626
142 Ga0307410_10126646 3300031852 Bacteria 1870
143 Ga0307410_10147895 3300031852 Bacteria 1745
144 Ga0307410_11293825 3300031852 Bacteria 637
145 Ga0307410_11448427 3300031852 Bacteria 604
146 Ga0307406_10145418 3300031901 Bacteria 1684
147 Ga0307406_10167194 3300031901 Bacteria 1588
148 Ga0307406_10225531 3300031901 Bacteria 1396
149 Ga0307406_10274413 3300031901 Bacteria 1282
150 Ga0307406_10994819 3300031901 Bacteria 719
151 Ga0307407_10624999 3300031903 Bacteria 804
152 Ga0307407_10638304 3300031903 Bacteria 796
153 Ga0307407_10670429 3300031903 Bacteria 778
154 Ga0307407_11513121 3300031903 Bacteria 531
155 Ga0307412_10059290 3300031911 Bacteria 2564
156 Ga0307412_12095972 3300031911 Bacteria 525
157 Ga0307409_100005138 3300031995 Bacteria 7475
158 Ga0307409_100459029 3300031995 Bacteria 1231
159 Ga0307409_101081726 3300031995 Bacteria 822
160 Ga0307409_101588414 3300031995 Bacteria 682
161 Ga0307409_101842077 3300031995 Bacteria 634
162 Ga0307409_102221727 3300031995 Bacteria 578
163 Ga0307409_102976166 3300031995 Bacteria 500
164 Ga0307416_100331541 3300032002 Bacteria 1529
165 Ga0307416_100645754 3300032002 Bacteria 1142
166 Ga0307416_100769841 3300032002 Bacteria 1056
167 Ga0307416_101397292 3300032002 Bacteria 806
168 Ga0307416_101805736 3300032002 Bacteria 715
169 Ga0307416_103017716 3300032002 Bacteria 563
170 Ga0307414_10640117 3300032004 Bacteria 957
171 Ga0307414_11071981 3300032004 Bacteria 743
172 Ga0307414_11360540 3300032004 Bacteria 659
173 Ga0307411_10207798 3300032005 Bacteria 1509
174 Ga0307411_10292353 3300032005 Bacteria 1302
175 Ga0307411_11082212 3300032005 Bacteria 722
176 Ga0307415_100005880 3300032126 Bacteria 6561
177 Ga0307415_100054951 3300032126 Bacteria 2721
178 Ga0307415_100335704 3300032126 Bacteria 1266
179 Ga0307415_100495361 3300032126 Bacteria 1067
180 Ga0307415_101156641 3300032126 Bacteria 727
181 Ga0307415_102230785 3300032126 Bacteria 536
182 Ga0373947_1042311 3300035725 Bacteria 558
183 Ga0372808_010119 3300036459 Bacteria 1322
184 Ga0373925_0814915 3300037068 Bacteria 770
185 Ga0395900_0509750 3300037418 Bacteria 1152
186 Ga0395900_1469118 3300037418 Bacteria 594
187 Ga0395900_1743938 3300037418 Bacteria 533
188 Ga0395898_0034960 3300037466 Bacteria 5001
189 Ga0395898_0122546 3300037466 Bacteria 2491
190 Ga0395901_0023451 3300038443 Bacteria 6327
191 Ga0395901_0957399 3300038443 Bacteria 834
192 Ga0451802_0725716 3300041460 Bacteria 560
193 Ga0466969_0011173 3300044656 Bacteria 4754
194 Ga0466969_0056473 3300044656 Bacteria 1916
195 Ga0466965_0027585 3300044683 Bacteria 2757
196 Ga0466965_0407212 3300044683 Bacteria 752
197 Ga0466965_0435275 3300044683 Bacteria 729
198 Ga0466965_0928819 3300044683 Bacteria 508
199 Ga0466966_0215995 3300044684 Bacteria 1158
200 Ga0466961_0012877 3300044693 Bacteria 5351
201 Ga0466961_0184331 3300044693 Bacteria 1295
202 Ga0466961_0207483 3300044693 Bacteria 1210
203 Ga0466963_0227040 3300044694 Bacteria 1308
204 Ga0466963_0430096 3300044694 Bacteria 931
205 Ga0466963_0460769 3300044694 Bacteria 897
206 Ga0466963_0718918 3300044694 Bacteria 705
207 Ga0466963_0978862 3300044694 Bacteria 596
208 Ga0466971_0111334 3300044719 Bacteria 1263
209 Ga0466968_0090416 3300044735 Bacteria 1356
210 Ga0466970_0091605 3300044765 Bacteria 1650
211 Ga0466970_0605919 3300044765 Bacteria 635
212 Ga0466957_0022998 3300044842 Bacteria 3680
213 Ga0466957_0263336 3300044842 Bacteria 1149
214 Ga0466957_0341154 3300044842 Bacteria 1015
215 Ga0466957_0684997 3300044842 Bacteria 723
216 Ga0466960_0042680 3300044901 Bacteria 2154
217 Ga0466960_0155838 3300044901 Bacteria 1223
218 Ga0466960_0299763 3300044901 Bacteria 905
219 Ga0466960_0449492 3300044901 Bacteria 749
220 Ga0466959_0028478 3300045049 Bacteria 4142
221 Ga0466959_0075565 3300045049 Bacteria 2434
222 Ga0466959_0203111 3300045049 Bacteria 1379
223 Ga0466959_0474161 3300045049 Bacteria 847
224 Ga0466959_0953809 3300045049 Bacteria 572
225 Ga0466958_0074509 3300045836 Bacteria 2080
226 Ga0466958_0137352 3300045836 Bacteria 1538
227 Ga0466958_0248784 3300045836 Bacteria 1137
228 Ga0466958_0926974 3300045836 Bacteria 568
229 Ga0466967_0065072 3300045976 Bacteria 3244
230 Ga0466967_0071945 3300045976 Bacteria 3097
231 Ga0466967_0223734 3300045976 Bacteria 1789
232 Ga0466967_0297014 3300045976 Bacteria 1553
233 Ga0466967_0388403 3300045976 Bacteria 1356
234 Ga0466967_0692847 3300045976 Bacteria 1009
235 Ga0466967_1401133 3300045976 Bacteria 696
236 Ga0495617_222247 3300046452 Bacteria 587
237 Ga0495629_0722131 3300046459 Bacteria 661
238 Ga0495596_0045677 3300046500 Bacteria 1722
239 Ga0495663_0031769 3300046525 Bacteria 1570
240 Ga0495663_0131928 3300046525 Bacteria 843
241 Ga0495654_0327119 3300046530 Bacteria 621
242 Ga0495656_0104706 3300046615 Bacteria 1314
243 Ga0495668_0330551 3300046616 Bacteria 836
244 Ga0495636_0377941 3300047318 Bacteria 672
245 Ga0495683_0328074 3300047323 Bacteria 651
246 Ga0495677_0353794 3300047445 Bacteria 580
247 Ga0495681_0356439 3300047470 Bacteria 555
248 Ga0496100_0530573 3300048903 Bacteria 909
249 Ga0496101_0765588 3300048904 Bacteria 762
250 Ga0496104_1064342 3300048907 Bacteria 713
251 Ga0496106_0564788 3300048909 Bacteria 913
252 Ga0496107_0561968 3300048910 Bacteria 845
253 Ga0496110_0471321 3300048913 Bacteria 1144
254 Ga0496111_0805264 3300048914 Bacteria 680
255 Ga0496112_0742770 3300048915 Bacteria 908
256 Ga0496112_1068133 3300048915 Bacteria 726
257 Ga0496113_0762267 3300048916 Bacteria 770
258 Ga0501307_087463 3300049162 Bacteria 516
259 Ga0501299_100948 3300049522 Bacteria 670
260 Ga0501318_045212 3300049534 Bacteria 640
261 Ga0501034_0005678 3300049571 Bacteria 13574
262 Ga0501037_0035248 3300049573 Bacteria 3691
263 Ga0501038_0478909 3300049574 Bacteria 954
264 Ga0501038_0993186 3300049574 Bacteria 616
265 Ga0501039_1022116 3300049575 Bacteria 642
266 Ga0501041_0367155 3300049577 Bacteria 910
267 Ga0501042_0025749 3300049578 Bacteria 4133
268 Ga0501042_0623193 3300049578 Bacteria 784
269 Ga0501043_0243857 3300049579 Bacteria 1385
270 Ga0501047_0012157 3300049581 Bacteria 8147
271 Ga0501048_0021854 3300049582 Bacteria 4682
272 Ga0501074_0023007 3300049590 Bacteria 4532
273 Ga0501208_165279 3300049655 Bacteria 505
274 Ga0501044_0016021 3300049823 Bacteria 8063
275 nmdc:mga0yw44_753182_c1 3300050492 Bacteria 661
276 nmdc:mga06r32_1478492_c1 3300050510 Bacteria 620
277 Ga0500635_0130852 3300053080 Bacteria 946
278 Ga0495619_0618078 3300053085 Bacteria 741
279 Ga0466962_0048730 3300061719 Bacteria 2024
280 Ga0466962_0054372 3300061719 Bacteria 1913
281 Ga0070683_101310685
282 Ga0070658_11931993
283 Ga0070683_101164854
284 Ga0070683_101818410
285 Ga0070683_102355389
286 Ga0070680_100645611
287 Ga0070682_101690356
288 Ga0070661_100865954
289 Ga0070661_101012161
290 Ga0070692_10899799
291 Ga0070674_100399143
292 Ga0070659_100158724
293 Ga0070659_101280781
294 Ga0070667_101168653
295 Ga0070709_10517236
296 Ga0070709_10825261
297 Ga0070714_100335521
298 Ga0070713_100034528
299 Ga0070710_10564518
300 Ga0070710_10767378
301 Ga0070708_101179107
302 Ga0070663_101853465
303 Ga0070706_100322064
304 Ga0070707_100239377
305 Ga0070698_100014104
306 Ga0070699_100754666
307 Ga0070684_100484080
308 Ga0070684_100507775
309 Ga0070684_101024431
310 Ga0070684_101521075
311 Ga0070696_100739377
312 Ga0070664_100737357
313 Ga0068856_101578583
314 Ga0068856_102382248
315 Ga0070702_100888857
316 Ga0068864_102170848
317 Ga0068862_100581480
318 Ga0070717_10263763
319 Ga0075365_10027740
320 Ga0075365_10033747
321 Ga0075365_10104055
322 Ga0075365_10176477
323 Ga0075365_10190141
324 Ga0075365_10190511
325 Ga0075365_10203719
326 Ga0075365_10263667
327 Ga0075365_10432128
328 Ga0075365_10445550
329 Ga0075365_10646786
330 Ga0075365_10741606
331 Ga0075365_10771953
332 Ga0075365_10828815
333 Ga0075365_10960148
334 Ga0075363_100019568
335 Ga0075363_100037371
336 Ga0075363_100200857
337 Ga0075364_10026614
338 Ga0075364_10278984
339 Ga0075364_10564760
340 Ga0070712_100801135
341 Ga0075362_10107942
342 Ga0075367_10078617
343 Ga0075367_10242868
344 Ga0075370_10042051
345 Ga0075370_10049867
346 Ga0075370_10084545
347 Ga0075428_100167970
348 Ga0105245_11098201
349 Ga0105245_11136441
350 Ga0105245_12398774
351 Ga0105247_10019872
352 Ga0105243_11102671
353 Ga0105243_11506808
354 Ga0105243_12576565
355 Ga0105241_11410249
356 Ga0105238_12645958
357 Ga0105239_10283275
358 Ga0105239_12323688
359 Ga0105246_11436188
360 Ga0157343_1024183
361 Ga0157329_1004034
362 Ga0157341_1045010
363 Ga0157339_1030777
364 Ga0157316_1006548
365 Ga0157326_1037861
366 Ga0157371_10368244
367 Ga0157371_10604980
368 Ga0157369_10311175
369 Ga0157369_12308069
370 Ga0157372_11159012
371 Ga0157372_11797300
372 Ga0163163_11877289
373 Ga0157380_11619097
374 Ga0157377_10889486
375 Ga0157377_11462241
376 Ga0197907_10225339
377 Ga0206356_11428032
378 Ga0206349_1668064
379 Ga0206351_10594626
380 Ga0206352_10291063
381 Ga0206350_10233104
382 Ga0206350_10655963
383 Ga0206354_10812046
384 Ga0206354_11011498
385 Ga0206353_10531266
386 Ga0206353_11202123
387 Ga0206353_11296763
388 Ga0154015_1525675
389 Ga0224712_10079974
390 Ga0224712_10187532
391 Ga0207688_10099586
392 Ga0207680_10676831
393 Ga0207699_11138651
394 Ga0207705_10763719
395 Ga0207705_11444986
396 Ga0207657_10570355
397 Ga0207652_10977745
398 Ga0207700_11485875
399 Ga0207664_10495662
400 Ga0207664_11632995
401 Ga0207690_10711968
402 Ga0207669_11742642
403 Ga0207661_10050303
404 Ga0207661_10804988
405 Ga0207661_12016705
406 Ga0207679_10882082
407 Ga0207667_10350949
408 Ga0207702_11940198
409 Ga0207676_12260804
410 Ga0207676_12304595
411 Ga0207675_101003167
412 Ga0207698_11574636
413 Ga0307511_10002269
414 Ga0316182_1261216
415 Ga0307408_100170941
416 Ga0307408_100280538
417 Ga0307408_102301872
418 Ga0307508_10163542
419 Ga0307405_10123030
420 Ga0307405_11566834
421 Ga0307410_10058604
422 Ga0307410_10126646
423 Ga0307410_10147895
424 Ga0307410_11293825
425 Ga0307410_11448427
426 Ga0307406_10145418
427 Ga0307406_10167194
428 Ga0307406_10225531
429 Ga0307406_10274413
430 Ga0307406_10994819
431 Ga0307407_10624999
432 Ga0307407_10638304
433 Ga0307407_10670429
434 Ga0307407_11513121
435 Ga0307412_10059290
436 Ga0307412_12095972
437 Ga0307409_100005138
438 Ga0307409_100459029
439 Ga0307409_101081726
440 Ga0307409_101588414
441 Ga0307409_101842077
442 Ga0307409_102221727
443 Ga0307409_102976166
444 Ga0307416_100331541
445 Ga0307416_100645754
446 Ga0307416_100769841
447 Ga0307416_101397292
448 Ga0307416_101805736
449 Ga0307416_103017716
450 Ga0307414_10640117
451 Ga0307414_11071981
452 Ga0307414_11360540
453 Ga0307411_10207798
454 Ga0307411_10292353
455 Ga0307411_11082212
456 Ga0307415_100005880
457 Ga0307415_100054951
458 Ga0307415_100335704
459 Ga0307415_100495361
460 Ga0307415_101156641
461 Ga0307415_102230785
462 Ga0373947_1042311
463 Ga0372808_010119
464 Ga0373925_0814915
465 Ga0395900_0509750
466 Ga0395900_1469118
467 Ga0395900_1743938
468 Ga0395898_0034960
469 Ga0395898_0122546
470 Ga0395901_0023451
471 Ga0395901_0957399
472 Ga0451802_0725716
473 Ga0466969_0011173
474 Ga0466969_0056473
475 Ga0466965_0027585
476 Ga0466965_0407212
477 Ga0466965_0435275
478 Ga0466965_0928819
479 Ga0466966_0215995
480 Ga0466961_0012877
481 Ga0466961_0184331
482 Ga0466961_0207483
483 Ga0466963_0227040
484 Ga0466963_0430096
485 Ga0466963_0460769
486 Ga0466963_0718918
487 Ga0466963_0978862
488 Ga0466971_0111334
489 Ga0466968_0090416
490 Ga0466970_0091605
491 Ga0466970_0605919
492 Ga0466957_0022998
493 Ga0466957_0263336
494 Ga0466957_0341154
495 Ga0466957_0684997
496 Ga0466960_0042680
497 Ga0466960_0155838
498 Ga0466960_0299763
499 Ga0466960_0449492
500 Ga0466959_0028478
501 Ga0466959_0075565
502 Ga0466959_0203111
503 Ga0466959_0474161
504 Ga0466959_0953809
505 Ga0466958_0074509
506 Ga0466958_0137352
507 Ga0466958_0248784
508 Ga0466958_0926974
509 Ga0466967_0065072
510 Ga0466967_0071945
511 Ga0466967_0223734
512 Ga0466967_0297014
513 Ga0466967_0388403
514 Ga0466967_0692847
515 Ga0466967_1401133
516 Ga0495617_222247
517 Ga0495629_0722131
518 Ga0495596_0045677
519 Ga0495663_0031769
520 Ga0495663_0131928
521 Ga0495654_0327119
522 Ga0495656_0104706
523 Ga0495668_0330551
524 Ga0495636_0377941
525 Ga0495683_0328074
526 Ga0495677_0353794
527 Ga0495681_0356439
528 Ga0496100_0530573
529 Ga0496101_0765588
530 Ga0496104_1064342
531 Ga0496106_0564788
532 Ga0496107_0561968
533 Ga0496110_0471321
534 Ga0496111_0805264
535 Ga0496112_0742770
536 Ga0496112_1068133
537 Ga0496113_0762267
538 Ga0501307_087463
539 Ga0501299_100948
540 Ga0501318_045212
541 Ga0501034_0005678
542 Ga0501037_0035248
543 Ga0501038_0478909
544 Ga0501038_0993186
545 Ga0501039_1022116
546 Ga0501041_0367155
547 Ga0501042_0025749
548 Ga0501042_0623193
549 Ga0501043_0243857
550 Ga0501047_0012157
551 Ga0501048_0021854
552 Ga0501074_0023007
553 Ga0501208_165279
554 Ga0501044_0016021
555 nmdc:mga0yw44_753182_c1
556 nmdc:mga06r32_1478492_c1
557 Ga0500635_0130852
558 Ga0495619_0618078
559 Ga0466962_0048730
560 Ga0466962_0054372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19599

DUF6104

Family of unknown function (DUF6104)

15

72

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
4mo4C02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5383 11 31 3.30.420.40
3u8zB02 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.437 1 35 1.20.80.10
4hccB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3638 4 57 1.10.287.1240
4hcbA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3616 4 57 1.10.287.1240
4hg6B05 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.36 6 53 1.20.5.4520
ID Description Score Start End GO Terms
AF-A0A537YHW0-F1-model_v4 Uncharacterized protein 0.6909 3 63
AF-A0A537YHW0-F1-model_v4 Uncharacterized protein 0.6643 3 63
AF-A0A7R9B7U4-F1-model_v4 SPRY domain-containing protein 7 0.4227 1 63
AF-A0A7R9B7U4-F1-model_v4 SPRY domain-containing protein 7 0.4027 1 63

Map