F383236

General Info

Members Datasets Scaffolds Average Seq Length
279 189 558 240

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0073955|Ga0466967_0073955_1701_2603
Length 290
Sequence VSAASAGDGYGVPNQRVTVEKGQGGLAVMTPEPLLELRGVRASYGAIEVLHGVNLAVPAGGVVAVLGPNGAGKSTMLRVVGGLHTPTAGDIFLGGRRVNGVDPVELARAGLCTIPEGRGIFPNLTVKENLQMVTYRGMSRKEVEERAFSYFPRLSERRTQMAGTMSGGEQQMLAVARAIASDPSMLLLDELSMGLAPLIVDQLYEAVRTISKEGVTILVVEQFAAAVLDVADTAAVMVNGRVVLTGTPKEIEADLSSVYLGGEVASRLSADENPLADPDSVPESEILVNE

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
55 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
86 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
175 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 2508501039 Frankia saprophytica CN3 Isolate Nodule
181 2517572101 Frankia sp. DC12 Isolate Nodule
182 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
183 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
184 2687453737 Frankia sp. BMG5.36 Isolate Nodule
185 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
186 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
187 2922554459 Rhodococcus sp. 66b Isolate Unclassified
188 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
189 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 0.72
Isolates 3.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.39
Nodule 2.15
Rhizoplane 3.23
Rhizosphere 70.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0073955 3300045976 Bacteria 3059
2 JGI25406J46586_10025396 3300003203 Bacteria 2301
3 Ga0070683_100290219 3300005329 Bacteria 1556
4 Ga0070661_100166767 3300005344 Bacteria 1671
5 Ga0070671_100008002 3300005355 Bacteria 8462
6 Ga0070714_100132561 3300005435 Bacteria 2228
7 Ga0070714_100303453 3300005435 Bacteria 1489
8 Ga0070714_100603489 3300005435 Bacteria 1054
9 Ga0070708_100005176 3300005445 Bacteria 10323
10 Ga0070706_100000084 3300005467 Bacteria 109077
11 Ga0070706_100047819 3300005467 Bacteria 3948
12 Ga0070706_100266198 3300005467 Bacteria 1600
13 Ga0070707_100016015 3300005468 Bacteria 7034
14 Ga0070707_100024292 3300005468 Bacteria 5738
15 Ga0070698_100141853 3300005471 Bacteria 2353
16 Ga0070698_100946816 3300005471 Bacteria 807
17 Ga0070699_100014955 3300005518 Bacteria 6669
18 Ga0070679_100563401 3300005530 Bacteria 1083
19 Ga0070704_100746672 3300005549 Bacteria 871
20 Ga0068852_100725407 3300005616 Bacteria 1005
21 Ga0068859_101278945 3300005617 Bacteria 808
22 Ga0068858_100010903 3300005842 Bacteria 8592
23 Ga0068860_100000237 3300005843 Bacteria 84631
24 Ga0081455_10344099 3300005937 Bacteria 1054
25 Ga0081539_10000196 3300005985 Bacteria 140882
26 Ga0081539_10004717 3300005985 Bacteria 14764
27 Ga0070717_10002711 3300006028 Bacteria 12488
28 Ga0075365_10060441 3300006038 Bacteria 2528
29 Ga0075365_10118210 3300006038 Bacteria 1827
30 Ga0075365_10145561 3300006038 Bacteria 1646
31 Ga0075365_10311408 3300006038 Bacteria 1108
32 Ga0075368_10155064 3300006042 Bacteria 957
33 Ga0075363_100022359 3300006048 Bacteria 3196
34 Ga0075364_10004794 3300006051 Bacteria 7826
35 Ga0075364_10146031 3300006051 Bacteria 1593
36 Ga0075364_10147268 3300006051 Bacteria 1586
37 Ga0075364_10342297 3300006051 Bacteria 1019
38 Ga0070715_10016961 3300006163 Bacteria 2747
39 Ga0075370_10167097 3300006353 Bacteria 1293
40 Ga0075428_100012364 3300006844 Bacteria 9497
41 Ga0075428_100084778 3300006844 Bacteria 3457
42 Ga0075430_100000584 3300006846 Bacteria 27631
43 Ga0075430_100002829 3300006846 Bacteria 14518
44 Ga0075430_100030254 3300006846 Bacteria 4597
45 Ga0075430_100095165 3300006846 Bacteria 2489
46 Ga0075431_100002267 3300006847 Bacteria 18430
47 Ga0075434_100064215 3300006871 Bacteria 3655
48 Ga0075429_100000239 3300006880 Bacteria 37819
49 Ga0097620_101279133 3300006931 Bacteria 808
50 Ga0111539_10000875 3300009094 Bacteria 39347
51 Ga0114129_10000630 3300009147 Bacteria 43905
52 Ga0114129_10146020 3300009147 Bacteria 3240
53 Ga0105249_10176919 3300009553 Bacteria 2073
54 Ga0105029_108631 3300009984 Bacteria 752
55 Ga0163163_10138777 3300014325 Bacteria 2473
56 Ga0163161_10249208 3300017792 Bacteria 1384
57 Ga0206353_11404119 3300020082 Bacteria 1422
58 Ga0213874_10023747 3300021377 Bacteria 1714
59 Ga0213876_10182657 3300021384 Bacteria 1115
60 Ga0207647_10016434 3300025904 Bacteria 5051
61 Ga0207647_10052684 3300025904 Bacteria 2511
62 Ga0207685_10099087 3300025905 Bacteria 1242
63 Ga0207705_10059467 3300025909 Bacteria 2758
64 Ga0207684_10000040 3300025910 Bacteria 262703
65 Ga0207684_10054848 3300025910 Bacteria 3382
66 Ga0207684_10598142 3300025910 Bacteria 942
67 Ga0207652_10088101 3300025921 Bacteria 2723
68 Ga0207646_10008708 3300025922 Bacteria 10124
69 Ga0207646_10012600 3300025922 Bacteria 8118
70 Ga0207646_10466232 3300025922 Bacteria 1139
71 Ga0207700_10010493 3300025928 Bacteria 5850
72 Ga0207644_10041791 3300025931 Bacteria 3245
73 Ga0207703_10010033 3300026035 Bacteria 7425
74 Ga0207428_10027997 3300027907 Bacteria 4685
75 Ga0207428_10056108 3300027907 Bacteria 3130
76 Ga0268264_10000195 3300028381 Bacteria 123899
77 Ga0307515_10003658 3300028794 Bacteria 32307
78 Ga0307515_10173131 3300028794 Bacteria 2141
79 Ga0307512_10005884 3300030522 Bacteria 12607
80 Ga0307512_10022852 3300030522 Bacteria 5604
81 Ga0265762_1007922 3300030760 Bacteria 1893
82 Ga0265327_10005890 3300031251 Bacteria 10016
83 Ga0265327_10014723 3300031251 Bacteria 5096
84 Ga0307513_10009246 3300031456 Bacteria 12474
85 Ga0307513_10075583 3300031456 Bacteria 3497
86 Ga0307509_10011262 3300031507 Bacteria 10850
87 Ga0307509_10086264 3300031507 Bacteria 3228
88 Ga0307509_10118735 3300031507 Bacteria 2627
89 Ga0307408_100004458 3300031548 Bacteria 9504
90 Ga0307408_100368643 3300031548 Bacteria 1224
91 Ga0307508_10001889 3300031616 Bacteria 23036
92 Ga0307508_10004794 3300031616 Bacteria 13050
93 Ga0307514_10144606 3300031649 Bacteria 1609
94 Ga0307514_10184597 3300031649 Bacteria 1339
95 Ga0316579_10128506 3300031691 Bacteria 1220
96 Ga0316576_10022295 3300031727 Bacteria 4396
97 Ga0316578_10109179 3300031728 Bacteria 1661
98 Ga0307516_10009889 3300031730 Bacteria 10578
99 Ga0316577_10024052 3300031733 Bacteria 3385
100 Ga0307413_10063781 3300031824 Bacteria 2286
101 Ga0307413_10149214 3300031824 Bacteria 1627
102 Ga0307413_10201474 3300031824 Bacteria 1438
103 Ga0307518_10084532 3300031838 Bacteria 2287
104 Ga0307518_10144873 3300031838 Bacteria 1651
105 Ga0307410_10252023 3300031852 Bacteria 1373
106 Ga0307407_10034723 3300031903 Bacteria 2764
107 Ga0307409_100080447 3300031995 Bacteria 2629
108 Ga0307411_10082378 3300032005 Bacteria 2219
109 Ga0307507_10018484 3300033179 Bacteria 7919
110 Ga0307510_10001697 3300033180 Bacteria 24476
111 Ga0307510_10041054 3300033180 Bacteria 5066
112 Ga0373943_0044322 3300035170 Bacteria 2165
113 Ga0316574_0011989 3300035398 Bacteria 4945
114 Ga0316574_0054321 3300035398 Bacteria 2502
115 Ga0373931_0181418 3300035691 Bacteria 1247
116 Ga0373931_0472044 3300035691 Bacteria 805
117 Ga0373947_0084763 3300035725 Bacteria 1967
118 Ga0316582_0001120 3300036647 Bacteria 11367
119 Ga0316582_0143833 3300036647 Bacteria 1609
120 Ga0316584_0002542 3300036712 Bacteria 11580
121 Ga0316584_0158349 3300036712 Bacteria 1683
122 Ga0316584_0200497 3300036712 Bacteria 1472
123 Ga0436364_0815283 3300037853 Bacteria 6162
124 Ga0436365_0288480 3300039437 Bacteria 2181
125 Ga0436365_0384598 3300039437 Bacteria 1624
126 Ga0436365_0667692 3300039437 Bacteria 2932
127 Ga0436360_0024612 3300039438 Bacteria 1329
128 Ga0436363_0324602 3300039450 Bacteria 832
129 Ga0436363_0663387 3300039450 Bacteria 1803
130 Ga0436363_1477826 3300039450 Bacteria 2109
131 Ga0451797_0964794 3300041453 Bacteria 1902
132 Ga0451798_0735535 3300041458 Bacteria 1163
133 Ga0451843_0019495 3300041509 Bacteria 1393
134 Ga0466969_0059915 3300044656 Bacteria 1851
135 Ga0466965_0041631 3300044683 Bacteria 2264
136 Ga0466961_0099537 3300044693 Bacteria 1832
137 Ga0466961_0146094 3300044693 Bacteria 1479
138 Ga0466961_0269156 3300044693 Bacteria 1044
139 Ga0466963_0011932 3300044694 Bacteria 5307
140 Ga0466963_0067782 3300044694 Bacteria 2395
141 Ga0466963_0077790 3300044694 Bacteria 2242
142 Ga0466971_0051206 3300044719 Bacteria 1858
143 Ga0466971_0126325 3300044719 Bacteria 1185
144 Ga0466957_0023760 3300044842 Bacteria 3626
145 Ga0466957_0081489 3300044842 Bacteria 2015
146 Ga0466960_0112174 3300044901 Bacteria 1418
147 Ga0466960_0148658 3300044901 Bacteria 1250
148 Ga0466959_0209424 3300045049 Bacteria 1355
149 Ga0466958_0008764 3300045836 Bacteria 5617
150 Ga0466958_0014403 3300045836 Bacteria 4516
151 Ga0466967_0001629 3300045976 Bacteria 13264
152 Ga0466967_0009715 3300045976 Bacteria 7163
153 Ga0466967_0042757 3300045976 Bacteria 3918
154 Ga0466967_0073538 3300045976 Bacteria 3067
155 Ga0466967_0227221 3300045976 Bacteria 1776
156 Ga0466967_0525229 3300045976 Bacteria 1163
157 Ga0466967_0533280 3300045976 Bacteria 1154
158 Ga0466967_0568434 3300045976 Bacteria 1117
159 Ga0495627_039697 3300046453 Bacteria 1452
160 Ga0495629_0005045 3300046459 Bacteria 9880
161 Ga0495638_0018735 3300046460 Bacteria 4592
162 Ga0495651_0013019 3300046462 Bacteria 6425
163 Ga0495651_0297687 3300046462 Bacteria 1083
164 Ga0495653_0093444 3300046463 Bacteria 2194
165 Ga0495639_0058255 3300046475 Bacteria 1766
166 Ga0495662_0014092 3300046476 Bacteria 3891
167 Ga0495664_0002669 3300046477 Bacteria 9608
168 Ga0495594_0023851 3300046499 Bacteria 3281
169 Ga0495583_0159161 3300046506 Bacteria 932
170 Ga0495618_0067171 3300046514 Bacteria 2280
171 Ga0495628_0078267 3300046516 Bacteria 2572
172 Ga0495630_0010432 3300046517 Bacteria 6708
173 Ga0495630_0272990 3300046517 Bacteria 1292
174 Ga0495648_0002994 3300046524 Bacteria 15145
175 Ga0495652_0053519 3300046529 Bacteria 3440
176 Ga0495587_0004536 3300046536 Bacteria 9125
177 Ga0495645_0042428 3300046543 Bacteria 3316
178 Ga0495668_0023838 3300046616 Bacteria 3484
179 Ga0495634_0011761 3300046642 Bacteria 6363
180 Ga0495588_0027691 3300046674 Bacteria 2834
181 Ga0495657_0000085 3300046675 Bacteria 82569
182 Ga0495646_0005870 3300046680 Bacteria 7786
183 Ga0495647_0019189 3300046681 Bacteria 2444
184 Ga0495658_0007001 3300046683 Bacteria 5565
185 Ga0495613_0000396 3300046689 Bacteria 37260
186 Ga0495624_0180175 3300046690 Bacteria 1288
187 Ga0495581_0006197 3300047315 Bacteria 6937
188 Ga0495604_0000250 3300047317 Bacteria 47753
189 Ga0495676_0041334 3300047321 Bacteria 3796
190 Ga0495687_000735 3300047443 Bacteria 35916
191 Ga0495675_0103200 3300047444 Bacteria 1783
192 Ga0495593_0002533 3300047673 Bacteria 10972
193 Ga0495602_0033288 3300048088 Bacteria 4837
194 Ga0495614_0011521 3300048089 Bacteria 3890
195 Ga0495614_0037592 3300048089 Bacteria 2077
196 Ga0496102_0963697 3300048905 Bacteria 774
197 Ga0496104_0203552 3300048907 Bacteria 1891
198 Ga0496105_0304370 3300048908 Bacteria 1281
199 Ga0496108_0030249 3300048911 Bacteria 4488
200 Ga0496108_0214150 3300048911 Bacteria 1673
201 Ga0496112_0289558 3300048915 Bacteria 1584
202 Ga0496113_0213760 3300048916 Bacteria 1536
203 Ga0496116_0000014 3300048919 Bacteria 569049
204 Ga0496119_0000639 3300048922 Bacteria 47198
205 Ga0496120_0045357 3300048923 Bacteria 2547
206 Ga0496123_0013794 3300048926 Bacteria 6745
207 Ga0496125_0034110 3300048928 Bacteria 4490
208 Ga0496125_0129399 3300048928 Bacteria 1781
209 Ga0496126_0000040 3300048929 Bacteria 345144
210 Ga0501033_0244998 3300049570 Bacteria 1271
211 Ga0501034_0008428 3300049571 Bacteria 10889
212 Ga0501037_0293166 3300049573 Bacteria 1131
213 Ga0501047_0066251 3300049581 Bacteria 3481
214 Ga0501047_0286347 3300049581 Bacteria 1492
215 Ga0501048_0100015 3300049582 Bacteria 2046
216 Ga0501069_0006929 3300049585 Bacteria 5924
217 Ga0501070_0000008 3300049586 Bacteria 199963
218 Ga0501070_0003417 3300049586 Bacteria 13771
219 Ga0501070_0511079 3300049586 Bacteria 964
220 Ga0501070_0780932 3300049586 Bacteria 751
221 Ga0501071_0026745 3300049587 Bacteria 4052
222 Ga0501072_0457380 3300049588 Bacteria 1011
223 Ga0501073_0005502 3300049589 Bacteria 9487
224 Ga0501073_0144624 3300049589 Bacteria 1648
225 Ga0501074_0233817 3300049590 Bacteria 1308
226 Ga0501075_0567495 3300049591 Bacteria 866
227 Ga0501076_0025636 3300049592 Bacteria 4566
228 Ga0501080_0035648 3300049742 Bacteria 4643
229 Ga0501080_0072054 3300049742 Bacteria 3214
230 Ga0501083_0069656 3300049744 Bacteria 2340
231 Ga0501044_0158706 3300049823 Bacteria 2240
232 nmdc:mga03n38_206081_c1 3300050490 Bacteria 1020
233 nmdc:mga03n38_49641_c1 3300050490 Bacteria 1867
234 nmdc:mga00v17_130903_c1 3300050491 Bacteria 1603
235 nmdc:mga00v17_131594_c1 3300050491 Bacteria 1599
236 nmdc:mga00v17_158557_c1 3300050491 Bacteria 1456
237 nmdc:mga00v17_171896_c1 3300050491 Bacteria 1397
238 nmdc:mga00v17_2641_c1 3300050491 Bacteria 5593
239 nmdc:mga0yw44_199550_c1 3300050492 Bacteria 1321
240 nmdc:mga0yw44_33257_c1 3300050492 Bacteria 3011
241 nmdc:mga0yw44_95721_c1 3300050492 Bacteria 1884
242 nmdc:mga06z11_495634_c1 3300050494 Bacteria 740
243 nmdc:mga07m45_236167_c1 3300050496 Bacteria 1064
244 nmdc:mga05p37_1834_c1 3300050507 Bacteria 24768
245 nmdc:mga05p37_638065_c1 3300050507 Bacteria 1195
246 nmdc:mga09592_2630_c1 3300050508 Bacteria 14530
247 nmdc:mga0qj67_164563_c1 3300050509 Bacteria 1800
248 nmdc:mga0qj67_268057_c1 3300050509 Bacteria 1385
249 nmdc:mga0qj67_3741_c1 3300050509 Bacteria 10984
250 nmdc:mga0qj67_4638_c1 3300050509 Bacteria 9972
251 nmdc:mga0qj67_48150_c1 3300050509 Bacteria 3367
252 nmdc:mga06r32_16069_c1 3300050510 Bacteria 6815
253 nmdc:mga06r32_201034_c1 3300050510 Bacteria 1980
254 nmdc:mga06r32_21639_c1 3300050510 Bacteria 5938
255 nmdc:mga06r32_22267_c1 3300050510 Bacteria 5856
256 nmdc:mga08y16_29714_c1 3300050511 Bacteria 5754
257 Ga0495612_0004726 3300053078 Bacteria 5638
258 Ga0495612_0064796 3300053078 Bacteria 1517
259 Ga0495595_0083018 3300053084 Bacteria 1529
260 Ga0495619_0121065 3300053085 Bacteria 1794
261 Ga0500644_0000179 3300053088 Bacteria 40770
262 Ga0500651_0210634 3300053093 Bacteria 1143
263 Ga0500640_000249 3300053095 Bacteria 11943
264 Ga0500652_122864 3300053131 Bacteria 1085
265 Ga0500559_0000157 3300053136 Bacteria 53554
266 Ga0500624_002752 3300053157 Bacteria 2339
267 Ga0501084_0000580 3300054114 Bacteria 27978
268 Ga0501084_0305558 3300054114 Bacteria 1344
269 Ga0466962_0016328 3300061719 Bacteria 3580
270 2508678135 2508501039 Bacteria 9978592
271 2517759635 2517572101 Bacteria 6884336
272 2566992621 2565956761 Bacteria 6601618
273 2676202079 2675902999 Bacteria 9438463
274 2689961092 2687453737 Bacteria 11203906
275 2774846655 2773857921 Bacteria 9435764
276 2904541517 2904535858 Bacteria 6308016
277 2922560107 2922554459 Bacteria 6683962
278 2928143121 2928142448 Bacteria 5288925
279 8002791766 8002784119 Bacteria 9788632
280 Ga0466967_0073955
281 JGI25406J46586_10025396
282 Ga0070683_100290219
283 Ga0070661_100166767
284 Ga0070671_100008002
285 Ga0070714_100132561
286 Ga0070714_100303453
287 Ga0070714_100603489
288 Ga0070708_100005176
289 Ga0070706_100000084
290 Ga0070706_100047819
291 Ga0070706_100266198
292 Ga0070707_100016015
293 Ga0070707_100024292
294 Ga0070698_100141853
295 Ga0070698_100946816
296 Ga0070699_100014955
297 Ga0070679_100563401
298 Ga0070704_100746672
299 Ga0068852_100725407
300 Ga0068859_101278945
301 Ga0068858_100010903
302 Ga0068860_100000237
303 Ga0081455_10344099
304 Ga0081539_10000196
305 Ga0081539_10004717
306 Ga0070717_10002711
307 Ga0075365_10060441
308 Ga0075365_10118210
309 Ga0075365_10145561
310 Ga0075365_10311408
311 Ga0075368_10155064
312 Ga0075363_100022359
313 Ga0075364_10004794
314 Ga0075364_10146031
315 Ga0075364_10147268
316 Ga0075364_10342297
317 Ga0070715_10016961
318 Ga0075370_10167097
319 Ga0075428_100012364
320 Ga0075428_100084778
321 Ga0075430_100000584
322 Ga0075430_100002829
323 Ga0075430_100030254
324 Ga0075430_100095165
325 Ga0075431_100002267
326 Ga0075434_100064215
327 Ga0075429_100000239
328 Ga0097620_101279133
329 Ga0111539_10000875
330 Ga0114129_10000630
331 Ga0114129_10146020
332 Ga0105249_10176919
333 Ga0105029_108631
334 Ga0163163_10138777
335 Ga0163161_10249208
336 Ga0206353_11404119
337 Ga0213874_10023747
338 Ga0213876_10182657
339 Ga0207647_10016434
340 Ga0207647_10052684
341 Ga0207685_10099087
342 Ga0207705_10059467
343 Ga0207684_10000040
344 Ga0207684_10054848
345 Ga0207684_10598142
346 Ga0207652_10088101
347 Ga0207646_10008708
348 Ga0207646_10012600
349 Ga0207646_10466232
350 Ga0207700_10010493
351 Ga0207644_10041791
352 Ga0207703_10010033
353 Ga0207428_10027997
354 Ga0207428_10056108
355 Ga0268264_10000195
356 Ga0307515_10003658
357 Ga0307515_10173131
358 Ga0307512_10005884
359 Ga0307512_10022852
360 Ga0265762_1007922
361 Ga0265327_10005890
362 Ga0265327_10014723
363 Ga0307513_10009246
364 Ga0307513_10075583
365 Ga0307509_10011262
366 Ga0307509_10086264
367 Ga0307509_10118735
368 Ga0307408_100004458
369 Ga0307408_100368643
370 Ga0307508_10001889
371 Ga0307508_10004794
372 Ga0307514_10144606
373 Ga0307514_10184597
374 Ga0316579_10128506
375 Ga0316576_10022295
376 Ga0316578_10109179
377 Ga0307516_10009889
378 Ga0316577_10024052
379 Ga0307413_10063781
380 Ga0307413_10149214
381 Ga0307413_10201474
382 Ga0307518_10084532
383 Ga0307518_10144873
384 Ga0307410_10252023
385 Ga0307407_10034723
386 Ga0307409_100080447
387 Ga0307411_10082378
388 Ga0307507_10018484
389 Ga0307510_10001697
390 Ga0307510_10041054
391 Ga0373943_0044322
392 Ga0316574_0011989
393 Ga0316574_0054321
394 Ga0373931_0181418
395 Ga0373931_0472044
396 Ga0373947_0084763
397 Ga0316582_0001120
398 Ga0316582_0143833
399 Ga0316584_0002542
400 Ga0316584_0158349
401 Ga0316584_0200497
402 Ga0436364_0815283
403 Ga0436365_0288480
404 Ga0436365_0384598
405 Ga0436365_0667692
406 Ga0436360_0024612
407 Ga0436363_0324602
408 Ga0436363_0663387
409 Ga0436363_1477826
410 Ga0451797_0964794
411 Ga0451798_0735535
412 Ga0451843_0019495
413 Ga0466969_0059915
414 Ga0466965_0041631
415 Ga0466961_0099537
416 Ga0466961_0146094
417 Ga0466961_0269156
418 Ga0466963_0011932
419 Ga0466963_0067782
420 Ga0466963_0077790
421 Ga0466971_0051206
422 Ga0466971_0126325
423 Ga0466957_0023760
424 Ga0466957_0081489
425 Ga0466960_0112174
426 Ga0466960_0148658
427 Ga0466959_0209424
428 Ga0466958_0008764
429 Ga0466958_0014403
430 Ga0466967_0001629
431 Ga0466967_0009715
432 Ga0466967_0042757
433 Ga0466967_0073538
434 Ga0466967_0227221
435 Ga0466967_0525229
436 Ga0466967_0533280
437 Ga0466967_0568434
438 Ga0495627_039697
439 Ga0495629_0005045
440 Ga0495638_0018735
441 Ga0495651_0013019
442 Ga0495651_0297687
443 Ga0495653_0093444
444 Ga0495639_0058255
445 Ga0495662_0014092
446 Ga0495664_0002669
447 Ga0495594_0023851
448 Ga0495583_0159161
449 Ga0495618_0067171
450 Ga0495628_0078267
451 Ga0495630_0010432
452 Ga0495630_0272990
453 Ga0495648_0002994
454 Ga0495652_0053519
455 Ga0495587_0004536
456 Ga0495645_0042428
457 Ga0495668_0023838
458 Ga0495634_0011761
459 Ga0495588_0027691
460 Ga0495657_0000085
461 Ga0495646_0005870
462 Ga0495647_0019189
463 Ga0495658_0007001
464 Ga0495613_0000396
465 Ga0495624_0180175
466 Ga0495581_0006197
467 Ga0495604_0000250
468 Ga0495676_0041334
469 Ga0495687_000735
470 Ga0495675_0103200
471 Ga0495593_0002533
472 Ga0495602_0033288
473 Ga0495614_0011521
474 Ga0495614_0037592
475 Ga0496102_0963697
476 Ga0496104_0203552
477 Ga0496105_0304370
478 Ga0496108_0030249
479 Ga0496108_0214150
480 Ga0496112_0289558
481 Ga0496113_0213760
482 Ga0496116_0000014
483 Ga0496119_0000639
484 Ga0496120_0045357
485 Ga0496123_0013794
486 Ga0496125_0034110
487 Ga0496125_0129399
488 Ga0496126_0000040
489 Ga0501033_0244998
490 Ga0501034_0008428
491 Ga0501037_0293166
492 Ga0501047_0066251
493 Ga0501047_0286347
494 Ga0501048_0100015
495 Ga0501069_0006929
496 Ga0501070_0000008
497 Ga0501070_0003417
498 Ga0501070_0511079
499 Ga0501070_0780932
500 Ga0501071_0026745
501 Ga0501072_0457380
502 Ga0501073_0005502
503 Ga0501073_0144624
504 Ga0501074_0233817
505 Ga0501075_0567495
506 Ga0501076_0025636
507 Ga0501080_0035648
508 Ga0501080_0072054
509 Ga0501083_0069656
510 Ga0501044_0158706
511 nmdc:mga03n38_206081_c1
512 nmdc:mga03n38_49641_c1
513 nmdc:mga00v17_130903_c1
514 nmdc:mga00v17_131594_c1
515 nmdc:mga00v17_158557_c1
516 nmdc:mga00v17_171896_c1
517 nmdc:mga00v17_2641_c1
518 nmdc:mga0yw44_199550_c1
519 nmdc:mga0yw44_33257_c1
520 nmdc:mga0yw44_95721_c1
521 nmdc:mga06z11_495634_c1
522 nmdc:mga07m45_236167_c1
523 nmdc:mga05p37_1834_c1
524 nmdc:mga05p37_638065_c1
525 nmdc:mga09592_2630_c1
526 nmdc:mga0qj67_164563_c1
527 nmdc:mga0qj67_268057_c1
528 nmdc:mga0qj67_3741_c1
529 nmdc:mga0qj67_4638_c1
530 nmdc:mga0qj67_48150_c1
531 nmdc:mga06r32_16069_c1
532 nmdc:mga06r32_201034_c1
533 nmdc:mga06r32_21639_c1
534 nmdc:mga06r32_22267_c1
535 nmdc:mga08y16_29714_c1
536 Ga0495612_0004726
537 Ga0495612_0064796
538 Ga0495595_0083018
539 Ga0495619_0121065
540 Ga0500644_0000179
541 Ga0500651_0210634
542 Ga0500640_000249
543 Ga0500652_122864
544 Ga0500559_0000157
545 Ga0500624_002752
546 Ga0501084_0000580
547 Ga0501084_0305558
548 Ga0466962_0016328
549 2508678135
550 2517759635
551 2566992621
552 2676202079
553 2689961092
554 2774846655
555 2904541517
556 2922560107
557 2928143121
558 8002791766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

50

192

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9047 26 229
1g9x-assembly3.cif.gz_C characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter 0.8942 25 236
1gaj-assembly1.cif.gz_A crystal structure of a nucleotide-free atp-binding cassette from an abc transporter 0.8911 25 234
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8866 23 241
1g6h-assembly1.cif.gz_A crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter 0.8816 25 241
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9149 22 241 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9122 27 85 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9047 26 229 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8981 27 235 3.40.50.300
af_A0A0P0VBQ7_902_1031_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8966 27 85 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y9JAY0-F1-model_v4 Branched-chain amino acid transport system ATP-binding protein 0.921 27 240 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A523UH55-F1-model_v4 ATP-binding cassette domain-containing protein 0.9158 24 229 GO:0005524
GO:0016887
GO:0043215
GO:1900753
AF-H5XUG3-F1-model_v4 ABC-type branched-chain amino acid transport system, ATPase component 0.9141 27 240 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A254THI3-F1-model_v4 ABC transporter ATP-binding protein 0.9131 27 241 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A496QUQ5-F1-model_v4 ABC transporter ATP-binding protein 0.9114 27 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map