F382898

General Info

Members Datasets Scaffolds Average Seq Length
279 145 558 199

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10017007|Ga0070681_100170076
Length 204
Sequence MLKIYGIPRSRAFRTLWMAKELGLDYDNVPIDFANGGSRTPEYLKINPNGHVPAIDDDGLVLWESMAINLYLAKKYGSGTLYPTRIEDEGRTWQWSFWGMTEIERHVLTAMFNRAILPEDKRDAALADDSERQLQAPLGVLNGALAGSPYLIGDHFTVADLNIASILSWARPARIDFTPFPHAADWAKRCADRPAARAARDLQR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.15
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10017007 3300005458 Bacteria 7268
2 Ga0065715_10009291 3300005293 Bacteria 4296
3 Ga0065715_10016319 3300005293 Unclassified 2439
4 Ga0065707_10089357 3300005295 Bacteria 4392
5 Ga0065707_10364908 3300005295 Bacteria 898
6 Ga0070670_100001395 3300005331 Bacteria 19372
7 Ga0070666_10084005 3300005335 Unclassified 2179
8 Ga0070660_100200079 3300005339 Unclassified 1620
9 Ga0070660_100401853 3300005339 Bacteria 1133
10 Ga0070660_101305328 3300005339 Bacteria 616
11 Ga0070661_100676215 3300005344 Bacteria 839
12 Ga0070661_100689574 3300005344 Bacteria 831
13 Ga0070692_10337134 3300005345 Bacteria 932
14 Ga0070668_100207626 3300005347 Bacteria 1610
15 Ga0070669_100089024 3300005353 Bacteria 2311
16 Ga0070675_100080660 3300005354 Unclassified 2712
17 Ga0070671_100120265 3300005355 Bacteria 2209
18 Ga0070674_100149488 3300005356 Bacteria 1761
19 Ga0070674_100289325 3300005356 Bacteria 1302
20 Ga0070673_100329978 3300005364 Unclassified 1349
21 Ga0070659_100023959 3300005366 Bacteria 4675
22 Ga0070659_100197399 3300005366 Unclassified 1655
23 Ga0070667_100044260 3300005367 Bacteria 3737
24 Ga0070711_100619439 3300005439 Bacteria 904
25 Ga0070705_100228108 3300005440 Bacteria 1294
26 Ga0070705_100551355 3300005440 Bacteria 884
27 Ga0070694_100167210 3300005444 Bacteria 1618
28 Ga0070708_100039885 3300005445 Bacteria 4111
29 Ga0070678_100047206 3300005456 Bacteria 3093
30 Ga0070662_100077956 3300005457 Bacteria 2460
31 Ga0070681_10021534 3300005458 Bacteria 6461
32 Ga0070681_10080349 3300005458 Unclassified 3216
33 Ga0070681_10163472 3300005458 Bacteria 2149
34 Ga0068867_101062790 3300005459 Bacteria 737
35 Ga0070706_100613021 3300005467 Bacteria 1011
36 Ga0070698_100319959 3300005471 Bacteria 1482
37 Ga0070679_100150350 3300005530 Unclassified 2305
38 Ga0070679_100511934 3300005530 Bacteria 1144
39 Ga0070672_100394037 3300005543 Bacteria 1186
40 Ga0070696_100087052 3300005546 Bacteria 2219
41 Ga0070696_100160746 3300005546 Bacteria 1655
42 Ga0068855_100077632 3300005563 Bacteria 3853
43 Ga0068856_100292183 3300005614 Bacteria 1647
44 Ga0068861_100537568 3300005719 Bacteria 1063
45 Ga0081455_10005233 3300005937 Bacteria 14262
46 Ga0081455_10213820 3300005937 Unclassified 1435
47 Ga0081538_10018587 3300005981 Bacteria 5211
48 Ga0070712_100085686 3300006175 Bacteria 2294
49 Ga0075428_100027142 3300006844 Bacteria 6339
50 Ga0075428_100043372 3300006844 Bacteria 4944
51 Ga0075430_100077679 3300006846 Bacteria 2782
52 Ga0075431_100210102 3300006847 Bacteria 1988
53 Ga0075431_100583533 3300006847 Bacteria 1103
54 Ga0075433_10003729 3300006852 Bacteria 11786
55 Ga0075433_10051080 3300006852 Bacteria 3600
56 Ga0075433_10162577 3300006852 Bacteria 1987
57 Ga0075434_100010476 3300006871 Bacteria 8691
58 Ga0075434_100022274 3300006871 Bacteria 6171
59 Ga0075434_100023069 3300006871 Bacteria 6059
60 Ga0075434_100051917 3300006871 Bacteria 4074
61 Ga0075434_100080464 3300006871 Bacteria 3255
62 Ga0075434_100085011 3300006871 Bacteria 3163
63 Ga0075434_100150041 3300006871 Unclassified 2351
64 Ga0075434_100424883 3300006871 Bacteria 1350
65 Ga0075429_100063341 3300006880 Bacteria 3222
66 Ga0075429_100272463 3300006880 Bacteria 1482
67 Ga0075429_101083209 3300006880 Bacteria 700
68 Ga0075436_100010377 3300006914 Bacteria 6383
69 Ga0075436_100136386 3300006914 Bacteria 1723
70 Ga0075436_100297127 3300006914 Bacteria 1157
71 Ga0075436_100298016 3300006914 Bacteria 1155
72 Ga0075436_100335961 3300006914 Bacteria 1087
73 Ga0075435_100082447 3300007076 Bacteria 2644
74 Ga0075435_100119547 3300007076 Bacteria 2198
75 Ga0075435_100145429 3300007076 Bacteria 1991
76 Ga0075435_100184936 3300007076 Bacteria 1762
77 Ga0075435_100317033 3300007076 Bacteria 1334
78 Ga0075435_100372858 3300007076 Bacteria 1225
79 Ga0111539_10047808 3300009094 Bacteria 5113
80 Ga0111539_10206423 3300009094 Bacteria 2290
81 Ga0111539_10224959 3300009094 Bacteria 2185
82 Ga0111539_10782795 3300009094 Bacteria 1110
83 Ga0105245_11267371 3300009098 Bacteria 786
84 Ga0114129_10058803 3300009147 Bacteria 5377
85 Ga0114129_10114571 3300009147 Bacteria 3717
86 Ga0114129_10133847 3300009147 Bacteria 3403
87 Ga0114129_10224060 3300009147 Bacteria 2535
88 Ga0114129_10306641 3300009147 Bacteria 2115
89 Ga0114129_10813821 3300009147 Bacteria 1191
90 Ga0114129_10875086 3300009147 Bacteria 1140
91 Ga0105241_10333862 3300009174 Unclassified 1311
92 Ga0105239_10292991 3300010375 Unclassified 1832
93 Ga0105246_10007835 3300011119 Bacteria 6553
94 Ga0157374_10132391 3300013296 Bacteria 2414
95 Ga0157378_10348000 3300013297 Bacteria 1447
96 Ga0163162_10166222 3300013306 Bacteria 2330
97 Ga0163162_10972804 3300013306 Bacteria 959
98 Ga0157379_10359346 3300014968 Bacteria 1334
99 Ga0157379_11126560 3300014968 Bacteria 752
100 Ga0157376_10225629 3300014969 Bacteria 1738
101 Ga0213875_10001159 3300021388 Bacteria 18080
102 Ga0213875_10004117 3300021388 Bacteria 8062
103 Ga0213875_10006296 3300021388 Bacteria 6246
104 Ga0207697_10292546 3300025315 Bacteria 722
105 Ga0207653_10188541 3300025885 Bacteria 774
106 Ga0207680_10259337 3300025903 Unclassified 1203
107 Ga0207645_10021137 3300025907 Bacteria 4248
108 Ga0207684_11027670 3300025910 Bacteria 688
109 Ga0207707_10012577 3300025912 Bacteria 7355
110 Ga0207707_10049615 3300025912 Bacteria 3657
111 Ga0207707_10073715 3300025912 Bacteria 2977
112 Ga0207707_10112540 3300025912 Unclassified 2380
113 Ga0207707_10221584 3300025912 Bacteria 1646
114 Ga0207693_10093698 3300025915 Bacteria 2354
115 Ga0207657_10081430 3300025919 Unclassified 2719
116 Ga0207657_10177385 3300025919 Bacteria 1724
117 Ga0207652_10413441 3300025921 Bacteria 1217
118 Ga0207681_10031714 3300025923 Bacteria 3453
119 Ga0207650_10009960 3300025925 Bacteria 6505
120 Ga0207659_10306842 3300025926 Unclassified 1305
121 Ga0207659_10644824 3300025926 Bacteria 905
122 Ga0207644_10225172 3300025931 Bacteria 1488
123 Ga0207690_10119508 3300025932 Bacteria 1912
124 Ga0207690_10136988 3300025932 Unclassified 1798
125 Ga0207706_10003666 3300025933 Bacteria 14663
126 Ga0207704_10364528 3300025938 Bacteria 1129
127 Ga0207691_10427834 3300025940 Bacteria 1128
128 Ga0207679_10082202 3300025945 Unclassified 2465
129 Ga0207679_10579477 3300025945 Bacteria 1009
130 Ga0207667_10266604 3300025949 Bacteria 1751
131 Ga0207651_10027836 3300025960 Unclassified 3557
132 Ga0207668_10589857 3300025972 Bacteria 967
133 Ga0207668_10591993 3300025972 Bacteria 965
134 Ga0207640_10027750 3300025981 Bacteria 3453
135 Ga0207658_10204064 3300025986 Bacteria 1652
136 Ga0207674_10241339 3300026116 Bacteria 1754
137 Ga0207683_10004511 3300026121 Bacteria 12015
138 Ga0209967_1001263 3300027364 Bacteria 3237
139 Ga0209970_1040210 3300027614 Bacteria 830
140 Ga0210002_1003169 3300027617 Bacteria 2416
141 Ga0209966_1001406 3300027695 Bacteria 4200
142 Ga0209974_10004353 3300027876 Bacteria 5034
143 Ga0207428_10247049 3300027907 Bacteria 1332
144 Ga0207428_10251421 3300027907 Bacteria 1318
145 Ga0307405_10390692 3300031731 Bacteria 1086
146 Ga0307410_10022162 3300031852 Bacteria 3921
147 Ga0307415_100940220 3300032126 Bacteria 799
148 Ga0373945_0224257 3300035116 Bacteria 787
149 Ga0373931_0203318 3300035691 Bacteria 1184
150 Ga0373927_0083164 3300035695 Bacteria 2075
151 Ga0373947_0031520 3300035725 Bacteria 3121
152 Ga0373937_0068812 3300036401 Bacteria 3264
153 Ga0373937_0837559 3300036401 Bacteria 868
154 Ga0436364_0062844 3300037853 Bacteria 42162
155 Ga0436364_0328145 3300037853 Bacteria 88179
156 Ga0436364_0955632 3300037853 Bacteria 12912
157 Ga0453683_0000171 3300044673 Bacteria 89761
158 Ga0453683_0588100 3300044673 Bacteria 725
159 Ga0453684_0244984 3300044712 Bacteria 2062
160 Ga0451576_0631768 3300045051 Bacteria 1125
161 Ga0451576_0963464 3300045051 Bacteria 894
162 Ga0496102_0107543 3300048905 Bacteria 2597
163 Ga0496103_0309668 3300048906 Bacteria 1016
164 Ga0496104_0797690 3300048907 Bacteria 850
165 Ga0496109_0232621 3300048912 Bacteria 1734
166 Ga0496111_0139232 3300048914 Bacteria 1798
167 Ga0496112_0025398 3300048915 Bacteria 5688
168 Ga0501031_0011520 3300049568 Bacteria 5764
169 Ga0501033_0008509 3300049570 Bacteria 7939
170 Ga0501036_0026975 3300049572 Bacteria 4854
171 Ga0501036_0501750 3300049572 Bacteria 1010
172 Ga0501037_0011180 3300049573 Bacteria 6605
173 Ga0501037_0512599 3300049573 Bacteria 813
174 Ga0501038_0013046 3300049574 Bacteria 7579
175 Ga0501038_0019748 3300049574 Bacteria 6065
176 Ga0501039_0111214 3300049575 Bacteria 2141
177 Ga0501040_0005544 3300049576 Bacteria 8171
178 Ga0501040_0013193 3300049576 Bacteria 5434
179 Ga0501040_0269281 3300049576 Bacteria 1216
180 Ga0501041_0005576 3300049577 Bacteria 7359
181 Ga0501041_0007319 3300049577 Bacteria 6477
182 Ga0501041_0048133 3300049577 Bacteria 2596
183 Ga0501042_0005759 3300049578 Bacteria 8006
184 Ga0501042_0047689 3300049578 Bacteria 3054
185 Ga0501043_0147973 3300049579 Bacteria 1838
186 Ga0501046_0053431 3300049580 Bacteria 3182
187 Ga0501046_0238565 3300049580 Bacteria 1341
188 Ga0501047_0123303 3300049581 Bacteria 2472
189 Ga0501048_0019547 3300049582 Bacteria 4967
190 Ga0501048_0047203 3300049582 Bacteria 3072
191 Ga0501048_0184004 3300049582 Bacteria 1481
192 Ga0501068_0006580 3300049584 Bacteria 6410
193 Ga0501068_0007845 3300049584 Bacteria 5914
194 Ga0501068_0019820 3300049584 Bacteria 3911
195 Ga0501069_0057097 3300049585 Bacteria 2175
196 Ga0501070_0029756 3300049586 Bacteria 4577
197 Ga0501071_0001526 3300049587 Bacteria 13491
198 Ga0501071_0023363 3300049587 Bacteria 4317
199 Ga0501072_0000229 3300049588 Bacteria 41350
200 Ga0501072_0073564 3300049588 Bacteria 2701
201 Ga0501072_0926739 3300049588 Bacteria 680
202 Ga0501073_0006113 3300049589 Bacteria 8985
203 Ga0501074_0036550 3300049590 Bacteria 3557
204 Ga0501074_0297486 3300049590 Bacteria 1146
205 Ga0501075_0006862 3300049591 Bacteria 7862
206 Ga0501075_0072510 3300049591 Bacteria 2603
207 Ga0501075_0100087 3300049591 Bacteria 2201
208 Ga0501075_0514585 3300049591 Bacteria 913
209 Ga0501076_0006534 3300049592 Bacteria 8459
210 Ga0501076_0011636 3300049592 Bacteria 6563
211 Ga0501076_0193332 3300049592 Bacteria 1661
212 Ga0501077_0000318 3300049593 Bacteria 28785
213 Ga0501077_0001866 3300049593 Bacteria 12740
214 Ga0501077_0002432 3300049593 Bacteria 11158
215 Ga0501077_0053943 3300049593 Bacteria 2553
216 Ga0501077_0254052 3300049593 Bacteria 1118
217 Ga0501077_0405192 3300049593 Bacteria 872
218 Ga0501079_0000959 3300049741 Bacteria 19899
219 Ga0501079_0009459 3300049741 Bacteria 7389
220 Ga0501079_0023574 3300049741 Bacteria 4722
221 Ga0501080_0017721 3300049742 Bacteria 6590
222 Ga0501080_0019441 3300049742 Bacteria 6292
223 Ga0501081_0000956 3300049743 Bacteria 17189
224 Ga0501081_0029525 3300049743 Bacteria 3705
225 Ga0501083_0043245 3300049744 Bacteria 3052
226 Ga0501035_0022543 3300049822 Bacteria 5784
227 Ga0501035_0124478 3300049822 Bacteria 2251
228 Ga0501045_0010151 3300049824 Bacteria 6590
229 Ga0501045_0036382 3300049824 Bacteria 3574
230 nmdc:mga05p37_3536_c1 3300050507 Bacteria 18231
231 nmdc:mga05p37_43051_c1 3300050507 Bacteria 5552
232 nmdc:mga05p37_43637_c1 3300050507 Bacteria 5517
233 nmdc:mga05p37_650626_c1 3300050507 Bacteria 1180
234 nmdc:mga05p37_801287_c1 3300050507 Bacteria 1031
235 nmdc:mga09592_101714_c1 3300050508 Bacteria 2462
236 nmdc:mga09592_71102_c1 3300050508 Bacteria 2953
237 nmdc:mga0qj67_167261_c1 3300050509 Bacteria 1785
238 nmdc:mga06r32_17390_c1 3300050510 Bacteria 6562
239 nmdc:mga06r32_363617_c1 3300050510 Unclassified 1430
240 nmdc:mga06r32_44342_c1 3300050510 Bacteria 4235
241 nmdc:mga06r32_733870_c1 3300050510 Unclassified 952
242 nmdc:mga08y16_32695_c1 3300050511 Bacteria 5468
243 nmdc:mga08y16_501661_c1 3300050511 Bacteria 1233
244 nmdc:mga0n895_201165_c1 3300050512 Bacteria 2023
245 nmdc:mga0n895_219550_c1 3300050512 Bacteria 1930
246 nmdc:mga0n895_405550_c1 3300050512 Bacteria 1379
247 nmdc:mga0n895_417109_c1 3300050512 Bacteria 1357
248 nmdc:mga0n895_51877_c1 3300050512 Bacteria 4025
249 nmdc:mga0n895_5403_c1 3300050512 Bacteria 10667
250 nmdc:mga0n895_6018_c1 3300050512 Bacteria 10222
251 nmdc:mga0n895_73303_c1 3300050512 Bacteria 3399
252 nmdc:mga0n895_96332_c1 3300050512 Bacteria 2964
253 nmdc:mga0rr50_100303_c1 3300050513 Bacteria 2274
254 nmdc:mga0rr50_183859_c1 3300050513 Bacteria 1710
255 nmdc:mga0rr50_42722_c1 3300050513 Bacteria 3312
256 nmdc:mga0rr50_644951_c1 3300050513 Bacteria 903
257 nmdc:mga0rr50_65728_c1 3300050513 Bacteria 2748
258 nmdc:mga0rr50_89805_c1 3300050513 Bacteria 2389
259 nmdc:mga08x19_267485_c1 3300050514 Bacteria 1183
260 nmdc:mga08x19_273500_c1 3300050514 Bacteria 1169
261 nmdc:mga08x19_41373_c1 3300050514 Bacteria 2934
262 nmdc:mga08x19_482711_c1 3300050514 Unclassified 874
263 nmdc:mga08x19_5965_c2 3300050514 Bacteria 6458
264 nmdc:mga08x19_654479_c1 3300050514 Bacteria 745
265 nmdc:mga08x19_76051_c1 3300050514 Bacteria 2196
266 nmdc:mga0a205_142479_c1 3300050515 Bacteria 2297
267 nmdc:mga0a205_164018_c1 3300050515 Bacteria 2118
268 nmdc:mga0a205_203981_c1 3300050515 Bacteria 1867
269 nmdc:mga0a205_3858_c1 3300050515 Bacteria 13428
270 nmdc:mga0a205_400287_c1 3300050515 Bacteria 1237
271 nmdc:mga0a205_518_c1 3300050515 Bacteria 30296
272 Ga0501084_0047718 3300054114 Bacteria 3586
273 Ga0501084_0167833 3300054114 Bacteria 1852
274 Ga0590075_053470 3300059424 Bacteria 1037
275 Ga0501082_0006833 3300060353 Bacteria 9863
276 Ga0501082_0009054 3300060353 Bacteria 8587
277 Ga0501082_0114556 3300060353 Bacteria 2334
278 Ga0530510_0004720 3300061734 Bacteria 9426
279 Ga0530510_0153863 3300061734 Bacteria 1699
280 Ga0070681_10017007
281 Ga0065715_10009291
282 Ga0065715_10016319
283 Ga0065707_10089357
284 Ga0065707_10364908
285 Ga0070670_100001395
286 Ga0070666_10084005
287 Ga0070660_100200079
288 Ga0070660_100401853
289 Ga0070660_101305328
290 Ga0070661_100676215
291 Ga0070661_100689574
292 Ga0070692_10337134
293 Ga0070668_100207626
294 Ga0070669_100089024
295 Ga0070675_100080660
296 Ga0070671_100120265
297 Ga0070674_100149488
298 Ga0070674_100289325
299 Ga0070673_100329978
300 Ga0070659_100023959
301 Ga0070659_100197399
302 Ga0070667_100044260
303 Ga0070711_100619439
304 Ga0070705_100228108
305 Ga0070705_100551355
306 Ga0070694_100167210
307 Ga0070708_100039885
308 Ga0070678_100047206
309 Ga0070662_100077956
310 Ga0070681_10021534
311 Ga0070681_10080349
312 Ga0070681_10163472
313 Ga0068867_101062790
314 Ga0070706_100613021
315 Ga0070698_100319959
316 Ga0070679_100150350
317 Ga0070679_100511934
318 Ga0070672_100394037
319 Ga0070696_100087052
320 Ga0070696_100160746
321 Ga0068855_100077632
322 Ga0068856_100292183
323 Ga0068861_100537568
324 Ga0081455_10005233
325 Ga0081455_10213820
326 Ga0081538_10018587
327 Ga0070712_100085686
328 Ga0075428_100027142
329 Ga0075428_100043372
330 Ga0075430_100077679
331 Ga0075431_100210102
332 Ga0075431_100583533
333 Ga0075433_10003729
334 Ga0075433_10051080
335 Ga0075433_10162577
336 Ga0075434_100010476
337 Ga0075434_100022274
338 Ga0075434_100023069
339 Ga0075434_100051917
340 Ga0075434_100080464
341 Ga0075434_100085011
342 Ga0075434_100150041
343 Ga0075434_100424883
344 Ga0075429_100063341
345 Ga0075429_100272463
346 Ga0075429_101083209
347 Ga0075436_100010377
348 Ga0075436_100136386
349 Ga0075436_100297127
350 Ga0075436_100298016
351 Ga0075436_100335961
352 Ga0075435_100082447
353 Ga0075435_100119547
354 Ga0075435_100145429
355 Ga0075435_100184936
356 Ga0075435_100317033
357 Ga0075435_100372858
358 Ga0111539_10047808
359 Ga0111539_10206423
360 Ga0111539_10224959
361 Ga0111539_10782795
362 Ga0105245_11267371
363 Ga0114129_10058803
364 Ga0114129_10114571
365 Ga0114129_10133847
366 Ga0114129_10224060
367 Ga0114129_10306641
368 Ga0114129_10813821
369 Ga0114129_10875086
370 Ga0105241_10333862
371 Ga0105239_10292991
372 Ga0105246_10007835
373 Ga0157374_10132391
374 Ga0157378_10348000
375 Ga0163162_10166222
376 Ga0163162_10972804
377 Ga0157379_10359346
378 Ga0157379_11126560
379 Ga0157376_10225629
380 Ga0213875_10001159
381 Ga0213875_10004117
382 Ga0213875_10006296
383 Ga0207697_10292546
384 Ga0207653_10188541
385 Ga0207680_10259337
386 Ga0207645_10021137
387 Ga0207684_11027670
388 Ga0207707_10012577
389 Ga0207707_10049615
390 Ga0207707_10073715
391 Ga0207707_10112540
392 Ga0207707_10221584
393 Ga0207693_10093698
394 Ga0207657_10081430
395 Ga0207657_10177385
396 Ga0207652_10413441
397 Ga0207681_10031714
398 Ga0207650_10009960
399 Ga0207659_10306842
400 Ga0207659_10644824
401 Ga0207644_10225172
402 Ga0207690_10119508
403 Ga0207690_10136988
404 Ga0207706_10003666
405 Ga0207704_10364528
406 Ga0207691_10427834
407 Ga0207679_10082202
408 Ga0207679_10579477
409 Ga0207667_10266604
410 Ga0207651_10027836
411 Ga0207668_10589857
412 Ga0207668_10591993
413 Ga0207640_10027750
414 Ga0207658_10204064
415 Ga0207674_10241339
416 Ga0207683_10004511
417 Ga0209967_1001263
418 Ga0209970_1040210
419 Ga0210002_1003169
420 Ga0209966_1001406
421 Ga0209974_10004353
422 Ga0207428_10247049
423 Ga0207428_10251421
424 Ga0307405_10390692
425 Ga0307410_10022162
426 Ga0307415_100940220
427 Ga0373945_0224257
428 Ga0373931_0203318
429 Ga0373927_0083164
430 Ga0373947_0031520
431 Ga0373937_0068812
432 Ga0373937_0837559
433 Ga0436364_0062844
434 Ga0436364_0328145
435 Ga0436364_0955632
436 Ga0453683_0000171
437 Ga0453683_0588100
438 Ga0453684_0244984
439 Ga0451576_0631768
440 Ga0451576_0963464
441 Ga0496102_0107543
442 Ga0496103_0309668
443 Ga0496104_0797690
444 Ga0496109_0232621
445 Ga0496111_0139232
446 Ga0496112_0025398
447 Ga0501031_0011520
448 Ga0501033_0008509
449 Ga0501036_0026975
450 Ga0501036_0501750
451 Ga0501037_0011180
452 Ga0501037_0512599
453 Ga0501038_0013046
454 Ga0501038_0019748
455 Ga0501039_0111214
456 Ga0501040_0005544
457 Ga0501040_0013193
458 Ga0501040_0269281
459 Ga0501041_0005576
460 Ga0501041_0007319
461 Ga0501041_0048133
462 Ga0501042_0005759
463 Ga0501042_0047689
464 Ga0501043_0147973
465 Ga0501046_0053431
466 Ga0501046_0238565
467 Ga0501047_0123303
468 Ga0501048_0019547
469 Ga0501048_0047203
470 Ga0501048_0184004
471 Ga0501068_0006580
472 Ga0501068_0007845
473 Ga0501068_0019820
474 Ga0501069_0057097
475 Ga0501070_0029756
476 Ga0501071_0001526
477 Ga0501071_0023363
478 Ga0501072_0000229
479 Ga0501072_0073564
480 Ga0501072_0926739
481 Ga0501073_0006113
482 Ga0501074_0036550
483 Ga0501074_0297486
484 Ga0501075_0006862
485 Ga0501075_0072510
486 Ga0501075_0100087
487 Ga0501075_0514585
488 Ga0501076_0006534
489 Ga0501076_0011636
490 Ga0501076_0193332
491 Ga0501077_0000318
492 Ga0501077_0001866
493 Ga0501077_0002432
494 Ga0501077_0053943
495 Ga0501077_0254052
496 Ga0501077_0405192
497 Ga0501079_0000959
498 Ga0501079_0009459
499 Ga0501079_0023574
500 Ga0501080_0017721
501 Ga0501080_0019441
502 Ga0501081_0000956
503 Ga0501081_0029525
504 Ga0501083_0043245
505 Ga0501035_0022543
506 Ga0501035_0124478
507 Ga0501045_0010151
508 Ga0501045_0036382
509 nmdc:mga05p37_3536_c1
510 nmdc:mga05p37_43051_c1
511 nmdc:mga05p37_43637_c1
512 nmdc:mga05p37_650626_c1
513 nmdc:mga05p37_801287_c1
514 nmdc:mga09592_101714_c1
515 nmdc:mga09592_71102_c1
516 nmdc:mga0qj67_167261_c1
517 nmdc:mga06r32_17390_c1
518 nmdc:mga06r32_363617_c1
519 nmdc:mga06r32_44342_c1
520 nmdc:mga06r32_733870_c1
521 nmdc:mga08y16_32695_c1
522 nmdc:mga08y16_501661_c1
523 nmdc:mga0n895_201165_c1
524 nmdc:mga0n895_219550_c1
525 nmdc:mga0n895_405550_c1
526 nmdc:mga0n895_417109_c1
527 nmdc:mga0n895_51877_c1
528 nmdc:mga0n895_5403_c1
529 nmdc:mga0n895_6018_c1
530 nmdc:mga0n895_73303_c1
531 nmdc:mga0n895_96332_c1
532 nmdc:mga0rr50_100303_c1
533 nmdc:mga0rr50_183859_c1
534 nmdc:mga0rr50_42722_c1
535 nmdc:mga0rr50_644951_c1
536 nmdc:mga0rr50_65728_c1
537 nmdc:mga0rr50_89805_c1
538 nmdc:mga08x19_267485_c1
539 nmdc:mga08x19_273500_c1
540 nmdc:mga08x19_41373_c1
541 nmdc:mga08x19_482711_c1
542 nmdc:mga08x19_5965_c2
543 nmdc:mga08x19_654479_c1
544 nmdc:mga08x19_76051_c1
545 nmdc:mga0a205_142479_c1
546 nmdc:mga0a205_164018_c1
547 nmdc:mga0a205_203981_c1
548 nmdc:mga0a205_3858_c1
549 nmdc:mga0a205_400287_c1
550 nmdc:mga0a205_518_c1
551 Ga0501084_0047718
552 Ga0501084_0167833
553 Ga0590075_053470
554 Ga0501082_0006833
555 Ga0501082_0009054
556 Ga0501082_0114556
557 Ga0530510_0004720
558 Ga0530510_0153863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

74

0.97

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

10

75

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

103

194

0.91

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

123

195

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

4

80

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

106

198

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9745 2 197
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9648 2 197
3m8n-assembly2.cif.gz_D crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9568 2 197
3m8n-assembly2.cif.gz_D crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9474 2 197
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9469 2 197
ID Description Score Start End Superfamily
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9935 2 73 3.40.30.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9845 2 72 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9841 4 68 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9777 3 75 3.40.30.10
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9717 4 75 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A534UF15-F1-model_v4 Glutathione S-transferase family protein 0.9864 2 102 GO:0016740
AF-A0A0C5EPK8-F1-model_v4 Glutathione S-transferase 0.9797 2 197
AF-A0A7Z6UBN4-F1-model_v4 Maleylacetoacetate isomerase / Glutathione S-transferase 0.9793 2 197 GO:0016740
GO:0016853
AF-M4XF30-F1-model_v4 Glutathione S-transferase 0.9788 2 197 GO:0016740
AF-A0A6L8C3A7-F1-model_v4 Glutathione S-transferase family protein 0.9785 2 195 GO:0016740

Map