F383151
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 149 | 266 | 336 |
Family's Representative Sequence
| Representative Sequence | 3300031614|Ga0310103_108842|Ga0310103_1088421 |
| Length | 389 |
| Sequence | VVNYLLKSIYKYTQSTSSPRSKVQHFAVIWKTGESECITRAMAQLAASSTVRRLRLGSQGLEVSAQGLGCMGMSAFYGPPKPDQEMISLIHHAVSRGITFLDTSDIYGPFTNEVLVGKAIKGIREKVQLATKFGIKYADGKREIRGDPAHVRAACEASLKRLDIDCIDLYYQHRIDIKVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGIVPYSPLGRGFLSAGAKLIDNLEDSDFRKFMPRFSKENLEKNKVIFERISEIASKKGCSPSQLALAWVQHQGNDVAPIPGTTKVKNLEENIGALSVELTPLEIKEVEDLVSSAGVFGDRSGEMDITWMNSETPLLSSWKAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 5 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 6 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 7 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 8 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 9 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 10 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 11 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 12 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 13 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 45 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300023553 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 49 | 3300023557 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 50 | 3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 51 | 3300023559 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 52 | 3300023560 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 53 | 3300023561 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 54 | 3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 55 | 3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 56 | 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 57 | 3300023664 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 58 | 3300023666 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 59 | 3300023668 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 60 | 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 61 | 3300023682 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 62 | 3300023684 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 63 | 3300023686 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 64 | 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 65 | 3300023689 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 66 | 3300023690 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 79 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 80 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 81 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 82 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 83 | 3300031632 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 84 | 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 85 | 3300031634 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 86 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 87 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 88 | 3300031664 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 89 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 90 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 91 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 92 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 93 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 94 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 95 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 96 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 97 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 98 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 99 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 100 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 101 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 102 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 103 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 105 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 106 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 107 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 108 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 109 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 110 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 111 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 112 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 113 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 114 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 115 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 117 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 118 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 136 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 137 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 21.86 |
| Metatranscriptomes | 73.48 |
| Isolates | 4.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.43 |
| Nodule | 0.72 |
| Rhizoplane | 1.43 |
| Rhizosphere | 42.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 53.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_825320 | 2162886007 | Bacteria | 30673 |
| 2 | JGI24739J22299_10002999 | 3300001989 | Bacteria | 6459 |
| 3 | JGI24738J21930_10029256 | 3300002075 | Bacteria | 1127 |
| 4 | Ga0006765J45826_112098 | 3300003161 | Eukaryota | 1296 |
| 5 | Ga0006759J45824_1022406 | 3300003163 | Eukaryota | 1288 |
| 6 | Ga0006759J45824_1057825 | 3300003163 | Eukaryota | 1085 |
| 7 | Ga0007417J51691_1012129 | 3300003544 | Eukaryota | 1369 |
| 8 | Ga0006560J51390_1013371 | 3300003565 | Eukaryota | 1212 |
| 9 | Ga0007416J51690_1018706 | 3300003577 | Eukaryota | 1299 |
| 10 | Ga0007416J51690_1078134 | 3300003577 | Eukaryota | 1180 |
| 11 | Ga0058862_10033077 | 3300004803 | Eukaryota | 1225 |
| 12 | Ga0058862_12359543 | 3300004803 | Eukaryota | 1820 |
| 13 | Ga0065704_10070354 | 3300005289 | Bacteria | 30678 |
| 14 | Ga0065707_10084864 | 3300005295 | Bacteria | 6694 |
| 15 | Ga0070666_10008811 | 3300005335 | Bacteria | 6271 |
| 16 | Ga0070668_100004442 | 3300005347 | Bacteria | 10410 |
| 17 | Ga0070671_100001146 | 3300005355 | Bacteria | 19744 |
| 18 | Ga0070671_100133302 | 3300005355 | Bacteria | 2093 |
| 19 | Ga0070667_100006307 | 3300005367 | Bacteria | 9854 |
| 20 | Ga0070714_100103909 | 3300005435 | Bacteria | 2507 |
| 21 | Ga0070708_100128282 | 3300005445 | Bacteria | 2346 |
| 22 | Ga0070663_100010210 | 3300005455 | Bacteria | 5847 |
| 23 | Ga0070665_100001075 | 3300005548 | Bacteria | 34026 |
| 24 | Ga0070665_100007402 | 3300005548 | Bacteria | 11168 |
| 25 | Ga0068863_100009251 | 3300005841 | Bacteria | 9610 |
| 26 | Ga0068863_100052231 | 3300005841 | Bacteria | 3874 |
| 27 | Ga0068858_100044271 | 3300005842 | Bacteria | 4126 |
| 28 | Ga0068860_100000147 | 3300005843 | Bacteria | 115672 |
| 29 | Ga0068860_100006752 | 3300005843 | Bacteria | 11509 |
| 30 | Ga0068860_100082277 | 3300005843 | Bacteria | 3062 |
| 31 | Ga0081455_10000082 | 3300005937 | Bacteria | 103704 |
| 32 | Ga0075365_10141931 | 3300006038 | Bacteria | 1667 |
| 33 | Ga0075363_100106779 | 3300006048 | Bacteria | 1553 |
| 34 | Ga0105247_10056929 | 3300009101 | Bacteria | 2416 |
| 35 | Ga0105249_10283326 | 3300009553 | Bacteria | 1656 |
| 36 | Ga0105246_10114310 | 3300011119 | Bacteria | 1988 |
| 37 | Ga0157378_10032668 | 3300013297 | Bacteria | 4598 |
| 38 | Ga0157375_10237586 | 3300013308 | Bacteria | 1981 |
| 39 | Ga0197907_10083565 | 3300020069 | Eukaryota | 1113 |
| 40 | Ga0206356_10084416 | 3300020070 | Eukaryota | 1234 |
| 41 | Ga0206350_10099299 | 3300020080 | Eukaryota | 1191 |
| 42 | Ga0206350_10217510 | 3300020080 | Eukaryota | 1196 |
| 43 | Ga0206354_10144565 | 3300020081 | Eukaryota | 1147 |
| 44 | Ga0206353_11903619 | 3300020082 | Eukaryota | 1555 |
| 45 | Ga0247524_104225 | 3300023553 | Eukaryota | 1291 |
| 46 | Ga0247524_104650 | 3300023553 | Eukaryota | 1227 |
| 47 | Ga0247521_102936 | 3300023557 | Eukaryota | 1693 |
| 48 | Ga0247521_103048 | 3300023557 | Eukaryota | 1666 |
| 49 | Ga0247521_104119 | 3300023557 | Eukaryota | 1452 |
| 50 | Ga0247521_104821 | 3300023557 | Eukaryota | 1338 |
| 51 | Ga0247526_102444 | 3300023558 | Eukaryota | 1773 |
| 52 | Ga0247526_103722 | 3300023558 | Eukaryota | 1468 |
| 53 | Ga0247526_103839 | 3300023558 | Eukaryota | 1447 |
| 54 | Ga0247526_104389 | 3300023558 | Eukaryota | 1353 |
| 55 | Ga0247529_104206 | 3300023559 | Eukaryota | 1421 |
| 56 | Ga0247514_104458 | 3300023560 | Eukaryota | 1674 |
| 57 | Ga0247514_104608 | 3300023560 | Eukaryota | 1649 |
| 58 | Ga0247514_105417 | 3300023560 | Eukaryota | 1519 |
| 59 | Ga0247514_105541 | 3300023560 | Eukaryota | 1500 |
| 60 | Ga0247514_105962 | 3300023560 | Eukaryota | 1442 |
| 61 | Ga0247518_101152 | 3300023561 | Eukaryota | 2679 |
| 62 | Ga0247518_105337 | 3300023561 | Eukaryota | 1511 |
| 63 | Ga0247518_107383 | 3300023561 | Eukaryota | 1244 |
| 64 | Ga0247516_104091 | 3300023562 | Eukaryota | 1679 |
| 65 | Ga0247516_104829 | 3300023562 | Eukaryota | 1554 |
| 66 | Ga0247516_107602 | 3300023562 | Eukaryota | 1204 |
| 67 | Ga0247530_102256 | 3300023563 | Eukaryota | 1694 |
| 68 | Ga0247530_102588 | 3300023563 | Eukaryota | 1607 |
| 69 | Ga0247530_103823 | 3300023563 | Eukaryota | 1346 |
| 70 | Ga0247515_103834 | 3300023564 | Eukaryota | 1707 |
| 71 | Ga0247515_104204 | 3300023564 | Eukaryota | 1640 |
| 72 | Ga0247515_105779 | 3300023564 | Eukaryota | 1409 |
| 73 | Ga0247527_103703 | 3300023664 | Eukaryota | 1302 |
| 74 | Ga0247531_103785 | 3300023666 | Eukaryota | 1419 |
| 75 | Ga0247531_104332 | 3300023666 | Eukaryota | 1327 |
| 76 | Ga0247531_104339 | 3300023666 | Eukaryota | 1326 |
| 77 | Ga0247525_103754 | 3300023668 | Eukaryota | 1545 |
| 78 | Ga0247525_104374 | 3300023668 | Eukaryota | 1437 |
| 79 | Ga0247528_102400 | 3300023680 | Eukaryota | 1552 |
| 80 | Ga0247513_103705 | 3300023682 | Eukaryota | 1565 |
| 81 | Ga0247513_103847 | 3300023682 | Eukaryota | 1536 |
| 82 | Ga0247513_103865 | 3300023682 | Eukaryota | 1533 |
| 83 | Ga0247513_104229 | 3300023682 | Eukaryota | 1459 |
| 84 | Ga0247513_104607 | 3300023682 | Eukaryota | 1397 |
| 85 | Ga0247513_104831 | 3300023682 | Eukaryota | 1357 |
| 86 | Ga0247523_105221 | 3300023684 | Eukaryota | 1293 |
| 87 | Ga0247520_103939 | 3300023686 | Eukaryota | 1479 |
| 88 | Ga0247522_103761 | 3300023688 | Eukaryota | 1559 |
| 89 | Ga0247522_104558 | 3300023688 | Eukaryota | 1421 |
| 90 | Ga0247522_104659 | 3300023688 | Eukaryota | 1403 |
| 91 | Ga0247522_105011 | 3300023688 | Eukaryota | 1355 |
| 92 | Ga0247517_103812 | 3300023689 | Eukaryota | 1607 |
| 93 | Ga0247517_104203 | 3300023689 | Eukaryota | 1528 |
| 94 | Ga0247517_105397 | 3300023689 | Eukaryota | 1351 |
| 95 | Ga0247517_105458 | 3300023689 | Eukaryota | 1341 |
| 96 | Ga0247517_105764 | 3300023689 | Eukaryota | 1301 |
| 97 | Ga0247512_104579 | 3300023690 | Eukaryota | 1616 |
| 98 | Ga0247512_104957 | 3300023690 | Eukaryota | 1557 |
| 99 | Ga0247512_105328 | 3300023690 | Eukaryota | 1497 |
| 100 | Ga0207680_10006137 | 3300025903 | Bacteria | 5794 |
| 101 | Ga0207647_10017205 | 3300025904 | Bacteria | 4919 |
| 102 | Ga0207664_10084918 | 3300025929 | Bacteria | 2583 |
| 103 | Ga0207644_10037139 | 3300025931 | Bacteria | 3425 |
| 104 | Ga0207644_10205111 | 3300025931 | Bacteria | 1556 |
| 105 | Ga0207711_10202904 | 3300025941 | Bacteria | 1810 |
| 106 | Ga0207668_10009592 | 3300025972 | Bacteria | 5810 |
| 107 | Ga0207668_10154533 | 3300025972 | Bacteria | 1781 |
| 108 | Ga0207658_10005393 | 3300025986 | Bacteria | 8778 |
| 109 | Ga0207658_10344947 | 3300025986 | Bacteria | 1295 |
| 110 | Ga0207678_10000485 | 3300026067 | Bacteria | 36039 |
| 111 | Ga0207641_10012381 | 3300026088 | Bacteria | 6997 |
| 112 | Ga0268266_10002253 | 3300028379 | Bacteria | 21001 |
| 113 | Ga0268266_10003958 | 3300028379 | Bacteria | 14377 |
| 114 | Ga0268264_10000033 | 3300028381 | Bacteria | 404123 |
| 115 | Ga0268264_10000138 | 3300028381 | Bacteria | 172597 |
| 116 | Ga0268264_10004714 | 3300028381 | Bacteria | 11588 |
| 117 | Ga0268264_10104203 | 3300028381 | Bacteria | 2472 |
| 118 | Ga0311003_159230 | 3300029282 | Eukaryota | 1307 |
| 119 | Ga0311003_176580 | 3300029282 | Eukaryota | 1244 |
| 120 | Ga0310116_103164 | 3300031591 | Eukaryota | 1683 |
| 121 | Ga0310116_103452 | 3300031591 | Eukaryota | 1627 |
| 122 | Ga0310116_105127 | 3300031591 | Eukaryota | 1348 |
| 123 | Ga0310117_105250 | 3300031592 | Eukaryota | 1400 |
| 124 | Ga0310103_107164 | 3300031614 | Eukaryota | 1495 |
| 125 | Ga0310103_108842 | 3300031614 | Eukaryota | 1361 |
| 126 | Ga0310107_104554 | 3300031615 | Eukaryota | 1794 |
| 127 | Ga0310107_106575 | 3300031615 | Eukaryota | 1541 |
| 128 | Ga0310107_108439 | 3300031615 | Eukaryota | 1361 |
| 129 | Ga0310107_108576 | 3300031615 | Eukaryota | 1350 |
| 130 | Ga0310107_110205 | 3300031615 | Eukaryota | 1231 |
| 131 | Ga0310102_101280 | 3300031632 | Eukaryota | 1454 |
| 132 | Ga0310102_101481 | 3300031632 | Eukaryota | 1375 |
| 133 | Ga0310108_104325 | 3300031633 | Eukaryota | 1602 |
| 134 | Ga0310108_105004 | 3300031633 | Eukaryota | 1498 |
| 135 | Ga0310108_105583 | 3300031633 | Eukaryota | 1420 |
| 136 | Ga0310106_101767 | 3300031634 | Eukaryota | 1608 |
| 137 | Ga0310115_106329 | 3300031635 | Eukaryota | 1424 |
| 138 | Ga0310115_108156 | 3300031635 | Eukaryota | 1239 |
| 139 | Ga0310113_104633 | 3300031636 | Eukaryota | 1552 |
| 140 | Ga0310113_105226 | 3300031636 | Eukaryota | 1475 |
| 141 | Ga0310113_105441 | 3300031636 | Eukaryota | 1448 |
| 142 | Ga0310118_102211 | 3300031664 | Eukaryota | 1599 |
| 143 | Ga0310118_102655 | 3300031664 | Eukaryota | 1496 |
| 144 | Ga0310118_102686 | 3300031664 | Eukaryota | 1489 |
| 145 | Ga0310118_102775 | 3300031664 | Eukaryota | 1468 |
| 146 | Ga0310105_103839 | 3300031666 | Eukaryota | 1687 |
| 147 | Ga0310105_103915 | 3300031666 | Eukaryota | 1671 |
| 148 | Ga0310105_104320 | 3300031666 | Eukaryota | 1598 |
| 149 | Ga0310105_105352 | 3300031666 | Eukaryota | 1437 |
| 150 | Ga0310105_106629 | 3300031666 | Eukaryota | 1271 |
| 151 | Ga0310111_107518 | 3300031667 | Eukaryota | 1412 |
| 152 | Ga0310114_102809 | 3300031678 | Eukaryota | 1727 |
| 153 | Ga0310114_103873 | 3300031678 | Eukaryota | 1524 |
| 154 | Ga0310114_104487 | 3300031678 | Eukaryota | 1424 |
| 155 | Ga0310119_105126 | 3300031686 | Eukaryota | 1628 |
| 156 | Ga0310119_105295 | 3300031686 | Eukaryota | 1607 |
| 157 | Ga0310119_106942 | 3300031686 | Eukaryota | 1401 |
| 158 | Ga0310101_105357 | 3300031690 | Eukaryota | 1557 |
| 159 | Ga0310101_106178 | 3300031690 | Eukaryota | 1442 |
| 160 | Ga0316044_106099 | 3300031810 | Eukaryota | 1528 |
| 161 | Ga0316044_106542 | 3300031810 | Eukaryota | 1467 |
| 162 | Ga0316044_106666 | 3300031810 | Eukaryota | 1452 |
| 163 | Ga0316044_106737 | 3300031810 | Eukaryota | 1443 |
| 164 | Ga0316045_104764 | 3300031815 | Eukaryota | 1706 |
| 165 | Ga0316045_106030 | 3300031815 | Eukaryota | 1523 |
| 166 | Ga0316045_107410 | 3300031815 | Eukaryota | 1356 |
| 167 | Ga0316042_105730 | 3300031816 | Eukaryota | 1800 |
| 168 | Ga0316042_107766 | 3300031816 | Eukaryota | 1525 |
| 169 | Ga0316042_107832 | 3300031816 | Eukaryota | 1518 |
| 170 | Ga0316042_107973 | 3300031816 | Eukaryota | 1502 |
| 171 | Ga0316042_108209 | 3300031816 | Eukaryota | 1476 |
| 172 | Ga0316043_106657 | 3300031828 | Eukaryota | 1658 |
| 173 | Ga0316043_106930 | 3300031828 | Eukaryota | 1621 |
| 174 | Ga0316043_107777 | 3300031828 | Eukaryota | 1518 |
| 175 | Ga0316043_108236 | 3300031828 | Eukaryota | 1470 |
| 176 | Ga0307518_10001341 | 3300031838 | Bacteria | 18372 |
| 177 | Ga0307518_10048919 | 3300031838 | Bacteria | 3074 |
| 178 | Ga0307507_10020474 | 3300033179 | Bacteria | 7404 |
| 179 | Ga0307510_10048774 | 3300033180 | Bacteria | 4513 |
| 180 | Ga0307510_10201755 | 3300033180 | Bacteria | 1523 |
| 181 | Ga0316574_0043167 | 3300035398 | Bacteria | 2785 |
| 182 | Ga0310104_02428 | 3300036242 | Eukaryota | 1601 |
| 183 | Ga0310104_02955 | 3300036242 | Eukaryota | 1468 |
| 184 | Ga0310104_03714 | 3300036242 | Eukaryota | 1315 |
| 185 | Ga0265778_005413 | 3300036457 | Eukaryota | 1350 |
| 186 | Ga0310112_006170 | 3300036458 | Eukaryota | 1691 |
| 187 | Ga0310112_007659 | 3300036458 | Eukaryota | 1545 |
| 188 | Ga0310112_008227 | 3300036458 | Eukaryota | 1491 |
| 189 | Ga0310112_010814 | 3300036458 | Eukaryota | 1303 |
| 190 | Ga0310112_010895 | 3300036458 | Eukaryota | 1298 |
| 191 | Ga0310112_011627 | 3300036458 | Eukaryota | 1257 |
| 192 | Ga0310112_011700 | 3300036458 | Eukaryota | 1253 |
| 193 | Ga0372808_005215 | 3300036459 | Eukaryota | 1704 |
| 194 | Ga0372808_005417 | 3300036459 | Eukaryota | 1682 |
| 195 | Ga0372808_009706 | 3300036459 | Eukaryota | 1347 |
| 196 | Ga0372808_010934 | 3300036459 | Eukaryota | 1281 |
| 197 | Ga0372808_011285 | 3300036459 | Eukaryota | 1264 |
| 198 | Ga0310109_005105 | 3300036534 | Eukaryota | 1668 |
| 199 | Ga0310109_005452 | 3300036534 | Eukaryota | 1629 |
| 200 | Ga0310109_005736 | 3300036534 | Eukaryota | 1599 |
| 201 | Ga0310109_007003 | 3300036534 | Eukaryota | 1481 |
| 202 | Ga0310109_009470 | 3300036534 | Eukaryota | 1306 |
| 203 | Ga0310109_014482 | 3300036534 | Eukaryota | 1070 |
| 204 | Ga0310110_006886 | 3300036535 | Eukaryota | 1659 |
| 205 | Ga0310110_007937 | 3300036535 | Eukaryota | 1557 |
| 206 | Ga0310110_009150 | 3300036535 | Eukaryota | 1453 |
| 207 | Ga0310110_010836 | 3300036535 | Eukaryota | 1332 |
| 208 | Ga0310110_011883 | 3300036535 | Eukaryota | 1264 |
| 209 | Ga0316584_0108297 | 3300036712 | Bacteria | 2079 |
| 210 | Ga0439461_0005035 | 3300041410 | Bacteria | 2235 |
| 211 | Ga0451790_10608 | 3300041444 | Eukaryota | 1176 |
| 212 | Ga0451801_21026 | 3300041455 | Eukaryota | 1374 |
| 213 | Ga0451805_060678 | 3300041461 | Eukaryota | 1244 |
| 214 | Ga0452271_15606 | 3300041916 | Eukaryota | 1222 |
| 215 | Ga0466972_0007532 | 3300044658 | Bacteria | 5462 |
| 216 | Ga0495650_0047351 | 3300046471 | Bacteria | 1799 |
| 217 | Ga0496110_0464562 | 3300048913 | Bacteria | 1153 |
| 218 | Ga0496126_0000037 | 3300048929 | Bacteria | 353425 |
| 219 | Ga0501306_004637 | 3300049127 | Eukaryota | 1547 |
| 220 | Ga0501306_006879 | 3300049127 | Eukaryota | 1348 |
| 221 | Ga0501308_003668 | 3300049128 | Eukaryota | 1436 |
| 222 | Ga0501309_003353 | 3300049129 | Eukaryota | 1811 |
| 223 | Ga0501309_005721 | 3300049129 | Eukaryota | 1492 |
| 224 | Ga0501309_008239 | 3300049129 | Eukaryota | 1307 |
| 225 | Ga0501309_009419 | 3300049129 | Eukaryota | 1246 |
| 226 | Ga0501310_004467 | 3300049130 | Eukaryota | 1406 |
| 227 | Ga0501304_001368 | 3300049160 | Eukaryota | 1551 |
| 228 | Ga0501305_006931 | 3300049161 | Eukaryota | 1421 |
| 229 | Ga0501305_007315 | 3300049161 | Eukaryota | 1397 |
| 230 | Ga0501311_005538 | 3300049527 | Eukaryota | 1388 |
| 231 | Ga0501311_005913 | 3300049527 | Eukaryota | 1360 |
| 232 | Ga0501311_007369 | 3300049527 | Eukaryota | 1265 |
| 233 | Ga0501312_007936 | 3300049528 | Eukaryota | 1365 |
| 234 | Ga0501312_012272 | 3300049528 | Eukaryota | 1177 |
| 235 | Ga0501313_003535 | 3300049529 | Eukaryota | 1560 |
| 236 | Ga0501313_004255 | 3300049529 | Eukaryota | 1463 |
| 237 | Ga0501313_004959 | 3300049529 | Eukaryota | 1389 |
| 238 | Ga0501313_005273 | 3300049529 | Eukaryota | 1359 |
| 239 | Ga0501314_002352 | 3300049530 | Eukaryota | 1453 |
| 240 | Ga0501315_004489 | 3300049531 | Eukaryota | 1463 |
| 241 | Ga0501316_005215 | 3300049532 | Eukaryota | 1339 |
| 242 | Ga0501318_005705 | 3300049534 | Eukaryota | 1245 |
| 243 | Ga0501320_004220 | 3300049536 | Eukaryota | 1256 |
| 244 | Ga0501321_003744 | 3300049537 | Eukaryota | 1413 |
| 245 | Ga0501321_005068 | 3300049537 | Eukaryota | 1287 |
| 246 | Ga0501323_004074 | 3300049539 | Eukaryota | 1527 |
| 247 | Ga0501323_005450 | 3300049539 | Eukaryota | 1392 |
| 248 | Ga0501324_001122 | 3300049540 | Eukaryota | 1718 |
| 249 | Ga0501324_002346 | 3300049540 | Eukaryota | 1362 |
| 250 | nmdc:mga00v17_106843_c1 | 3300050491 | Bacteria | 1772 |
| 251 | nmdc:mga06z11_121090_c1 | 3300050494 | Bacteria | 1460 |
| 252 | Ga0587070_010047 | 3300059491 | Eukaryota | 1384 |
| 253 | Ga0587070_010325 | 3300059491 | Eukaryota | 1373 |
| 254 | Ga0587090_010346 | 3300059510 | Eukaryota | 1291 |
| 255 | Ga0587094_006103 | 3300059513 | Eukaryota | 1433 |
| 256 | Ga0587109_012854 | 3300059624 | Eukaryota | 1380 |
| 257 | Ga0587067_008465 | 3300059640 | Eukaryota | 1504 |
| 258 | Ga0587067_009691 | 3300059640 | Eukaryota | 1443 |
| 259 | Ga0587075_006444 | 3300059644 | Eukaryota | 1442 |
| 260 | Ga0587076_012044 | 3300059645 | Eukaryota | 1284 |
| 261 | Ga0587078_004928 | 3300059646 | Eukaryota | 1410 |
| 262 | Ga0587114_004899 | 3300059655 | Eukaryota | 1421 |
| 263 | Ga0587119_004039 | 3300059658 | Eukaryota | 1434 |
| 264 | Ga0587071_012395 | 3300060344 | Eukaryota | 1454 |
| 265 | Ga0587111_0010454 | 3300060346 | Eukaryota | 1593 |
| 266 | Ga0587111_0018589 | 3300060346 | Eukaryota | 1309 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036534 | Ga0310109_014482 | Ga0310109_014482_25_933 | 280 |
| 2 | iso_pu_bacteria | 2773857933 | 2774901708 | 288 |
| 3 | 3300005335 | Ga0070666_10008811 | Ga0070666_100088112 | 289 |
| 4 | 3300005367 | Ga0070667_100006307 | Ga0070667_1000063072 | 289 |
| 5 | 3300009101 | Ga0105247_10056929 | Ga0105247_100569291 | 289 |
| 6 | 3300009553 | Ga0105249_10283326 | Ga0105249_102833261 | 289 |
| 7 | 3300023557 | Ga0247521_103048 | Ga0247521_1030481 | 289 |
| 8 | 3300023558 | Ga0247526_102444 | Ga0247526_1024441 | 289 |
| 9 | 3300023560 | Ga0247514_104458 | Ga0247514_1044582 | 289 |
| 10 | 3300023562 | Ga0247516_104091 | Ga0247516_1040911 | 289 |
| 11 | 3300023563 | Ga0247530_102256 | Ga0247530_1022563 | 289 |
| 12 | 3300023564 | Ga0247515_103834 | Ga0247515_1038341 | 289 |
| 13 | 3300023680 | Ga0247528_102400 | Ga0247528_1024001 | 289 |
| 14 | 3300023688 | Ga0247522_104558 | Ga0247522_1045581 | 289 |
| 15 | 3300023689 | Ga0247517_103812 | Ga0247517_1038121 | 289 |
| 16 | 3300031591 | Ga0310116_103452 | Ga0310116_1034521 | 289 |
| 17 | 3300031632 | Ga0310102_101481 | Ga0310102_1014812 | 289 |
| 18 | 3300031633 | Ga0310108_105583 | Ga0310108_1055831 | 289 |
| 19 | 3300031664 | Ga0310118_102211 | Ga0310118_1022113 | 289 |
| 20 | 3300031666 | Ga0310105_103915 | Ga0310105_1039152 | 289 |
| 21 | 3300031678 | Ga0310114_102809 | Ga0310114_1028091 | 289 |
| 22 | 3300031686 | Ga0310119_105295 | Ga0310119_1052951 | 289 |
| 23 | 3300031690 | Ga0310101_105357 | Ga0310101_1053571 | 289 |
| 24 | 3300031815 | Ga0316045_104764 | Ga0316045_1047641 | 289 |
| 25 | 3300031816 | Ga0316042_107832 | Ga0316042_1078321 | 289 |
| 26 | 3300036458 | Ga0310112_006170 | Ga0310112_006170_475_1419 | 289 |
| 27 | 3300036534 | Ga0310109_005105 | Ga0310109_005105_457_1401 | 289 |
| 28 | 3300013308 | Ga0157375_10237586 | Ga0157375_102375862 | 291 |
| 29 | 3300048913 | Ga0496110_0464562 | Ga0496110_0464562_130_1062 | 291 |
| 30 | 3300050494 | nmdc:mga06z11_121090_c1 | nmdc:mga06z11_121090_c1_154_1080 | 291 |
| 31 | 3300036458 | Ga0310112_007659 | Ga0310112_007659_249_1202 | 295 |
| 32 | 3300036459 | Ga0372808_009706 | Ga0372808_009706_175_1128 | 295 |
| 33 | 3300036535 | Ga0310110_009150 | Ga0310110_009150_281_1246 | 295 |
| 34 | 3300036242 | Ga0310104_02428 | Ga0310104_02428_142_1101 | 297 |
| 35 | 3300036242 | Ga0310104_02955 | Ga0310104_02955_309_1268 | 297 |
| 36 | 3300036458 | Ga0310112_008227 | Ga0310112_008227_313_1290 | 297 |
| 37 | 3300036459 | Ga0372808_005215 | Ga0372808_005215_105_1064 | 297 |
| 38 | 3300036459 | Ga0372808_005417 | Ga0372808_005417_501_1460 | 297 |
| 39 | 3300036459 | Ga0372808_011285 | Ga0372808_011285_227_1192 | 297 |
| 40 | 3300036534 | Ga0310109_005452 | Ga0310109_005452_207_1166 | 297 |
| 41 | 3300036534 | Ga0310109_005736 | Ga0310109_005736_501_1460 | 297 |
| 42 | 3300036535 | Ga0310110_006886 | Ga0310110_006886_283_1242 | 297 |
| 43 | 3300036535 | Ga0310110_007937 | Ga0310110_007937_351_1310 | 297 |
| 44 | 3300041444 | Ga0451790_10608 | Ga0451790_10608_187_1134 | 297 |
| 45 | 3300049539 | Ga0501323_004074 | Ga0501323_004074_270_1229 | 297 |
| 46 | 3300048929 | Ga0496126_0000037 | Ga0496126_0000037_301364_302374 | 300 |
| 47 | 3300028381 | Ga0268264_10104203 | Ga0268264_101042032 | 303 |
| 48 | 3300031666 | Ga0310105_103839 | Ga0310105_1038391 | 305 |
| 49 | 3300005455 | Ga0070663_100010210 | Ga0070663_1000102106 | 306 |
| 50 | 3300026067 | Ga0207678_10000485 | Ga0207678_1000048524 | 306 |
| 51 | 3300041455 | Ga0451801_21026 | Ga0451801_21026_148_1137 | 307 |
| 52 | 3300041461 | Ga0451805_060678 | Ga0451805_060678_242_1231 | 307 |
| 53 | 3300020082 | Ga0206353_11903619 | Ga0206353_119036192 | 309 |
| 54 | 3300005355 | Ga0070671_100133302 | Ga0070671_1001333022 | 310 |
| 55 | 3300005548 | Ga0070665_100007402 | Ga0070665_10000740210 | 310 |
| 56 | 3300005841 | Ga0068863_100009251 | Ga0068863_1000092518 | 310 |
| 57 | 3300005842 | Ga0068858_100044271 | Ga0068858_1000442715 | 310 |
| 58 | 3300005843 | Ga0068860_100000147 | Ga0068860_10000014753 | 310 |
| 59 | 3300023558 | Ga0247526_103722 | Ga0247526_1037221 | 310 |
| 60 | 3300023564 | Ga0247515_104204 | Ga0247515_1042041 | 310 |
| 61 | 3300023666 | Ga0247531_103785 | Ga0247531_1037851 | 310 |
| 62 | 3300023690 | Ga0247512_104579 | Ga0247512_1045791 | 310 |
| 63 | 3300025903 | Ga0207680_10006137 | Ga0207680_100061377 | 310 |
| 64 | 3300025931 | Ga0207644_10037139 | Ga0207644_100371393 | 310 |
| 65 | 3300025986 | Ga0207658_10005393 | Ga0207658_100053938 | 310 |
| 66 | 3300026088 | Ga0207641_10012381 | Ga0207641_100123812 | 310 |
| 67 | 3300028379 | Ga0268266_10003958 | Ga0268266_100039586 | 310 |
| 68 | 3300028381 | Ga0268264_10000033 | Ga0268264_1000003338 | 310 |
| 69 | 3300028381 | Ga0268264_10000138 | Ga0268264_1000013860 | 310 |
| 70 | 3300031615 | Ga0310107_108576 | Ga0310107_1085761 | 310 |
| 71 | 3300031632 | Ga0310102_101280 | Ga0310102_1012802 | 310 |
| 72 | 3300031633 | Ga0310108_105004 | Ga0310108_1050041 | 310 |
| 73 | 3300031634 | Ga0310106_101767 | Ga0310106_1017671 | 310 |
| 74 | 3300031828 | Ga0316043_106657 | Ga0316043_1066572 | 310 |
| 75 | iso_pu_bacteria | 2511231025 | 2511380609 | 311 |
| 76 | 3300006038 | Ga0075365_10141931 | Ga0075365_101419311 | 312 |
| 77 | 3300006048 | Ga0075363_100106779 | Ga0075363_1001067791 | 312 |
| 78 | 3300049129 | Ga0501309_008239 | Ga0501309_008239_178_1185 | 312 |
| 79 | 3300049527 | Ga0501311_005538 | Ga0501311_005538_265_1272 | 312 |
| 80 | 3300049529 | Ga0501313_005273 | Ga0501313_005273_123_1130 | 312 |
| 81 | iso_pu_bacteria | 2870782633 | 2870788599 | 312 |
| 82 | iso_pu_bacteria | 2899359706 | 2899366743 | 312 |
| 83 | iso_pu_bacteria | 2917736166 | 2917737634 | 312 |
| 84 | 3300005355 | Ga0070671_100001146 | Ga0070671_1000011465 | 313 |
| 85 | 3300005548 | Ga0070665_100001075 | Ga0070665_1000010752 | 313 |
| 86 | 3300005841 | Ga0068863_100052231 | Ga0068863_1000522314 | 313 |
| 87 | 3300005843 | Ga0068860_100006752 | Ga0068860_1000067527 | 313 |
| 88 | 3300025931 | Ga0207644_10205111 | Ga0207644_102051112 | 313 |
| 89 | 3300025972 | Ga0207668_10154533 | Ga0207668_101545332 | 313 |
| 90 | 3300025986 | Ga0207658_10344947 | Ga0207658_103449472 | 313 |
| 91 | 3300028379 | Ga0268266_10002253 | Ga0268266_100022537 | 313 |
| 92 | 3300028381 | Ga0268264_10004714 | Ga0268264_100047147 | 313 |
| 93 | 3300050491 | nmdc:mga00v17_106843_c1 | nmdc:mga00v17_106843_c1_583_1575 | 313 |
| 94 | iso_pu_bacteria | 2585427649 | 2586064306 | 313 |
| 95 | iso_pu_bacteria | 2795385472 | 2795793430 | 313 |
| 96 | iso_pu_bacteria | 2808606522 | 2809586444 | 313 |
| 97 | iso_pu_bacteria | 2873314349 | 2873315308 | 313 |
| 98 | iso_pu_bacteria | 2929212328 | 2929212801 | 313 |
| 99 | iso_pu_bacteria | 2687453737 | 2689955656 | 314 |
| 100 | iso_pu_bacteria | 3006486233 | 3006488400 | 314 |
| 101 | iso_pu_bacteria | 8025478263 | 8025484855 | 314 |
| 102 | 3300005347 | Ga0070668_100004442 | Ga0070668_1000044424 | 315 |
| 103 | 3300005435 | Ga0070714_100103909 | Ga0070714_1001039091 | 315 |
| 104 | 3300025929 | Ga0207664_10084918 | Ga0207664_100849181 | 315 |
| 105 | 3300025972 | Ga0207668_10009592 | Ga0207668_100095924 | 315 |
| 106 | 3300033179 | Ga0307507_10020474 | Ga0307507_100204744 | 315 |
| 107 | 3300033180 | Ga0307510_10048774 | Ga0307510_100487744 | 315 |
| 108 | 3300044658 | Ga0466972_0007532 | Ga0466972_0007532_3369_4346 | 315 |
| 109 | 3300004803 | Ga0058862_10033077 | Ga0058862_100330771 | 316 |
| 110 | 3300005937 | Ga0081455_10000082 | Ga0081455_100000826 | 316 |
| 111 | 3300020069 | Ga0197907_10083565 | Ga0197907_100835651 | 316 |
| 112 | 3300020070 | Ga0206356_10084416 | Ga0206356_100844161 | 316 |
| 113 | 3300020080 | Ga0206350_10217510 | Ga0206350_102175101 | 316 |
| 114 | 3300020081 | Ga0206354_10144565 | Ga0206354_101445651 | 316 |
| 115 | 3300029282 | Ga0311003_159230 | Ga0311003_1592301 | 316 |
| 116 | 3300041410 | Ga0439461_0005035 | Ga0439461_0005035_318_1331 | 316 |
| 117 | 3300013297 | Ga0157378_10032668 | Ga0157378_100326684 | 317 |
| 118 | 3300023689 | Ga0247517_105458 | Ga0247517_1054581 | 317 |
| 119 | 3300025941 | Ga0207711_10202904 | Ga0207711_102029042 | 317 |
| 120 | 3300031838 | Ga0307518_10001341 | Ga0307518_1000134110 | 317 |
| 121 | 3300035398 | Ga0316574_0043167 | Ga0316574_0043167_374_1360 | 317 |
| 122 | 3300036458 | Ga0310112_011700 | Ga0310112_011700_36_1058 | 317 |
| 123 | 3300036712 | Ga0316584_0108297 | Ga0316584_0108297_839_1825 | 317 |
| 124 | 3300001989 | JGI24739J22299_10002999 | JGI24739J22299_100029996 | 318 |
| 125 | 3300002075 | JGI24738J21930_10029256 | JGI24738J21930_100292561 | 318 |
| 126 | 3300011119 | Ga0105246_10114310 | Ga0105246_101143102 | 318 |
| 127 | 3300023562 | Ga0247516_107602 | Ga0247516_1076021 | 318 |
| 128 | 3300023689 | Ga0247517_105764 | Ga0247517_1057642 | 318 |
| 129 | 3300025904 | Ga0207647_10017205 | Ga0207647_100172055 | 318 |
| 130 | 3300031615 | Ga0310107_110205 | Ga0310107_1102051 | 318 |
| 131 | 3300031678 | Ga0310114_103873 | Ga0310114_1038732 | 318 |
| 132 | 3300031838 | Ga0307518_10048919 | Ga0307518_100489193 | 318 |
| 133 | 3300033180 | Ga0307510_10201755 | Ga0307510_102017552 | 318 |
| 134 | 3300036242 | Ga0310104_03714 | Ga0310104_03714_259_1284 | 318 |
| 135 | 3300036459 | Ga0372808_010934 | Ga0372808_010934_225_1250 | 318 |
| 136 | 3300036534 | Ga0310109_007003 | Ga0310109_007003_189_1214 | 318 |
| 137 | 3300046471 | Ga0495650_0047351 | Ga0495650_0047351_111_1097 | 318 |
| 138 | 3300003161 | Ga0006765J45826_112098 | Ga0006765J45826_1120981 | 319 |
| 139 | 3300003163 | Ga0006759J45824_1022406 | Ga0006759J45824_10224061 | 319 |
| 140 | 3300003163 | Ga0006759J45824_1057825 | Ga0006759J45824_10578251 | 319 |
| 141 | 3300003544 | Ga0007417J51691_1012129 | Ga0007417J51691_10121291 | 319 |
| 142 | 3300003577 | Ga0007416J51690_1018706 | Ga0007416J51690_10187061 | 319 |
| 143 | 3300020080 | Ga0206350_10099299 | Ga0206350_100992991 | 319 |
| 144 | 3300041916 | Ga0452271_15606 | Ga0452271_15606_142_1164 | 319 |
| 145 | 3300049127 | Ga0501306_006879 | Ga0501306_006879_245_1285 | 319 |
| 146 | 3300049129 | Ga0501309_009419 | Ga0501309_009419_141_1181 | 319 |
| 147 | 3300049527 | Ga0501311_007369 | Ga0501311_007369_57_1097 | 319 |
| 148 | 3300049529 | Ga0501313_004959 | Ga0501313_004959_283_1323 | 319 |
| 149 | 3300003565 | Ga0006560J51390_1013371 | Ga0006560J51390_10133711 | 320 |
| 150 | 3300003577 | Ga0007416J51690_1078134 | Ga0007416J51690_10781341 | 320 |
| 151 | 3300004803 | Ga0058862_12359543 | Ga0058862_123595431 | 320 |
| 152 | 3300023553 | Ga0247524_104650 | Ga0247524_1046502 | 320 |
| 153 | 3300023558 | Ga0247526_104389 | Ga0247526_1043892 | 320 |
| 154 | 3300023560 | Ga0247514_105541 | Ga0247514_1055411 | 320 |
| 155 | 3300023561 | Ga0247518_101152 | Ga0247518_1011521 | 320 |
| 156 | 3300023561 | Ga0247518_107383 | Ga0247518_1073831 | 320 |
| 157 | 3300023563 | Ga0247530_102588 | Ga0247530_1025881 | 320 |
| 158 | 3300023668 | Ga0247525_103754 | Ga0247525_1037542 | 320 |
| 159 | 3300023682 | Ga0247513_103705 | Ga0247513_1037051 | 320 |
| 160 | 3300023682 | Ga0247513_103865 | Ga0247513_1038652 | 320 |
| 161 | 3300023682 | Ga0247513_104229 | Ga0247513_1042292 | 320 |
| 162 | 3300023684 | Ga0247523_105221 | Ga0247523_1052211 | 320 |
| 163 | 3300023688 | Ga0247522_105011 | Ga0247522_1050111 | 320 |
| 164 | 3300023689 | Ga0247517_104203 | Ga0247517_1042031 | 320 |
| 165 | 3300029282 | Ga0311003_176580 | Ga0311003_1765801 | 320 |
| 166 | 3300031592 | Ga0310117_105250 | Ga0310117_1052501 | 320 |
| 167 | 3300031633 | Ga0310108_104325 | Ga0310108_1043251 | 320 |
| 168 | 3300031635 | Ga0310115_106329 | Ga0310115_1063291 | 320 |
| 169 | 3300031635 | Ga0310115_108156 | Ga0310115_1081562 | 320 |
| 170 | 3300031636 | Ga0310113_104633 | Ga0310113_1046331 | 320 |
| 171 | 3300031664 | Ga0310118_102655 | Ga0310118_1026551 | 320 |
| 172 | 3300031664 | Ga0310118_102686 | Ga0310118_1026861 | 320 |
| 173 | 3300031666 | Ga0310105_105352 | Ga0310105_1053521 | 320 |
| 174 | 3300031666 | Ga0310105_106629 | Ga0310105_1066291 | 320 |
| 175 | 3300031667 | Ga0310111_107518 | Ga0310111_1075182 | 320 |
| 176 | 3300031686 | Ga0310119_106942 | Ga0310119_1069421 | 320 |
| 177 | 3300031810 | Ga0316044_106737 | Ga0316044_1067371 | 320 |
| 178 | 3300031816 | Ga0316042_107766 | Ga0316042_1077662 | 320 |
| 179 | 3300031816 | Ga0316042_107973 | Ga0316042_1079731 | 320 |
| 180 | 3300031828 | Ga0316043_108236 | Ga0316043_1082361 | 320 |
| 181 | 3300036457 | Ga0265778_005413 | Ga0265778_005413_34_1080 | 320 |
| 182 | 3300036458 | Ga0310112_010814 | Ga0310112_010814_33_1064 | 320 |
| 183 | 3300036458 | Ga0310112_011627 | Ga0310112_011627_180_1211 | 320 |
| 184 | 3300036535 | Ga0310110_011883 | Ga0310110_011883_47_1078 | 320 |
| 185 | 3300049128 | Ga0501308_003668 | Ga0501308_003668_369_1409 | 320 |
| 186 | 3300049129 | Ga0501309_005721 | Ga0501309_005721_358_1398 | 320 |
| 187 | 3300049130 | Ga0501310_004467 | Ga0501310_004467_338_1378 | 320 |
| 188 | 3300049160 | Ga0501304_001368 | Ga0501304_001368_482_1522 | 320 |
| 189 | 3300049161 | Ga0501305_006931 | Ga0501305_006931_279_1319 | 320 |
| 190 | 3300049527 | Ga0501311_005913 | Ga0501311_005913_293_1333 | 320 |
| 191 | 3300049528 | Ga0501312_007936 | Ga0501312_007936_299_1339 | 320 |
| 192 | 3300049529 | Ga0501313_004255 | Ga0501313_004255_369_1409 | 320 |
| 193 | 3300049530 | Ga0501314_002352 | Ga0501314_002352_115_1155 | 320 |
| 194 | 3300049531 | Ga0501315_004489 | Ga0501315_004489_30_1070 | 320 |
| 195 | 3300049532 | Ga0501316_005215 | Ga0501316_005215_30_1070 | 320 |
| 196 | 3300049537 | Ga0501321_003744 | Ga0501321_003744_345_1385 | 320 |
| 197 | 3300049540 | Ga0501324_002346 | Ga0501324_002346_293_1333 | 320 |
| 198 | 3300059491 | Ga0587070_010325 | Ga0587070_010325_36_1076 | 320 |
| 199 | 3300059510 | Ga0587090_010346 | Ga0587090_010346_160_1200 | 320 |
| 200 | 3300059513 | Ga0587094_006103 | Ga0587094_006103_90_1130 | 320 |
| 201 | 3300059624 | Ga0587109_012854 | Ga0587109_012854_44_1084 | 320 |
| 202 | 3300059640 | Ga0587067_009691 | Ga0587067_009691_303_1343 | 320 |
| 203 | 3300059644 | Ga0587075_006444 | Ga0587075_006444_285_1325 | 320 |
| 204 | 3300059646 | Ga0587078_004928 | Ga0587078_004928_286_1326 | 320 |
| 205 | 3300059655 | Ga0587114_004899 | Ga0587114_004899_290_1330 | 320 |
| 206 | 3300059658 | Ga0587119_004039 | Ga0587119_004039_83_1123 | 320 |
| 207 | 3300060344 | Ga0587071_012395 | Ga0587071_012395_338_1372 | 320 |
| 208 | 3300060346 | Ga0587111_0010454 | Ga0587111_0010454_303_1343 | 320 |
| 209 | 3300060346 | Ga0587111_0018589 | Ga0587111_0018589_194_1228 | 320 |
| 210 | 3300005295 | Ga0065707_10084864 | Ga0065707_100848648 | 321 |
| 211 | 3300005445 | Ga0070708_100128282 | Ga0070708_1001282822 | 321 |
| 212 | 3300005843 | Ga0068860_100082277 | Ga0068860_1000822774 | 321 |
| 213 | 3300049127 | Ga0501306_004637 | Ga0501306_004637_444_1490 | 321 |
| 214 | 3300049129 | Ga0501309_003353 | Ga0501309_003353_708_1754 | 321 |
| 215 | 3300049161 | Ga0501305_007315 | Ga0501305_007315_294_1340 | 321 |
| 216 | 3300049528 | Ga0501312_012272 | Ga0501312_012272_58_1104 | 321 |
| 217 | 3300049529 | Ga0501313_003535 | Ga0501313_003535_457_1503 | 321 |
| 218 | 3300049534 | Ga0501318_005705 | Ga0501318_005705_55_1101 | 321 |
| 219 | 3300049536 | Ga0501320_004220 | Ga0501320_004220_157_1203 | 321 |
| 220 | 3300049537 | Ga0501321_005068 | Ga0501321_005068_58_1104 | 321 |
| 221 | 3300049539 | Ga0501323_005450 | Ga0501323_005450_58_1104 | 321 |
| 222 | 3300049540 | Ga0501324_001122 | Ga0501324_001122_58_1104 | 321 |
| 223 | 3300059491 | Ga0587070_010047 | Ga0587070_010047_58_1104 | 321 |
| 224 | 3300059640 | Ga0587067_008465 | Ga0587067_008465_58_1104 | 321 |
| 225 | 3300059645 | Ga0587076_012044 | Ga0587076_012044_181_1227 | 321 |
| 226 | 3300023553 | Ga0247524_104225 | Ga0247524_1042251 | 322 |
| 227 | 3300023557 | Ga0247521_102936 | Ga0247521_1029361 | 322 |
| 228 | 3300023557 | Ga0247521_104821 | Ga0247521_1048211 | 322 |
| 229 | 3300023558 | Ga0247526_103839 | Ga0247526_1038391 | 322 |
| 230 | 3300023559 | Ga0247529_104206 | Ga0247529_1042061 | 322 |
| 231 | 3300023560 | Ga0247514_104608 | Ga0247514_1046081 | 322 |
| 232 | 3300023560 | Ga0247514_105417 | Ga0247514_1054171 | 322 |
| 233 | 3300023561 | Ga0247518_105337 | Ga0247518_1053371 | 322 |
| 234 | 3300023562 | Ga0247516_104829 | Ga0247516_1048291 | 322 |
| 235 | 3300023564 | Ga0247515_105779 | Ga0247515_1057791 | 322 |
| 236 | 3300023664 | Ga0247527_103703 | Ga0247527_1037031 | 322 |
| 237 | 3300023666 | Ga0247531_104332 | Ga0247531_1043322 | 322 |
| 238 | 3300023666 | Ga0247531_104339 | Ga0247531_1043391 | 322 |
| 239 | 3300023668 | Ga0247525_104374 | Ga0247525_1043742 | 322 |
| 240 | 3300023682 | Ga0247513_103847 | Ga0247513_1038471 | 322 |
| 241 | 3300023682 | Ga0247513_104831 | Ga0247513_1048311 | 322 |
| 242 | 3300023686 | Ga0247520_103939 | Ga0247520_1039391 | 322 |
| 243 | 3300023688 | Ga0247522_103761 | Ga0247522_1037611 | 322 |
| 244 | 3300023690 | Ga0247512_105328 | Ga0247512_1053281 | 322 |
| 245 | 3300031591 | Ga0310116_103164 | Ga0310116_1031642 | 322 |
| 246 | 3300031591 | Ga0310116_105127 | Ga0310116_1051271 | 322 |
| 247 | 3300031614 | Ga0310103_107164 | Ga0310103_1071642 | 322 |
| 248 | 3300031615 | Ga0310107_104554 | Ga0310107_1045541 | 322 |
| 249 | 3300031636 | Ga0310113_105226 | Ga0310113_1052261 | 322 |
| 250 | 3300031664 | Ga0310118_102775 | Ga0310118_1027751 | 322 |
| 251 | 3300031666 | Ga0310105_104320 | Ga0310105_1043201 | 322 |
| 252 | 3300031678 | Ga0310114_104487 | Ga0310114_1044871 | 322 |
| 253 | 3300031686 | Ga0310119_105126 | Ga0310119_1051261 | 322 |
| 254 | 3300031690 | Ga0310101_106178 | Ga0310101_1061781 | 322 |
| 255 | 3300031810 | Ga0316044_106099 | Ga0316044_1060991 | 322 |
| 256 | 3300031810 | Ga0316044_106542 | Ga0316044_1065421 | 322 |
| 257 | 3300031815 | Ga0316045_106030 | Ga0316045_1060301 | 322 |
| 258 | 3300031816 | Ga0316042_105730 | Ga0316042_1057301 | 322 |
| 259 | 3300031828 | Ga0316043_106930 | Ga0316043_1069301 | 322 |
| 260 | 3300023557 | Ga0247521_104119 | Ga0247521_1041191 | 323 |
| 261 | 3300023560 | Ga0247514_105962 | Ga0247514_1059621 | 323 |
| 262 | 3300023563 | Ga0247530_103823 | Ga0247530_1038232 | 323 |
| 263 | 3300023682 | Ga0247513_104607 | Ga0247513_1046071 | 323 |
| 264 | 3300023688 | Ga0247522_104659 | Ga0247522_1046591 | 323 |
| 265 | 3300023689 | Ga0247517_105397 | Ga0247517_1053971 | 323 |
| 266 | 3300023690 | Ga0247512_104957 | Ga0247512_1049571 | 323 |
| 267 | 3300031615 | Ga0310107_106575 | Ga0310107_1065751 | 323 |
| 268 | 3300031615 | Ga0310107_108439 | Ga0310107_1084392 | 323 |
| 269 | 3300031636 | Ga0310113_105441 | Ga0310113_1054411 | 323 |
| 270 | 3300031810 | Ga0316044_106666 | Ga0316044_1066661 | 323 |
| 271 | 3300031815 | Ga0316045_107410 | Ga0316045_1074101 | 323 |
| 272 | 3300031816 | Ga0316042_108209 | Ga0316042_1082091 | 323 |
| 273 | 3300031828 | Ga0316043_107777 | Ga0316043_1077771 | 323 |
| 274 | 3300036458 | Ga0310112_010895 | Ga0310112_010895_28_1077 | 323 |
| 275 | 3300036534 | Ga0310109_009470 | Ga0310109_009470_36_1085 | 323 |
| 276 | 3300036535 | Ga0310110_010836 | Ga0310110_010836_252_1301 | 323 |
| 277 | 3300031614 | Ga0310103_108842 | Ga0310103_1088421 | 328 |
| 278 | 3300005289 | Ga0065704_10070354 | Ga0065704_1007035420 | 329 |
| 279 | 2162886007 | SwRhRL2b_contig_825320 | SwRhRL2b_0004.00003330 | 335 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9356 | 14 | 328 |
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9325 | 14 | 325 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9194 | 14 | 328 |
| 1pz0-assembly1.cif.gz_A | structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) | 0.9112 | 15 | 327 |
| 1pz0-assembly1.cif.gz_A | structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) | 0.9084 | 15 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6KUU8_358_629_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9704 | 86 | 335 | 3.20.20.100 |
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9657 | 14 | 335 | 3.20.20.100 |
| af_A0A0R0ETH2_7_234_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9389 | 14 | 240 | 3.20.20.100 |
| 3v0uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9356 | 14 | 328 | 3.20.20.100 |
| af_Q09923_6_337_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9337 | 17 | 335 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W9VHQ2-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9848 | 113 | 214 |
GO:0004033
GO:0005737 |
| AF-A0A535KBQ5-F1-model_v4 | Aldo/keto reductase | 0.9781 | 179 | 335 |
GO:0004033
GO:0005737 |
| AF-A0A3N5PSF6-F1-model_v4 | Aldo/keto reductase | 0.9767 | 147 | 335 |
GO:0004033
GO:0005737 |
| AF-A0A239N909-F1-model_v4 | Aldo/keto reductase family protein | 0.9721 | 205 | 335 |
GO:0004033
GO:0005737 |
| AF-A0A2I0IYB2-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9714 | 113 | 335 |
GO:0004033
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar