F383200

General Info

Members Datasets Scaffolds Average Seq Length
279 122 558 332

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0255658|Ga0436361_0255658_3846_4859
Length 337
Sequence MSDDMPKISALDLAPIIQGADAGDALRRSLDLARHVESLGFHRFWLAEHHNMPGIASAATAVALAHVAAGTSKIRIGSGGVMLPNHAPYIIAEQFGTLAALHPGRVDLGLGRAPGTDQLTARALRRNLHSDPEAFPQDVVELLHFLAPVREGQSVRAIPGAGADVEVWILGSSLFGAQVAAALGLPFAFASHFAPAELDRALAIYRERFQPSPRLQKPYAIAALMVIGADTDAEARYLFSSIQQSFVALRTGRPGPLPPPVLEMGERLTPEGRMHLDHALSCAVIGSPATVKEGLEAFARRTGADELMITASIFEHEARLRSFEIAAAAMGAPALAA

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.02
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0255658 3300039447 Bacteria 8362
2 JGI24740J21852_10002192 3300001979 Bacteria 8929
3 JGI24735J21928_10029002 3300002067 Bacteria 1650
4 JGI24034J26672_10016064 3300002239 Bacteria 1150
5 Ga0065715_10012368 3300005293 Bacteria 2498
6 Ga0070658_10008367 3300005327 Bacteria 8317
7 Ga0070658_10039515 3300005327 Bacteria 3807
8 Ga0070658_10154116 3300005327 Bacteria 1925
9 Ga0070683_100035747 3300005329 Bacteria 4542
10 Ga0070683_100140568 3300005329 Bacteria 2287
11 Ga0070670_100021974 3300005331 Bacteria 5490
12 Ga0070677_10001703 3300005333 Bacteria 6959
13 Ga0070666_10006964 3300005335 Bacteria 6970
14 Ga0070680_100000229 3300005336 Bacteria 37007
15 Ga0070680_100025240 3300005336 Bacteria 4748
16 Ga0070680_100033326 3300005336 Bacteria 4151
17 Ga0070680_100049681 3300005336 Bacteria 3420
18 Ga0070680_100063777 3300005336 Bacteria 3019
19 Ga0070660_100000787 3300005339 Bacteria 21082
20 Ga0070660_100002314 3300005339 Bacteria 13096
21 Ga0070660_100002854 3300005339 Bacteria 11896
22 Ga0070660_100005696 3300005339 Bacteria 8633
23 Ga0070660_100026543 3300005339 Bacteria 4313
24 Ga0070661_100076684 3300005344 Bacteria 2464
25 Ga0070661_100116766 3300005344 Bacteria 1996
26 Ga0070661_100166849 3300005344 Bacteria 1670
27 Ga0070692_10036386 3300005345 Bacteria 2498
28 Ga0070669_100070356 3300005353 Bacteria 2586
29 Ga0070669_100228216 3300005353 Bacteria 1475
30 Ga0070675_100000985 3300005354 Bacteria 20370
31 Ga0070671_100009878 3300005355 Bacteria 7661
32 Ga0070671_100226978 3300005355 Bacteria 1584
33 Ga0070659_100273791 3300005366 Bacteria 1403
34 Ga0070667_100033119 3300005367 Bacteria 4315
35 Ga0070663_100006173 3300005455 Bacteria 7177
36 Ga0070663_100062416 3300005455 Bacteria 2686
37 Ga0070663_100186266 3300005455 Bacteria 1613
38 Ga0070662_100175664 3300005457 Bacteria 1685
39 Ga0070662_100230874 3300005457 Bacteria 1480
40 Ga0070681_10144660 3300005458 Bacteria 2307
41 Ga0070681_10151180 3300005458 Bacteria 2248
42 Ga0070679_100229851 3300005530 Bacteria 1814
43 Ga0070665_100291072 3300005548 Bacteria 1635
44 Ga0068855_100003629 3300005563 Bacteria 18867
45 Ga0068855_100007269 3300005563 Bacteria 13421
46 Ga0068855_100026768 3300005563 Bacteria 6900
47 Ga0070664_100003664 3300005564 Bacteria 12374
48 Ga0070664_100089730 3300005564 Bacteria 2660
49 Ga0068854_100214815 3300005578 Bacteria 1519
50 Ga0068856_100368367 3300005614 Bacteria 1455
51 Ga0068856_100379690 3300005614 Bacteria 1432
52 Ga0068852_100013554 3300005616 Bacteria 6240
53 Ga0068852_100118245 3300005616 Bacteria 2422
54 Ga0068864_100001105 3300005618 Bacteria 22558
55 Ga0068864_100039270 3300005618 Bacteria 4046
56 Ga0105240_10514082 3300009093 Bacteria 1330
57 Ga0105241_10176872 3300009174 Bacteria 1767
58 Ga0105248_10039595 3300009177 Bacteria 5280
59 Ga0105248_10292630 3300009177 Bacteria 1834
60 Ga0157373_10101045 3300013100 Bacteria 2029
61 Ga0157373_10121513 3300013100 Bacteria 1836
62 Ga0157371_10043354 3300013102 Bacteria 3205
63 Ga0157371_10045224 3300013102 Bacteria 3133
64 Ga0157371_10052904 3300013102 Bacteria 2884
65 Ga0157371_10081555 3300013102 Bacteria 2290
66 Ga0157370_10068823 3300013104 Bacteria 3345
67 Ga0157370_10104677 3300013104 Bacteria 2649
68 Ga0157369_10045965 3300013105 Bacteria 4746
69 Ga0157369_10065853 3300013105 Bacteria 3899
70 Ga0157369_10211157 3300013105 Bacteria 2034
71 Ga0157369_10230699 3300013105 Bacteria 1936
72 Ga0157369_10487136 3300013105 Bacteria 1276
73 Ga0157372_10129613 3300013307 Bacteria 2901
74 Ga0157372_10167137 3300013307 Bacteria 2544
75 Ga0157380_10163394 3300014326 Bacteria 1938
76 Ga0163161_10155703 3300017792 Bacteria 1740
77 Ga0197907_11124301 3300020069 Bacteria 1456
78 Ga0206353_11615461 3300020082 Bacteria 2588
79 Ga0207682_10003350 3300025893 Bacteria 6985
80 Ga0207647_10036640 3300025904 Bacteria 3115
81 Ga0207705_10000135 3300025909 Bacteria 79350
82 Ga0207705_10003971 3300025909 Bacteria 11245
83 Ga0207705_10017176 3300025909 Bacteria 5182
84 Ga0207705_10031053 3300025909 Bacteria 3812
85 Ga0207705_10060536 3300025909 Bacteria 2735
86 Ga0207707_10093361 3300025912 Bacteria 2628
87 Ga0207707_10134943 3300025912 Bacteria 2158
88 Ga0207660_10000092 3300025917 Bacteria 48931
89 Ga0207660_10004148 3300025917 Bacteria 9427
90 Ga0207660_10048266 3300025917 Bacteria 3012
91 Ga0207660_10089175 3300025917 Bacteria 2282
92 Ga0207660_10234703 3300025917 Bacteria 1443
93 Ga0207657_10000218 3300025919 Bacteria 59661
94 Ga0207657_10000675 3300025919 Bacteria 36346
95 Ga0207657_10004790 3300025919 Bacteria 14279
96 Ga0207657_10016270 3300025919 Bacteria 7178
97 Ga0207657_10045044 3300025919 Bacteria 3875
98 Ga0207657_10060780 3300025919 Bacteria 3242
99 Ga0207649_10056374 3300025920 Bacteria 2454
100 Ga0207649_10132328 3300025920 Bacteria 1696
101 Ga0207649_10132332 3300025920 Bacteria 1696
102 Ga0207652_10001035 3300025921 Bacteria 25477
103 Ga0207652_10181502 3300025921 Bacteria 1891
104 Ga0207652_10257152 3300025921 Bacteria 1575
105 Ga0207652_10329489 3300025921 Bacteria 1378
106 Ga0207681_10042706 3300025923 Bacteria 3030
107 Ga0207681_10151727 3300025923 Bacteria 1737
108 Ga0207681_10271250 3300025923 Bacteria 1332
109 Ga0207650_10016124 3300025925 Bacteria 5217
110 Ga0207650_10029343 3300025925 Bacteria 3954
111 Ga0207650_10148903 3300025925 Bacteria 1846
112 Ga0207650_10248969 3300025925 Bacteria 1438
113 Ga0207659_10033738 3300025926 Bacteria 3525
114 Ga0207700_10102053 3300025928 Bacteria 2290
115 Ga0207644_10000901 3300025931 Bacteria 18809
116 Ga0207644_10003298 3300025931 Bacteria 10433
117 Ga0207644_10047170 3300025931 Bacteria 3072
118 Ga0207644_10073439 3300025931 Bacteria 2508
119 Ga0207690_10027107 3300025932 Bacteria 3617
120 Ga0207706_10003866 3300025933 Bacteria 14256
121 Ga0207706_10017273 3300025933 Bacteria 6502
122 Ga0207706_10174100 3300025933 Bacteria 1891
123 Ga0207669_10031835 3300025937 Bacteria 2953
124 Ga0207669_10202268 3300025937 Bacteria 1443
125 Ga0207711_10000567 3300025941 Bacteria 37685
126 Ga0207711_10079921 3300025941 Bacteria 2855
127 Ga0207711_10355875 3300025941 Bacteria 1356
128 Ga0207661_10036019 3300025944 Bacteria 3860
129 Ga0207679_10007612 3300025945 Bacteria 6879
130 Ga0207679_10057741 3300025945 Bacteria 2872
131 Ga0207667_10000122 3300025949 Bacteria 121588
132 Ga0207667_10101836 3300025949 Bacteria 2962
133 Ga0207667_10327099 3300025949 Bacteria 1565
134 Ga0207658_10018327 3300025986 Bacteria 4834
135 Ga0207639_10159657 3300026041 Bacteria 1898
136 Ga0207678_10000325 3300026067 Bacteria 42910
137 Ga0207678_10015243 3300026067 Bacteria 6762
138 Ga0207678_10069355 3300026067 Bacteria 3023
139 Ga0207678_10092923 3300026067 Bacteria 2578
140 Ga0207678_10194883 3300026067 Bacteria 1732
141 Ga0207702_10300962 3300026078 Bacteria 1522
142 Ga0207702_10309460 3300026078 Bacteria 1502
143 Ga0207676_10014222 3300026095 Bacteria 5718
144 Ga0207674_10054560 3300026116 Bacteria 4068
145 Ga0207698_10016312 3300026142 Bacteria 5003
146 Ga0209974_10002198 3300027876 Bacteria 7109
147 Ga0268266_10265824 3300028379 Bacteria 1591
148 Ga0307408_100014588 3300031548 Bacteria 5222
149 Ga0307405_10090495 3300031731 Bacteria 2024
150 Ga0307405_10130011 3300031731 Bacteria 1738
151 Ga0307413_10004641 3300031824 Bacteria 6010
152 Ga0307413_10037521 3300031824 Bacteria 2799
153 Ga0307413_10045299 3300031824 Bacteria 2606
154 Ga0307413_10104522 3300031824 Bacteria 1880
155 Ga0307410_10006374 3300031852 Bacteria 6364
156 Ga0307410_10011390 3300031852 Bacteria 5083
157 Ga0307410_10027957 3300031852 Bacteria 3570
158 Ga0307410_10039400 3300031852 Bacteria 3102
159 Ga0307410_10050544 3300031852 Bacteria 2796
160 Ga0307410_10062670 3300031852 Bacteria 2548
161 Ga0307410_10136314 3300031852 Bacteria 1810
162 Ga0307410_10259686 3300031852 Bacteria 1354
163 Ga0307410_10268074 3300031852 Bacteria 1334
164 Ga0307406_10008453 3300031901 Bacteria 5743
165 Ga0307406_10015891 3300031901 Bacteria 4364
166 Ga0307407_10071047 3300031903 Bacteria 2071
167 Ga0307407_10080496 3300031903 Bacteria 1968
168 Ga0307412_10187644 3300031911 Bacteria 1560
169 Ga0307412_10187649 3300031911 Bacteria 1560
170 Ga0307409_100026025 3300031995 Bacteria 4118
171 Ga0307409_100044020 3300031995 Bacteria 3358
172 Ga0307409_100049870 3300031995 Bacteria 3194
173 Ga0307409_100104042 3300031995 Bacteria 2363
174 Ga0307409_100240941 3300031995 Bacteria 1646
175 Ga0307409_100311369 3300031995 Bacteria 1469
176 Ga0307416_100013726 3300032002 Bacteria 5517
177 Ga0307416_100105323 3300032002 Bacteria 2468
178 Ga0307416_100233176 3300032002 Bacteria 1776
179 Ga0307416_100279089 3300032002 Bacteria 1646
180 Ga0307414_10018568 3300032004 Bacteria 4287
181 Ga0307414_10035870 3300032004 Bacteria 3304
182 Ga0307414_10190903 3300032004 Bacteria 1657
183 Ga0307411_10029818 3300032005 Bacteria 3337
184 Ga0307411_10031549 3300032005 Bacteria 3262
185 Ga0307411_10051183 3300032005 Bacteria 2693
186 Ga0307411_10085248 3300032005 Bacteria 2187
187 Ga0307411_10125240 3300032005 Bacteria 1867
188 Ga0307411_10140635 3300032005 Bacteria 1779
189 Ga0307415_100047205 3300032126 Bacteria 2898
190 Ga0307415_100071948 3300032126 Bacteria 2433
191 Ga0373960_0046652 3300035121 Bacteria 1272
192 Ga0373955_0081576 3300035172 Bacteria 1829
193 Ga0373933_0012887 3300035724 Bacteria 4625
194 Ga0373937_0001008 3300036401 Bacteria 23842
195 Ga0395899_0000103 3300037312 Bacteria 147274
196 Ga0395899_0000352 3300037312 Bacteria 56166
197 Ga0395899_0001385 3300037312 Bacteria 20802
198 Ga0395899_0004406 3300037312 Bacteria 10983
199 Ga0395899_0024965 3300037312 Bacteria 4513
200 Ga0395900_0000093 3300037418 Bacteria 166505
201 Ga0395900_0000944 3300037418 Bacteria 37904
202 Ga0395900_0006972 3300037418 Bacteria 11708
203 Ga0395900_0015417 3300037418 Bacteria 7791
204 Ga0395900_0095272 3300037418 Bacteria 3058
205 Ga0395900_0118041 3300037418 Bacteria 2722
206 Ga0395900_0121757 3300037418 Bacteria 2676
207 Ga0395898_0000053 3300037466 Bacteria 279600
208 Ga0395898_0003377 3300037466 Bacteria 17885
209 Ga0395898_0007615 3300037466 Bacteria 11495
210 Ga0395898_0009787 3300037466 Bacteria 10046
211 Ga0395898_0028093 3300037466 Bacteria 5641
212 Ga0395898_0100152 3300037466 Bacteria 2783
213 Ga0395905_0000031 3300037471 Bacteria 286757
214 Ga0395905_0002517 3300037471 Bacteria 20238
215 Ga0395905_0036203 3300037471 Bacteria 4634
216 Ga0395905_0118870 3300037471 Bacteria 2484
217 Ga0395905_0672619 3300037471 Bacteria 937
218 Ga0395901_0000047 3300038443 Bacteria 175221
219 Ga0395901_0000850 3300038443 Bacteria 33604
220 Ga0395901_0001246 3300038443 Bacteria 27128
221 Ga0395901_0022765 3300038443 Bacteria 6425
222 Ga0395901_0050936 3300038443 Bacteria 4302
223 Ga0395901_0059080 3300038443 Bacteria 3989
224 Ga0439432_007938 3300042006 Bacteria 3744
225 Ga0439432_013534 3300042006 Bacteria 2774
226 Ga0439432_017503 3300042006 Bacteria 2405
227 Ga0466972_0034609 3300044658 Bacteria 2474
228 Ga0466972_0055316 3300044658 Bacteria 1908
229 Ga0466966_0027185 3300044684 Bacteria 3731
230 Ga0466966_0050801 3300044684 Bacteria 2637
231 Ga0466961_0075338 3300044693 Bacteria 2139
232 Ga0466961_0119376 3300044693 Bacteria 1656
233 Ga0466961_0133671 3300044693 Bacteria 1554
234 Ga0466961_0152121 3300044693 Bacteria 1444
235 Ga0466963_0001992 3300044694 Bacteria 11207
236 Ga0466963_0014885 3300044694 Bacteria 4805
237 Ga0466963_0107610 3300044694 Bacteria 1912
238 Ga0466963_0135707 3300044694 Bacteria 1702
239 Ga0466971_0001911 3300044719 Bacteria 8835
240 Ga0466970_0052346 3300044765 Bacteria 2179
241 Ga0466957_0004226 3300044842 Bacteria 7963
242 Ga0466957_0008285 3300044842 Bacteria 5910
243 Ga0466957_0032407 3300044842 Bacteria 3129
244 Ga0466957_0061102 3300044842 Bacteria 2311
245 Ga0466960_0113057 3300044901 Bacteria 1413
246 Ga0466959_0123211 3300045049 Bacteria 1841
247 Ga0466959_0198390 3300045049 Bacteria 1398
248 Ga0466958_0002246 3300045836 Bacteria 9621
249 Ga0466958_0014804 3300045836 Bacteria 4457
250 Ga0466958_0058079 3300045836 Bacteria 2352
251 Ga0466967_0044136 3300045976 Bacteria 3864
252 Ga0466967_0217334 3300045976 Bacteria 1815
253 Ga0466967_0384548 3300045976 Bacteria 1363
254 Ga0495638_0091344 3300046460 Bacteria 1834
255 Ga0495663_0002789 3300046525 Bacteria 5171
256 Ga0495621_0000742 3300046539 Bacteria 8278
257 Ga0495633_0002038 3300046558 Bacteria 14582
258 Ga0495669_0004112 3300046684 Bacteria 5987
259 Ga0495669_0008048 3300046684 Bacteria 4423
260 Ga0495670_0003665 3300046691 Bacteria 7550
261 Ga0495674_0377335 3300047319 Bacteria 1148
262 Ga0495672_0021225 3300047320 Bacteria 4239
263 Ga0496104_0431954 3300048907 Bacteria 1229
264 Ga0496108_0013000 3300048911 Bacteria 6782
265 Ga0496108_0109000 3300048911 Bacteria 2366
266 Ga0496109_0081481 3300048912 Bacteria 2982
267 Ga0496109_0141764 3300048912 Bacteria 2247
268 Ga0496110_0000806 3300048913 Bacteria 21970
269 Ga0496110_0048103 3300048913 Bacteria 3738
270 Ga0496110_0298403 3300048913 Bacteria 1468
271 Ga0496112_0091155 3300048915 Bacteria 3017
272 Ga0496112_0186653 3300048915 Bacteria 2036
273 Ga0496113_0003502 3300048916 Bacteria 9414
274 Ga0496113_0022620 3300048916 Bacteria 4450
275 Ga0496114_0115060 3300048917 Bacteria 2307
276 Ga0496115_0000797 3300048918 Bacteria 23110
277 Ga0501067_0164821 3300049583 Bacteria 1234
278 Ga0466962_0005851 3300061719 Bacteria 5909
279 Ga0466962_0032899 3300061719 Bacteria 2481
280 Ga0436361_0255658
281 JGI24740J21852_10002192
282 JGI24735J21928_10029002
283 JGI24034J26672_10016064
284 Ga0065715_10012368
285 Ga0070658_10008367
286 Ga0070658_10039515
287 Ga0070658_10154116
288 Ga0070683_100035747
289 Ga0070683_100140568
290 Ga0070670_100021974
291 Ga0070677_10001703
292 Ga0070666_10006964
293 Ga0070680_100000229
294 Ga0070680_100025240
295 Ga0070680_100033326
296 Ga0070680_100049681
297 Ga0070680_100063777
298 Ga0070660_100000787
299 Ga0070660_100002314
300 Ga0070660_100002854
301 Ga0070660_100005696
302 Ga0070660_100026543
303 Ga0070661_100076684
304 Ga0070661_100116766
305 Ga0070661_100166849
306 Ga0070692_10036386
307 Ga0070669_100070356
308 Ga0070669_100228216
309 Ga0070675_100000985
310 Ga0070671_100009878
311 Ga0070671_100226978
312 Ga0070659_100273791
313 Ga0070667_100033119
314 Ga0070663_100006173
315 Ga0070663_100062416
316 Ga0070663_100186266
317 Ga0070662_100175664
318 Ga0070662_100230874
319 Ga0070681_10144660
320 Ga0070681_10151180
321 Ga0070679_100229851
322 Ga0070665_100291072
323 Ga0068855_100003629
324 Ga0068855_100007269
325 Ga0068855_100026768
326 Ga0070664_100003664
327 Ga0070664_100089730
328 Ga0068854_100214815
329 Ga0068856_100368367
330 Ga0068856_100379690
331 Ga0068852_100013554
332 Ga0068852_100118245
333 Ga0068864_100001105
334 Ga0068864_100039270
335 Ga0105240_10514082
336 Ga0105241_10176872
337 Ga0105248_10039595
338 Ga0105248_10292630
339 Ga0157373_10101045
340 Ga0157373_10121513
341 Ga0157371_10043354
342 Ga0157371_10045224
343 Ga0157371_10052904
344 Ga0157371_10081555
345 Ga0157370_10068823
346 Ga0157370_10104677
347 Ga0157369_10045965
348 Ga0157369_10065853
349 Ga0157369_10211157
350 Ga0157369_10230699
351 Ga0157369_10487136
352 Ga0157372_10129613
353 Ga0157372_10167137
354 Ga0157380_10163394
355 Ga0163161_10155703
356 Ga0197907_11124301
357 Ga0206353_11615461
358 Ga0207682_10003350
359 Ga0207647_10036640
360 Ga0207705_10000135
361 Ga0207705_10003971
362 Ga0207705_10017176
363 Ga0207705_10031053
364 Ga0207705_10060536
365 Ga0207707_10093361
366 Ga0207707_10134943
367 Ga0207660_10000092
368 Ga0207660_10004148
369 Ga0207660_10048266
370 Ga0207660_10089175
371 Ga0207660_10234703
372 Ga0207657_10000218
373 Ga0207657_10000675
374 Ga0207657_10004790
375 Ga0207657_10016270
376 Ga0207657_10045044
377 Ga0207657_10060780
378 Ga0207649_10056374
379 Ga0207649_10132328
380 Ga0207649_10132332
381 Ga0207652_10001035
382 Ga0207652_10181502
383 Ga0207652_10257152
384 Ga0207652_10329489
385 Ga0207681_10042706
386 Ga0207681_10151727
387 Ga0207681_10271250
388 Ga0207650_10016124
389 Ga0207650_10029343
390 Ga0207650_10148903
391 Ga0207650_10248969
392 Ga0207659_10033738
393 Ga0207700_10102053
394 Ga0207644_10000901
395 Ga0207644_10003298
396 Ga0207644_10047170
397 Ga0207644_10073439
398 Ga0207690_10027107
399 Ga0207706_10003866
400 Ga0207706_10017273
401 Ga0207706_10174100
402 Ga0207669_10031835
403 Ga0207669_10202268
404 Ga0207711_10000567
405 Ga0207711_10079921
406 Ga0207711_10355875
407 Ga0207661_10036019
408 Ga0207679_10007612
409 Ga0207679_10057741
410 Ga0207667_10000122
411 Ga0207667_10101836
412 Ga0207667_10327099
413 Ga0207658_10018327
414 Ga0207639_10159657
415 Ga0207678_10000325
416 Ga0207678_10015243
417 Ga0207678_10069355
418 Ga0207678_10092923
419 Ga0207678_10194883
420 Ga0207702_10300962
421 Ga0207702_10309460
422 Ga0207676_10014222
423 Ga0207674_10054560
424 Ga0207698_10016312
425 Ga0209974_10002198
426 Ga0268266_10265824
427 Ga0307408_100014588
428 Ga0307405_10090495
429 Ga0307405_10130011
430 Ga0307413_10004641
431 Ga0307413_10037521
432 Ga0307413_10045299
433 Ga0307413_10104522
434 Ga0307410_10006374
435 Ga0307410_10011390
436 Ga0307410_10027957
437 Ga0307410_10039400
438 Ga0307410_10050544
439 Ga0307410_10062670
440 Ga0307410_10136314
441 Ga0307410_10259686
442 Ga0307410_10268074
443 Ga0307406_10008453
444 Ga0307406_10015891
445 Ga0307407_10071047
446 Ga0307407_10080496
447 Ga0307412_10187644
448 Ga0307412_10187649
449 Ga0307409_100026025
450 Ga0307409_100044020
451 Ga0307409_100049870
452 Ga0307409_100104042
453 Ga0307409_100240941
454 Ga0307409_100311369
455 Ga0307416_100013726
456 Ga0307416_100105323
457 Ga0307416_100233176
458 Ga0307416_100279089
459 Ga0307414_10018568
460 Ga0307414_10035870
461 Ga0307414_10190903
462 Ga0307411_10029818
463 Ga0307411_10031549
464 Ga0307411_10051183
465 Ga0307411_10085248
466 Ga0307411_10125240
467 Ga0307411_10140635
468 Ga0307415_100047205
469 Ga0307415_100071948
470 Ga0373960_0046652
471 Ga0373955_0081576
472 Ga0373933_0012887
473 Ga0373937_0001008
474 Ga0395899_0000103
475 Ga0395899_0000352
476 Ga0395899_0001385
477 Ga0395899_0004406
478 Ga0395899_0024965
479 Ga0395900_0000093
480 Ga0395900_0000944
481 Ga0395900_0006972
482 Ga0395900_0015417
483 Ga0395900_0095272
484 Ga0395900_0118041
485 Ga0395900_0121757
486 Ga0395898_0000053
487 Ga0395898_0003377
488 Ga0395898_0007615
489 Ga0395898_0009787
490 Ga0395898_0028093
491 Ga0395898_0100152
492 Ga0395905_0000031
493 Ga0395905_0002517
494 Ga0395905_0036203
495 Ga0395905_0118870
496 Ga0395905_0672619
497 Ga0395901_0000047
498 Ga0395901_0000850
499 Ga0395901_0001246
500 Ga0395901_0022765
501 Ga0395901_0050936
502 Ga0395901_0059080
503 Ga0439432_007938
504 Ga0439432_013534
505 Ga0439432_017503
506 Ga0466972_0034609
507 Ga0466972_0055316
508 Ga0466966_0027185
509 Ga0466966_0050801
510 Ga0466961_0075338
511 Ga0466961_0119376
512 Ga0466961_0133671
513 Ga0466961_0152121
514 Ga0466963_0001992
515 Ga0466963_0014885
516 Ga0466963_0107610
517 Ga0466963_0135707
518 Ga0466971_0001911
519 Ga0466970_0052346
520 Ga0466957_0004226
521 Ga0466957_0008285
522 Ga0466957_0032407
523 Ga0466957_0061102
524 Ga0466960_0113057
525 Ga0466959_0123211
526 Ga0466959_0198390
527 Ga0466958_0002246
528 Ga0466958_0014804
529 Ga0466958_0058079
530 Ga0466967_0044136
531 Ga0466967_0217334
532 Ga0466967_0384548
533 Ga0495638_0091344
534 Ga0495663_0002789
535 Ga0495621_0000742
536 Ga0495633_0002038
537 Ga0495669_0004112
538 Ga0495669_0008048
539 Ga0495670_0003665
540 Ga0495674_0377335
541 Ga0495672_0021225
542 Ga0496104_0431954
543 Ga0496108_0013000
544 Ga0496108_0109000
545 Ga0496109_0081481
546 Ga0496109_0141764
547 Ga0496110_0000806
548 Ga0496110_0048103
549 Ga0496110_0298403
550 Ga0496112_0091155
551 Ga0496112_0186653
552 Ga0496113_0003502
553 Ga0496113_0022620
554 Ga0496114_0115060
555 Ga0496115_0000797
556 Ga0501067_0164821
557 Ga0466962_0005851
558 Ga0466962_0032899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

8

306

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8466 4 324
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.8451 4 330
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.8418 4 330
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.834 4 330
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.8305 4 330
ID Description Score Start End Superfamily
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9402 3 324 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9272 4 324 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9208 3 324 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9029 4 324 3.20.20.30
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8791 4 324 3.20.20.30
ID Description Score Start End GO Terms
AF-Q98D40-F1-model_v4 Mlr4873 protein 0.9688 191 324 GO:0005829
GO:0016705
AF-A0A4Q2YTM3-F1-model_v4 Alkane 1-monooxygenase 0.9687 213 324 GO:0004497
GO:0005829
GO:0016705
AF-A0A2E1N7F0-F1-model_v4 deleted 0.9676 181 326
AF-A0A435MG24-F1-model_v4 deleted 0.9663 161 324
AF-A0A3D2L7K4-F1-model_v4 Alkane 1-monooxygenase 0.9598 174 327 GO:0004497
GO:0005829
GO:0016705

Map