F383151

General Info

Members Datasets Scaffolds Average Seq Length
279 149 266 336

Family's Representative Sequence

Representative Sequence 3300031614|Ga0310103_108842|Ga0310103_1088421
Length 389
Sequence VVNYLLKSIYKYTQSTSSPRSKVQHFAVIWKTGESECITRAMAQLAASSTVRRLRLGSQGLEVSAQGLGCMGMSAFYGPPKPDQEMISLIHHAVSRGITFLDTSDIYGPFTNEVLVGKAIKGIREKVQLATKFGIKYADGKREIRGDPAHVRAACEASLKRLDIDCIDLYYQHRIDIKVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGIVPYSPLGRGFLSAGAKLIDNLEDSDFRKFMPRFSKENLEKNKVIFERISEIASKKGCSPSQLALAWVQHQGNDVAPIPGTTKVKNLEENIGALSVELTPLEIKEVEDLVSSAGVFGDRSGEMDITWMNSETPLLSSWKAAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2687453737 Frankia sp. BMG5.36 Isolate Nodule
5 2773857933 Frankia sp. BMG5.30 Isolate Nodule
6 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
7 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
8 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
9 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
10 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
11 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
12 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
13 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300023553 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
49 3300023557 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
50 3300023558 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
51 3300023559 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
52 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
53 3300023561 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
54 3300023562 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
55 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
56 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
57 3300023664 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
58 3300023666 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
59 3300023668 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
60 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
61 3300023682 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
62 3300023684 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
63 3300023686 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
64 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
65 3300023689 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
66 3300023690 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
79 3300031591 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
80 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
81 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
82 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
83 3300031632 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
84 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
85 3300031634 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
86 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
87 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
88 3300031664 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
89 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
90 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
91 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
92 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
93 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
94 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
95 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
96 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
97 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
98 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
103 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
105 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
107 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
110 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
111 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
112 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
113 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 21.86
Metatranscriptomes 73.48
Isolates 4.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0.72
Rhizoplane 1.43
Rhizosphere 42.65
Stem 0
Stem Tuber 0
Unclassified 53.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_825320 2162886007 Bacteria 30673
2 JGI24739J22299_10002999 3300001989 Bacteria 6459
3 JGI24738J21930_10029256 3300002075 Bacteria 1127
4 Ga0006765J45826_112098 3300003161 Eukaryota 1296
5 Ga0006759J45824_1022406 3300003163 Eukaryota 1288
6 Ga0006759J45824_1057825 3300003163 Eukaryota 1085
7 Ga0007417J51691_1012129 3300003544 Eukaryota 1369
8 Ga0006560J51390_1013371 3300003565 Eukaryota 1212
9 Ga0007416J51690_1018706 3300003577 Eukaryota 1299
10 Ga0007416J51690_1078134 3300003577 Eukaryota 1180
11 Ga0058862_10033077 3300004803 Eukaryota 1225
12 Ga0058862_12359543 3300004803 Eukaryota 1820
13 Ga0065704_10070354 3300005289 Bacteria 30678
14 Ga0065707_10084864 3300005295 Bacteria 6694
15 Ga0070666_10008811 3300005335 Bacteria 6271
16 Ga0070668_100004442 3300005347 Bacteria 10410
17 Ga0070671_100001146 3300005355 Bacteria 19744
18 Ga0070671_100133302 3300005355 Bacteria 2093
19 Ga0070667_100006307 3300005367 Bacteria 9854
20 Ga0070714_100103909 3300005435 Bacteria 2507
21 Ga0070708_100128282 3300005445 Bacteria 2346
22 Ga0070663_100010210 3300005455 Bacteria 5847
23 Ga0070665_100001075 3300005548 Bacteria 34026
24 Ga0070665_100007402 3300005548 Bacteria 11168
25 Ga0068863_100009251 3300005841 Bacteria 9610
26 Ga0068863_100052231 3300005841 Bacteria 3874
27 Ga0068858_100044271 3300005842 Bacteria 4126
28 Ga0068860_100000147 3300005843 Bacteria 115672
29 Ga0068860_100006752 3300005843 Bacteria 11509
30 Ga0068860_100082277 3300005843 Bacteria 3062
31 Ga0081455_10000082 3300005937 Bacteria 103704
32 Ga0075365_10141931 3300006038 Bacteria 1667
33 Ga0075363_100106779 3300006048 Bacteria 1553
34 Ga0105247_10056929 3300009101 Bacteria 2416
35 Ga0105249_10283326 3300009553 Bacteria 1656
36 Ga0105246_10114310 3300011119 Bacteria 1988
37 Ga0157378_10032668 3300013297 Bacteria 4598
38 Ga0157375_10237586 3300013308 Bacteria 1981
39 Ga0197907_10083565 3300020069 Eukaryota 1113
40 Ga0206356_10084416 3300020070 Eukaryota 1234
41 Ga0206350_10099299 3300020080 Eukaryota 1191
42 Ga0206350_10217510 3300020080 Eukaryota 1196
43 Ga0206354_10144565 3300020081 Eukaryota 1147
44 Ga0206353_11903619 3300020082 Eukaryota 1555
45 Ga0247524_104225 3300023553 Eukaryota 1291
46 Ga0247524_104650 3300023553 Eukaryota 1227
47 Ga0247521_102936 3300023557 Eukaryota 1693
48 Ga0247521_103048 3300023557 Eukaryota 1666
49 Ga0247521_104119 3300023557 Eukaryota 1452
50 Ga0247521_104821 3300023557 Eukaryota 1338
51 Ga0247526_102444 3300023558 Eukaryota 1773
52 Ga0247526_103722 3300023558 Eukaryota 1468
53 Ga0247526_103839 3300023558 Eukaryota 1447
54 Ga0247526_104389 3300023558 Eukaryota 1353
55 Ga0247529_104206 3300023559 Eukaryota 1421
56 Ga0247514_104458 3300023560 Eukaryota 1674
57 Ga0247514_104608 3300023560 Eukaryota 1649
58 Ga0247514_105417 3300023560 Eukaryota 1519
59 Ga0247514_105541 3300023560 Eukaryota 1500
60 Ga0247514_105962 3300023560 Eukaryota 1442
61 Ga0247518_101152 3300023561 Eukaryota 2679
62 Ga0247518_105337 3300023561 Eukaryota 1511
63 Ga0247518_107383 3300023561 Eukaryota 1244
64 Ga0247516_104091 3300023562 Eukaryota 1679
65 Ga0247516_104829 3300023562 Eukaryota 1554
66 Ga0247516_107602 3300023562 Eukaryota 1204
67 Ga0247530_102256 3300023563 Eukaryota 1694
68 Ga0247530_102588 3300023563 Eukaryota 1607
69 Ga0247530_103823 3300023563 Eukaryota 1346
70 Ga0247515_103834 3300023564 Eukaryota 1707
71 Ga0247515_104204 3300023564 Eukaryota 1640
72 Ga0247515_105779 3300023564 Eukaryota 1409
73 Ga0247527_103703 3300023664 Eukaryota 1302
74 Ga0247531_103785 3300023666 Eukaryota 1419
75 Ga0247531_104332 3300023666 Eukaryota 1327
76 Ga0247531_104339 3300023666 Eukaryota 1326
77 Ga0247525_103754 3300023668 Eukaryota 1545
78 Ga0247525_104374 3300023668 Eukaryota 1437
79 Ga0247528_102400 3300023680 Eukaryota 1552
80 Ga0247513_103705 3300023682 Eukaryota 1565
81 Ga0247513_103847 3300023682 Eukaryota 1536
82 Ga0247513_103865 3300023682 Eukaryota 1533
83 Ga0247513_104229 3300023682 Eukaryota 1459
84 Ga0247513_104607 3300023682 Eukaryota 1397
85 Ga0247513_104831 3300023682 Eukaryota 1357
86 Ga0247523_105221 3300023684 Eukaryota 1293
87 Ga0247520_103939 3300023686 Eukaryota 1479
88 Ga0247522_103761 3300023688 Eukaryota 1559
89 Ga0247522_104558 3300023688 Eukaryota 1421
90 Ga0247522_104659 3300023688 Eukaryota 1403
91 Ga0247522_105011 3300023688 Eukaryota 1355
92 Ga0247517_103812 3300023689 Eukaryota 1607
93 Ga0247517_104203 3300023689 Eukaryota 1528
94 Ga0247517_105397 3300023689 Eukaryota 1351
95 Ga0247517_105458 3300023689 Eukaryota 1341
96 Ga0247517_105764 3300023689 Eukaryota 1301
97 Ga0247512_104579 3300023690 Eukaryota 1616
98 Ga0247512_104957 3300023690 Eukaryota 1557
99 Ga0247512_105328 3300023690 Eukaryota 1497
100 Ga0207680_10006137 3300025903 Bacteria 5794
101 Ga0207647_10017205 3300025904 Bacteria 4919
102 Ga0207664_10084918 3300025929 Bacteria 2583
103 Ga0207644_10037139 3300025931 Bacteria 3425
104 Ga0207644_10205111 3300025931 Bacteria 1556
105 Ga0207711_10202904 3300025941 Bacteria 1810
106 Ga0207668_10009592 3300025972 Bacteria 5810
107 Ga0207668_10154533 3300025972 Bacteria 1781
108 Ga0207658_10005393 3300025986 Bacteria 8778
109 Ga0207658_10344947 3300025986 Bacteria 1295
110 Ga0207678_10000485 3300026067 Bacteria 36039
111 Ga0207641_10012381 3300026088 Bacteria 6997
112 Ga0268266_10002253 3300028379 Bacteria 21001
113 Ga0268266_10003958 3300028379 Bacteria 14377
114 Ga0268264_10000033 3300028381 Bacteria 404123
115 Ga0268264_10000138 3300028381 Bacteria 172597
116 Ga0268264_10004714 3300028381 Bacteria 11588
117 Ga0268264_10104203 3300028381 Bacteria 2472
118 Ga0311003_159230 3300029282 Eukaryota 1307
119 Ga0311003_176580 3300029282 Eukaryota 1244
120 Ga0310116_103164 3300031591 Eukaryota 1683
121 Ga0310116_103452 3300031591 Eukaryota 1627
122 Ga0310116_105127 3300031591 Eukaryota 1348
123 Ga0310117_105250 3300031592 Eukaryota 1400
124 Ga0310103_107164 3300031614 Eukaryota 1495
125 Ga0310103_108842 3300031614 Eukaryota 1361
126 Ga0310107_104554 3300031615 Eukaryota 1794
127 Ga0310107_106575 3300031615 Eukaryota 1541
128 Ga0310107_108439 3300031615 Eukaryota 1361
129 Ga0310107_108576 3300031615 Eukaryota 1350
130 Ga0310107_110205 3300031615 Eukaryota 1231
131 Ga0310102_101280 3300031632 Eukaryota 1454
132 Ga0310102_101481 3300031632 Eukaryota 1375
133 Ga0310108_104325 3300031633 Eukaryota 1602
134 Ga0310108_105004 3300031633 Eukaryota 1498
135 Ga0310108_105583 3300031633 Eukaryota 1420
136 Ga0310106_101767 3300031634 Eukaryota 1608
137 Ga0310115_106329 3300031635 Eukaryota 1424
138 Ga0310115_108156 3300031635 Eukaryota 1239
139 Ga0310113_104633 3300031636 Eukaryota 1552
140 Ga0310113_105226 3300031636 Eukaryota 1475
141 Ga0310113_105441 3300031636 Eukaryota 1448
142 Ga0310118_102211 3300031664 Eukaryota 1599
143 Ga0310118_102655 3300031664 Eukaryota 1496
144 Ga0310118_102686 3300031664 Eukaryota 1489
145 Ga0310118_102775 3300031664 Eukaryota 1468
146 Ga0310105_103839 3300031666 Eukaryota 1687
147 Ga0310105_103915 3300031666 Eukaryota 1671
148 Ga0310105_104320 3300031666 Eukaryota 1598
149 Ga0310105_105352 3300031666 Eukaryota 1437
150 Ga0310105_106629 3300031666 Eukaryota 1271
151 Ga0310111_107518 3300031667 Eukaryota 1412
152 Ga0310114_102809 3300031678 Eukaryota 1727
153 Ga0310114_103873 3300031678 Eukaryota 1524
154 Ga0310114_104487 3300031678 Eukaryota 1424
155 Ga0310119_105126 3300031686 Eukaryota 1628
156 Ga0310119_105295 3300031686 Eukaryota 1607
157 Ga0310119_106942 3300031686 Eukaryota 1401
158 Ga0310101_105357 3300031690 Eukaryota 1557
159 Ga0310101_106178 3300031690 Eukaryota 1442
160 Ga0316044_106099 3300031810 Eukaryota 1528
161 Ga0316044_106542 3300031810 Eukaryota 1467
162 Ga0316044_106666 3300031810 Eukaryota 1452
163 Ga0316044_106737 3300031810 Eukaryota 1443
164 Ga0316045_104764 3300031815 Eukaryota 1706
165 Ga0316045_106030 3300031815 Eukaryota 1523
166 Ga0316045_107410 3300031815 Eukaryota 1356
167 Ga0316042_105730 3300031816 Eukaryota 1800
168 Ga0316042_107766 3300031816 Eukaryota 1525
169 Ga0316042_107832 3300031816 Eukaryota 1518
170 Ga0316042_107973 3300031816 Eukaryota 1502
171 Ga0316042_108209 3300031816 Eukaryota 1476
172 Ga0316043_106657 3300031828 Eukaryota 1658
173 Ga0316043_106930 3300031828 Eukaryota 1621
174 Ga0316043_107777 3300031828 Eukaryota 1518
175 Ga0316043_108236 3300031828 Eukaryota 1470
176 Ga0307518_10001341 3300031838 Bacteria 18372
177 Ga0307518_10048919 3300031838 Bacteria 3074
178 Ga0307507_10020474 3300033179 Bacteria 7404
179 Ga0307510_10048774 3300033180 Bacteria 4513
180 Ga0307510_10201755 3300033180 Bacteria 1523
181 Ga0316574_0043167 3300035398 Bacteria 2785
182 Ga0310104_02428 3300036242 Eukaryota 1601
183 Ga0310104_02955 3300036242 Eukaryota 1468
184 Ga0310104_03714 3300036242 Eukaryota 1315
185 Ga0265778_005413 3300036457 Eukaryota 1350
186 Ga0310112_006170 3300036458 Eukaryota 1691
187 Ga0310112_007659 3300036458 Eukaryota 1545
188 Ga0310112_008227 3300036458 Eukaryota 1491
189 Ga0310112_010814 3300036458 Eukaryota 1303
190 Ga0310112_010895 3300036458 Eukaryota 1298
191 Ga0310112_011627 3300036458 Eukaryota 1257
192 Ga0310112_011700 3300036458 Eukaryota 1253
193 Ga0372808_005215 3300036459 Eukaryota 1704
194 Ga0372808_005417 3300036459 Eukaryota 1682
195 Ga0372808_009706 3300036459 Eukaryota 1347
196 Ga0372808_010934 3300036459 Eukaryota 1281
197 Ga0372808_011285 3300036459 Eukaryota 1264
198 Ga0310109_005105 3300036534 Eukaryota 1668
199 Ga0310109_005452 3300036534 Eukaryota 1629
200 Ga0310109_005736 3300036534 Eukaryota 1599
201 Ga0310109_007003 3300036534 Eukaryota 1481
202 Ga0310109_009470 3300036534 Eukaryota 1306
203 Ga0310109_014482 3300036534 Eukaryota 1070
204 Ga0310110_006886 3300036535 Eukaryota 1659
205 Ga0310110_007937 3300036535 Eukaryota 1557
206 Ga0310110_009150 3300036535 Eukaryota 1453
207 Ga0310110_010836 3300036535 Eukaryota 1332
208 Ga0310110_011883 3300036535 Eukaryota 1264
209 Ga0316584_0108297 3300036712 Bacteria 2079
210 Ga0439461_0005035 3300041410 Bacteria 2235
211 Ga0451790_10608 3300041444 Eukaryota 1176
212 Ga0451801_21026 3300041455 Eukaryota 1374
213 Ga0451805_060678 3300041461 Eukaryota 1244
214 Ga0452271_15606 3300041916 Eukaryota 1222
215 Ga0466972_0007532 3300044658 Bacteria 5462
216 Ga0495650_0047351 3300046471 Bacteria 1799
217 Ga0496110_0464562 3300048913 Bacteria 1153
218 Ga0496126_0000037 3300048929 Bacteria 353425
219 Ga0501306_004637 3300049127 Eukaryota 1547
220 Ga0501306_006879 3300049127 Eukaryota 1348
221 Ga0501308_003668 3300049128 Eukaryota 1436
222 Ga0501309_003353 3300049129 Eukaryota 1811
223 Ga0501309_005721 3300049129 Eukaryota 1492
224 Ga0501309_008239 3300049129 Eukaryota 1307
225 Ga0501309_009419 3300049129 Eukaryota 1246
226 Ga0501310_004467 3300049130 Eukaryota 1406
227 Ga0501304_001368 3300049160 Eukaryota 1551
228 Ga0501305_006931 3300049161 Eukaryota 1421
229 Ga0501305_007315 3300049161 Eukaryota 1397
230 Ga0501311_005538 3300049527 Eukaryota 1388
231 Ga0501311_005913 3300049527 Eukaryota 1360
232 Ga0501311_007369 3300049527 Eukaryota 1265
233 Ga0501312_007936 3300049528 Eukaryota 1365
234 Ga0501312_012272 3300049528 Eukaryota 1177
235 Ga0501313_003535 3300049529 Eukaryota 1560
236 Ga0501313_004255 3300049529 Eukaryota 1463
237 Ga0501313_004959 3300049529 Eukaryota 1389
238 Ga0501313_005273 3300049529 Eukaryota 1359
239 Ga0501314_002352 3300049530 Eukaryota 1453
240 Ga0501315_004489 3300049531 Eukaryota 1463
241 Ga0501316_005215 3300049532 Eukaryota 1339
242 Ga0501318_005705 3300049534 Eukaryota 1245
243 Ga0501320_004220 3300049536 Eukaryota 1256
244 Ga0501321_003744 3300049537 Eukaryota 1413
245 Ga0501321_005068 3300049537 Eukaryota 1287
246 Ga0501323_004074 3300049539 Eukaryota 1527
247 Ga0501323_005450 3300049539 Eukaryota 1392
248 Ga0501324_001122 3300049540 Eukaryota 1718
249 Ga0501324_002346 3300049540 Eukaryota 1362
250 nmdc:mga00v17_106843_c1 3300050491 Bacteria 1772
251 nmdc:mga06z11_121090_c1 3300050494 Bacteria 1460
252 Ga0587070_010047 3300059491 Eukaryota 1384
253 Ga0587070_010325 3300059491 Eukaryota 1373
254 Ga0587090_010346 3300059510 Eukaryota 1291
255 Ga0587094_006103 3300059513 Eukaryota 1433
256 Ga0587109_012854 3300059624 Eukaryota 1380
257 Ga0587067_008465 3300059640 Eukaryota 1504
258 Ga0587067_009691 3300059640 Eukaryota 1443
259 Ga0587075_006444 3300059644 Eukaryota 1442
260 Ga0587076_012044 3300059645 Eukaryota 1284
261 Ga0587078_004928 3300059646 Eukaryota 1410
262 Ga0587114_004899 3300059655 Eukaryota 1421
263 Ga0587119_004039 3300059658 Eukaryota 1434
264 Ga0587071_012395 3300060344 Eukaryota 1454
265 Ga0587111_0010454 3300060346 Eukaryota 1593
266 Ga0587111_0018589 3300060346 Eukaryota 1309

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036534 Ga0310109_014482 Ga0310109_014482_25_933 280
2 iso_pu_bacteria 2773857933 2774901708 288
3 3300005335 Ga0070666_10008811 Ga0070666_100088112 289
4 3300005367 Ga0070667_100006307 Ga0070667_1000063072 289
5 3300009101 Ga0105247_10056929 Ga0105247_100569291 289
6 3300009553 Ga0105249_10283326 Ga0105249_102833261 289
7 3300023557 Ga0247521_103048 Ga0247521_1030481 289
8 3300023558 Ga0247526_102444 Ga0247526_1024441 289
9 3300023560 Ga0247514_104458 Ga0247514_1044582 289
10 3300023562 Ga0247516_104091 Ga0247516_1040911 289
11 3300023563 Ga0247530_102256 Ga0247530_1022563 289
12 3300023564 Ga0247515_103834 Ga0247515_1038341 289
13 3300023680 Ga0247528_102400 Ga0247528_1024001 289
14 3300023688 Ga0247522_104558 Ga0247522_1045581 289
15 3300023689 Ga0247517_103812 Ga0247517_1038121 289
16 3300031591 Ga0310116_103452 Ga0310116_1034521 289
17 3300031632 Ga0310102_101481 Ga0310102_1014812 289
18 3300031633 Ga0310108_105583 Ga0310108_1055831 289
19 3300031664 Ga0310118_102211 Ga0310118_1022113 289
20 3300031666 Ga0310105_103915 Ga0310105_1039152 289
21 3300031678 Ga0310114_102809 Ga0310114_1028091 289
22 3300031686 Ga0310119_105295 Ga0310119_1052951 289
23 3300031690 Ga0310101_105357 Ga0310101_1053571 289
24 3300031815 Ga0316045_104764 Ga0316045_1047641 289
25 3300031816 Ga0316042_107832 Ga0316042_1078321 289
26 3300036458 Ga0310112_006170 Ga0310112_006170_475_1419 289
27 3300036534 Ga0310109_005105 Ga0310109_005105_457_1401 289
28 3300013308 Ga0157375_10237586 Ga0157375_102375862 291
29 3300048913 Ga0496110_0464562 Ga0496110_0464562_130_1062 291
30 3300050494 nmdc:mga06z11_121090_c1 nmdc:mga06z11_121090_c1_154_1080 291
31 3300036458 Ga0310112_007659 Ga0310112_007659_249_1202 295
32 3300036459 Ga0372808_009706 Ga0372808_009706_175_1128 295
33 3300036535 Ga0310110_009150 Ga0310110_009150_281_1246 295
34 3300036242 Ga0310104_02428 Ga0310104_02428_142_1101 297
35 3300036242 Ga0310104_02955 Ga0310104_02955_309_1268 297
36 3300036458 Ga0310112_008227 Ga0310112_008227_313_1290 297
37 3300036459 Ga0372808_005215 Ga0372808_005215_105_1064 297
38 3300036459 Ga0372808_005417 Ga0372808_005417_501_1460 297
39 3300036459 Ga0372808_011285 Ga0372808_011285_227_1192 297
40 3300036534 Ga0310109_005452 Ga0310109_005452_207_1166 297
41 3300036534 Ga0310109_005736 Ga0310109_005736_501_1460 297
42 3300036535 Ga0310110_006886 Ga0310110_006886_283_1242 297
43 3300036535 Ga0310110_007937 Ga0310110_007937_351_1310 297
44 3300041444 Ga0451790_10608 Ga0451790_10608_187_1134 297
45 3300049539 Ga0501323_004074 Ga0501323_004074_270_1229 297
46 3300048929 Ga0496126_0000037 Ga0496126_0000037_301364_302374 300
47 3300028381 Ga0268264_10104203 Ga0268264_101042032 303
48 3300031666 Ga0310105_103839 Ga0310105_1038391 305
49 3300005455 Ga0070663_100010210 Ga0070663_1000102106 306
50 3300026067 Ga0207678_10000485 Ga0207678_1000048524 306
51 3300041455 Ga0451801_21026 Ga0451801_21026_148_1137 307
52 3300041461 Ga0451805_060678 Ga0451805_060678_242_1231 307
53 3300020082 Ga0206353_11903619 Ga0206353_119036192 309
54 3300005355 Ga0070671_100133302 Ga0070671_1001333022 310
55 3300005548 Ga0070665_100007402 Ga0070665_10000740210 310
56 3300005841 Ga0068863_100009251 Ga0068863_1000092518 310
57 3300005842 Ga0068858_100044271 Ga0068858_1000442715 310
58 3300005843 Ga0068860_100000147 Ga0068860_10000014753 310
59 3300023558 Ga0247526_103722 Ga0247526_1037221 310
60 3300023564 Ga0247515_104204 Ga0247515_1042041 310
61 3300023666 Ga0247531_103785 Ga0247531_1037851 310
62 3300023690 Ga0247512_104579 Ga0247512_1045791 310
63 3300025903 Ga0207680_10006137 Ga0207680_100061377 310
64 3300025931 Ga0207644_10037139 Ga0207644_100371393 310
65 3300025986 Ga0207658_10005393 Ga0207658_100053938 310
66 3300026088 Ga0207641_10012381 Ga0207641_100123812 310
67 3300028379 Ga0268266_10003958 Ga0268266_100039586 310
68 3300028381 Ga0268264_10000033 Ga0268264_1000003338 310
69 3300028381 Ga0268264_10000138 Ga0268264_1000013860 310
70 3300031615 Ga0310107_108576 Ga0310107_1085761 310
71 3300031632 Ga0310102_101280 Ga0310102_1012802 310
72 3300031633 Ga0310108_105004 Ga0310108_1050041 310
73 3300031634 Ga0310106_101767 Ga0310106_1017671 310
74 3300031828 Ga0316043_106657 Ga0316043_1066572 310
75 iso_pu_bacteria 2511231025 2511380609 311
76 3300006038 Ga0075365_10141931 Ga0075365_101419311 312
77 3300006048 Ga0075363_100106779 Ga0075363_1001067791 312
78 3300049129 Ga0501309_008239 Ga0501309_008239_178_1185 312
79 3300049527 Ga0501311_005538 Ga0501311_005538_265_1272 312
80 3300049529 Ga0501313_005273 Ga0501313_005273_123_1130 312
81 iso_pu_bacteria 2870782633 2870788599 312
82 iso_pu_bacteria 2899359706 2899366743 312
83 iso_pu_bacteria 2917736166 2917737634 312
84 3300005355 Ga0070671_100001146 Ga0070671_1000011465 313
85 3300005548 Ga0070665_100001075 Ga0070665_1000010752 313
86 3300005841 Ga0068863_100052231 Ga0068863_1000522314 313
87 3300005843 Ga0068860_100006752 Ga0068860_1000067527 313
88 3300025931 Ga0207644_10205111 Ga0207644_102051112 313
89 3300025972 Ga0207668_10154533 Ga0207668_101545332 313
90 3300025986 Ga0207658_10344947 Ga0207658_103449472 313
91 3300028379 Ga0268266_10002253 Ga0268266_100022537 313
92 3300028381 Ga0268264_10004714 Ga0268264_100047147 313
93 3300050491 nmdc:mga00v17_106843_c1 nmdc:mga00v17_106843_c1_583_1575 313
94 iso_pu_bacteria 2585427649 2586064306 313
95 iso_pu_bacteria 2795385472 2795793430 313
96 iso_pu_bacteria 2808606522 2809586444 313
97 iso_pu_bacteria 2873314349 2873315308 313
98 iso_pu_bacteria 2929212328 2929212801 313
99 iso_pu_bacteria 2687453737 2689955656 314
100 iso_pu_bacteria 3006486233 3006488400 314
101 iso_pu_bacteria 8025478263 8025484855 314
102 3300005347 Ga0070668_100004442 Ga0070668_1000044424 315
103 3300005435 Ga0070714_100103909 Ga0070714_1001039091 315
104 3300025929 Ga0207664_10084918 Ga0207664_100849181 315
105 3300025972 Ga0207668_10009592 Ga0207668_100095924 315
106 3300033179 Ga0307507_10020474 Ga0307507_100204744 315
107 3300033180 Ga0307510_10048774 Ga0307510_100487744 315
108 3300044658 Ga0466972_0007532 Ga0466972_0007532_3369_4346 315
109 3300004803 Ga0058862_10033077 Ga0058862_100330771 316
110 3300005937 Ga0081455_10000082 Ga0081455_100000826 316
111 3300020069 Ga0197907_10083565 Ga0197907_100835651 316
112 3300020070 Ga0206356_10084416 Ga0206356_100844161 316
113 3300020080 Ga0206350_10217510 Ga0206350_102175101 316
114 3300020081 Ga0206354_10144565 Ga0206354_101445651 316
115 3300029282 Ga0311003_159230 Ga0311003_1592301 316
116 3300041410 Ga0439461_0005035 Ga0439461_0005035_318_1331 316
117 3300013297 Ga0157378_10032668 Ga0157378_100326684 317
118 3300023689 Ga0247517_105458 Ga0247517_1054581 317
119 3300025941 Ga0207711_10202904 Ga0207711_102029042 317
120 3300031838 Ga0307518_10001341 Ga0307518_1000134110 317
121 3300035398 Ga0316574_0043167 Ga0316574_0043167_374_1360 317
122 3300036458 Ga0310112_011700 Ga0310112_011700_36_1058 317
123 3300036712 Ga0316584_0108297 Ga0316584_0108297_839_1825 317
124 3300001989 JGI24739J22299_10002999 JGI24739J22299_100029996 318
125 3300002075 JGI24738J21930_10029256 JGI24738J21930_100292561 318
126 3300011119 Ga0105246_10114310 Ga0105246_101143102 318
127 3300023562 Ga0247516_107602 Ga0247516_1076021 318
128 3300023689 Ga0247517_105764 Ga0247517_1057642 318
129 3300025904 Ga0207647_10017205 Ga0207647_100172055 318
130 3300031615 Ga0310107_110205 Ga0310107_1102051 318
131 3300031678 Ga0310114_103873 Ga0310114_1038732 318
132 3300031838 Ga0307518_10048919 Ga0307518_100489193 318
133 3300033180 Ga0307510_10201755 Ga0307510_102017552 318
134 3300036242 Ga0310104_03714 Ga0310104_03714_259_1284 318
135 3300036459 Ga0372808_010934 Ga0372808_010934_225_1250 318
136 3300036534 Ga0310109_007003 Ga0310109_007003_189_1214 318
137 3300046471 Ga0495650_0047351 Ga0495650_0047351_111_1097 318
138 3300003161 Ga0006765J45826_112098 Ga0006765J45826_1120981 319
139 3300003163 Ga0006759J45824_1022406 Ga0006759J45824_10224061 319
140 3300003163 Ga0006759J45824_1057825 Ga0006759J45824_10578251 319
141 3300003544 Ga0007417J51691_1012129 Ga0007417J51691_10121291 319
142 3300003577 Ga0007416J51690_1018706 Ga0007416J51690_10187061 319
143 3300020080 Ga0206350_10099299 Ga0206350_100992991 319
144 3300041916 Ga0452271_15606 Ga0452271_15606_142_1164 319
145 3300049127 Ga0501306_006879 Ga0501306_006879_245_1285 319
146 3300049129 Ga0501309_009419 Ga0501309_009419_141_1181 319
147 3300049527 Ga0501311_007369 Ga0501311_007369_57_1097 319
148 3300049529 Ga0501313_004959 Ga0501313_004959_283_1323 319
149 3300003565 Ga0006560J51390_1013371 Ga0006560J51390_10133711 320
150 3300003577 Ga0007416J51690_1078134 Ga0007416J51690_10781341 320
151 3300004803 Ga0058862_12359543 Ga0058862_123595431 320
152 3300023553 Ga0247524_104650 Ga0247524_1046502 320
153 3300023558 Ga0247526_104389 Ga0247526_1043892 320
154 3300023560 Ga0247514_105541 Ga0247514_1055411 320
155 3300023561 Ga0247518_101152 Ga0247518_1011521 320
156 3300023561 Ga0247518_107383 Ga0247518_1073831 320
157 3300023563 Ga0247530_102588 Ga0247530_1025881 320
158 3300023668 Ga0247525_103754 Ga0247525_1037542 320
159 3300023682 Ga0247513_103705 Ga0247513_1037051 320
160 3300023682 Ga0247513_103865 Ga0247513_1038652 320
161 3300023682 Ga0247513_104229 Ga0247513_1042292 320
162 3300023684 Ga0247523_105221 Ga0247523_1052211 320
163 3300023688 Ga0247522_105011 Ga0247522_1050111 320
164 3300023689 Ga0247517_104203 Ga0247517_1042031 320
165 3300029282 Ga0311003_176580 Ga0311003_1765801 320
166 3300031592 Ga0310117_105250 Ga0310117_1052501 320
167 3300031633 Ga0310108_104325 Ga0310108_1043251 320
168 3300031635 Ga0310115_106329 Ga0310115_1063291 320
169 3300031635 Ga0310115_108156 Ga0310115_1081562 320
170 3300031636 Ga0310113_104633 Ga0310113_1046331 320
171 3300031664 Ga0310118_102655 Ga0310118_1026551 320
172 3300031664 Ga0310118_102686 Ga0310118_1026861 320
173 3300031666 Ga0310105_105352 Ga0310105_1053521 320
174 3300031666 Ga0310105_106629 Ga0310105_1066291 320
175 3300031667 Ga0310111_107518 Ga0310111_1075182 320
176 3300031686 Ga0310119_106942 Ga0310119_1069421 320
177 3300031810 Ga0316044_106737 Ga0316044_1067371 320
178 3300031816 Ga0316042_107766 Ga0316042_1077662 320
179 3300031816 Ga0316042_107973 Ga0316042_1079731 320
180 3300031828 Ga0316043_108236 Ga0316043_1082361 320
181 3300036457 Ga0265778_005413 Ga0265778_005413_34_1080 320
182 3300036458 Ga0310112_010814 Ga0310112_010814_33_1064 320
183 3300036458 Ga0310112_011627 Ga0310112_011627_180_1211 320
184 3300036535 Ga0310110_011883 Ga0310110_011883_47_1078 320
185 3300049128 Ga0501308_003668 Ga0501308_003668_369_1409 320
186 3300049129 Ga0501309_005721 Ga0501309_005721_358_1398 320
187 3300049130 Ga0501310_004467 Ga0501310_004467_338_1378 320
188 3300049160 Ga0501304_001368 Ga0501304_001368_482_1522 320
189 3300049161 Ga0501305_006931 Ga0501305_006931_279_1319 320
190 3300049527 Ga0501311_005913 Ga0501311_005913_293_1333 320
191 3300049528 Ga0501312_007936 Ga0501312_007936_299_1339 320
192 3300049529 Ga0501313_004255 Ga0501313_004255_369_1409 320
193 3300049530 Ga0501314_002352 Ga0501314_002352_115_1155 320
194 3300049531 Ga0501315_004489 Ga0501315_004489_30_1070 320
195 3300049532 Ga0501316_005215 Ga0501316_005215_30_1070 320
196 3300049537 Ga0501321_003744 Ga0501321_003744_345_1385 320
197 3300049540 Ga0501324_002346 Ga0501324_002346_293_1333 320
198 3300059491 Ga0587070_010325 Ga0587070_010325_36_1076 320
199 3300059510 Ga0587090_010346 Ga0587090_010346_160_1200 320
200 3300059513 Ga0587094_006103 Ga0587094_006103_90_1130 320
201 3300059624 Ga0587109_012854 Ga0587109_012854_44_1084 320
202 3300059640 Ga0587067_009691 Ga0587067_009691_303_1343 320
203 3300059644 Ga0587075_006444 Ga0587075_006444_285_1325 320
204 3300059646 Ga0587078_004928 Ga0587078_004928_286_1326 320
205 3300059655 Ga0587114_004899 Ga0587114_004899_290_1330 320
206 3300059658 Ga0587119_004039 Ga0587119_004039_83_1123 320
207 3300060344 Ga0587071_012395 Ga0587071_012395_338_1372 320
208 3300060346 Ga0587111_0010454 Ga0587111_0010454_303_1343 320
209 3300060346 Ga0587111_0018589 Ga0587111_0018589_194_1228 320
210 3300005295 Ga0065707_10084864 Ga0065707_100848648 321
211 3300005445 Ga0070708_100128282 Ga0070708_1001282822 321
212 3300005843 Ga0068860_100082277 Ga0068860_1000822774 321
213 3300049127 Ga0501306_004637 Ga0501306_004637_444_1490 321
214 3300049129 Ga0501309_003353 Ga0501309_003353_708_1754 321
215 3300049161 Ga0501305_007315 Ga0501305_007315_294_1340 321
216 3300049528 Ga0501312_012272 Ga0501312_012272_58_1104 321
217 3300049529 Ga0501313_003535 Ga0501313_003535_457_1503 321
218 3300049534 Ga0501318_005705 Ga0501318_005705_55_1101 321
219 3300049536 Ga0501320_004220 Ga0501320_004220_157_1203 321
220 3300049537 Ga0501321_005068 Ga0501321_005068_58_1104 321
221 3300049539 Ga0501323_005450 Ga0501323_005450_58_1104 321
222 3300049540 Ga0501324_001122 Ga0501324_001122_58_1104 321
223 3300059491 Ga0587070_010047 Ga0587070_010047_58_1104 321
224 3300059640 Ga0587067_008465 Ga0587067_008465_58_1104 321
225 3300059645 Ga0587076_012044 Ga0587076_012044_181_1227 321
226 3300023553 Ga0247524_104225 Ga0247524_1042251 322
227 3300023557 Ga0247521_102936 Ga0247521_1029361 322
228 3300023557 Ga0247521_104821 Ga0247521_1048211 322
229 3300023558 Ga0247526_103839 Ga0247526_1038391 322
230 3300023559 Ga0247529_104206 Ga0247529_1042061 322
231 3300023560 Ga0247514_104608 Ga0247514_1046081 322
232 3300023560 Ga0247514_105417 Ga0247514_1054171 322
233 3300023561 Ga0247518_105337 Ga0247518_1053371 322
234 3300023562 Ga0247516_104829 Ga0247516_1048291 322
235 3300023564 Ga0247515_105779 Ga0247515_1057791 322
236 3300023664 Ga0247527_103703 Ga0247527_1037031 322
237 3300023666 Ga0247531_104332 Ga0247531_1043322 322
238 3300023666 Ga0247531_104339 Ga0247531_1043391 322
239 3300023668 Ga0247525_104374 Ga0247525_1043742 322
240 3300023682 Ga0247513_103847 Ga0247513_1038471 322
241 3300023682 Ga0247513_104831 Ga0247513_1048311 322
242 3300023686 Ga0247520_103939 Ga0247520_1039391 322
243 3300023688 Ga0247522_103761 Ga0247522_1037611 322
244 3300023690 Ga0247512_105328 Ga0247512_1053281 322
245 3300031591 Ga0310116_103164 Ga0310116_1031642 322
246 3300031591 Ga0310116_105127 Ga0310116_1051271 322
247 3300031614 Ga0310103_107164 Ga0310103_1071642 322
248 3300031615 Ga0310107_104554 Ga0310107_1045541 322
249 3300031636 Ga0310113_105226 Ga0310113_1052261 322
250 3300031664 Ga0310118_102775 Ga0310118_1027751 322
251 3300031666 Ga0310105_104320 Ga0310105_1043201 322
252 3300031678 Ga0310114_104487 Ga0310114_1044871 322
253 3300031686 Ga0310119_105126 Ga0310119_1051261 322
254 3300031690 Ga0310101_106178 Ga0310101_1061781 322
255 3300031810 Ga0316044_106099 Ga0316044_1060991 322
256 3300031810 Ga0316044_106542 Ga0316044_1065421 322
257 3300031815 Ga0316045_106030 Ga0316045_1060301 322
258 3300031816 Ga0316042_105730 Ga0316042_1057301 322
259 3300031828 Ga0316043_106930 Ga0316043_1069301 322
260 3300023557 Ga0247521_104119 Ga0247521_1041191 323
261 3300023560 Ga0247514_105962 Ga0247514_1059621 323
262 3300023563 Ga0247530_103823 Ga0247530_1038232 323
263 3300023682 Ga0247513_104607 Ga0247513_1046071 323
264 3300023688 Ga0247522_104659 Ga0247522_1046591 323
265 3300023689 Ga0247517_105397 Ga0247517_1053971 323
266 3300023690 Ga0247512_104957 Ga0247512_1049571 323
267 3300031615 Ga0310107_106575 Ga0310107_1065751 323
268 3300031615 Ga0310107_108439 Ga0310107_1084392 323
269 3300031636 Ga0310113_105441 Ga0310113_1054411 323
270 3300031810 Ga0316044_106666 Ga0316044_1066661 323
271 3300031815 Ga0316045_107410 Ga0316045_1074101 323
272 3300031816 Ga0316042_108209 Ga0316042_1082091 323
273 3300031828 Ga0316043_107777 Ga0316043_1077771 323
274 3300036458 Ga0310112_010895 Ga0310112_010895_28_1077 323
275 3300036534 Ga0310109_009470 Ga0310109_009470_36_1085 323
276 3300036535 Ga0310110_010836 Ga0310110_010836_252_1301 323
277 3300031614 Ga0310103_108842 Ga0310103_1088421 328
278 3300005289 Ga0065704_10070354 Ga0065704_1007035420 329
279 2162886007 SwRhRL2b_contig_825320 SwRhRL2b_0004.00003330 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

67

358

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9356 14 328
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9325 14 325
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9194 14 328
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9112 15 327
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9084 15 327
ID Description Score Start End Superfamily
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9704 86 335 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9657 14 335 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9389 14 240 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9356 14 328 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9337 17 335 3.20.20.100
ID Description Score Start End GO Terms
AF-W9VHQ2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9848 113 214 GO:0004033
GO:0005737
AF-A0A535KBQ5-F1-model_v4 Aldo/keto reductase 0.9781 179 335 GO:0004033
GO:0005737
AF-A0A3N5PSF6-F1-model_v4 Aldo/keto reductase 0.9767 147 335 GO:0004033
GO:0005737
AF-A0A239N909-F1-model_v4 Aldo/keto reductase family protein 0.9721 205 335 GO:0004033
GO:0005737
AF-A0A2I0IYB2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9714 113 335 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
91.24 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map