F382869

General Info

Members Datasets Scaffolds Average Seq Length
279 201 558 79

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101381296|Ga0070669_1013812962
Length 81
Sequence MAATVTLLYFASLRDTAGLDRETVASEAADLRALYAEVRARHGFVLPQEKLRVAVDGAFARWDAPLGDGSEIAFIPPVSGG

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
49 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
107 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
108 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
109 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
177 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
190 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
195 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
196 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
197 2643221695 Lysobacter sp. Root494 Isolate Unclassified
198 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
199 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
200 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
201 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.53
Nodule 0
Rhizoplane 6.09
Rhizosphere 82.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_101381296 3300005353 Bacteria 611
2 Ga0055526_1065423 3300003771 Bacteria 757
3 Ga0055524_1011066 3300003775 Bacteria 3548
4 Ga0055524_1014164 3300003775 Bacteria 2970
5 Ga0055531_10097881 3300003794 Bacteria 608
6 Ga0065714_10091994 3300005288 Bacteria 1883
7 Ga0070680_100235574 3300005336 Bacteria 1546
8 Ga0070680_100698855 3300005336 Bacteria 872
9 Ga0070660_101292570 3300005339 Bacteria 619
10 Ga0070691_10199644 3300005341 Bacteria 1050
11 Ga0070692_10771415 3300005345 Bacteria 654
12 Ga0070668_100188470 3300005347 Bacteria 1688
13 Ga0070675_100295745 3300005354 Bacteria 1425
14 Ga0070659_100277880 3300005366 Bacteria 1393
15 Ga0070667_100290116 3300005367 Bacteria 1471
16 Ga0070714_100027856 3300005435 Bacteria 4682
17 Ga0070711_100537850 3300005439 Bacteria 968
18 Ga0070678_100445127 3300005456 Bacteria 1134
19 Ga0070681_10000007 3300005458 Bacteria 159821
20 Ga0070681_10095162 3300005458 Bacteria 2927
21 Ga0070681_10569447 3300005458 Bacteria 1046
22 Ga0068867_100248422 3300005459 Bacteria 1446
23 Ga0068867_100510584 3300005459 Bacteria 1035
24 Ga0070679_100915459 3300005530 Bacteria 820
25 Ga0068853_100006385 3300005539 Bacteria 9364
26 Ga0070672_100004380 3300005543 Bacteria 9246
27 Ga0070672_100010568 3300005543 Bacteria 6408
28 Ga0070696_100112148 3300005546 Bacteria 1965
29 Ga0070693_100007564 3300005547 Bacteria 5316
30 Ga0070693_100308020 3300005547 Bacteria 1070
31 Ga0070693_101194275 3300005547 Bacteria 584
32 Ga0070665_100309634 3300005548 Bacteria 1583
33 Ga0068855_100077870 3300005563 Bacteria 3847
34 Ga0068855_100702714 3300005563 Bacteria 1082
35 Ga0068855_101810135 3300005563 Bacteria 620
36 Ga0068857_100091286 3300005577 Bacteria 2726
37 Ga0068854_101763927 3300005578 Bacteria 567
38 Ga0070702_100998986 3300005615 Bacteria 662
39 Ga0068852_100120763 3300005616 Bacteria 2399
40 Ga0068852_102014267 3300005616 Bacteria 599
41 Ga0068859_100076536 3300005617 Bacteria 3387
42 Ga0068859_101452708 3300005617 Bacteria 757
43 Ga0068861_101087207 3300005719 Bacteria 768
44 Ga0068863_100503415 3300005841 Bacteria 1193
45 Ga0068860_100009878 3300005843 Bacteria 9461
46 Ga0068862_101632388 3300005844 Bacteria 652
47 Ga0081455_10259029 3300005937 Bacteria 1268
48 Ga0075364_10057092 3300006051 Bacteria 2556
49 Ga0075364_10060407 3300006051 Bacteria 2486
50 Ga0075364_10350399 3300006051 Bacteria 1006
51 Ga0068871_100115700 3300006358 Bacteria 2260
52 Ga0068865_100001867 3300006881 Bacteria 12378
53 Ga0097620_100076536 3300006931 Bacteria 3387
54 Ga0097620_101452632 3300006931 Bacteria 757
55 Ga0105240_10007745 3300009093 Bacteria 15536
56 Ga0105240_10095359 3300009093 Bacteria 3627
57 Ga0105240_11352357 3300009093 Bacteria 750
58 Ga0105240_12555636 3300009093 Bacteria 528
59 Ga0105245_10762446 3300009098 Bacteria 1004
60 Ga0105245_12512095 3300009098 Bacteria 568
61 Ga0105241_10060823 3300009174 Bacteria 2907
62 Ga0105242_10001918 3300009176 Bacteria 16343
63 Ga0105237_10016858 3300009545 Bacteria 7580
64 Ga0105237_12496965 3300009545 Bacteria 527
65 Ga0105238_10015784 3300009551 Bacteria 7645
66 Ga0105238_10019466 3300009551 Bacteria 6912
67 Ga0105249_10071549 3300009553 Bacteria 3204
68 Ga0105239_10044931 3300010375 Bacteria 4842
69 Ga0105239_10111889 3300010375 Bacteria 3027
70 Ga0105239_12039930 3300010375 Bacteria 666
71 Ga0157327_1008046 3300012512 Bacteria 935
72 Ga0157326_1052637 3300012513 Bacteria 602
73 Ga0157373_10188820 3300013100 Bacteria 1452
74 Ga0157373_11564704 3300013100 Bacteria 504
75 Ga0157371_11363739 3300013102 Bacteria 550
76 Ga0157370_10064917 3300013104 Bacteria 3454
77 Ga0157370_10352429 3300013104 Bacteria 1357
78 Ga0157370_10780219 3300013104 Bacteria 870
79 Ga0157369_10000195 3300013105 Bacteria 84688
80 Ga0157374_10039767 3300013296 Bacteria 4329
81 Ga0157374_10121405 3300013296 Bacteria 2522
82 Ga0157378_10051445 3300013297 Bacteria 3666
83 Ga0163162_10001959 3300013306 Bacteria 19333
84 Ga0157372_10312351 3300013307 Bacteria 1830
85 Ga0157372_11124253 3300013307 Bacteria 909
86 Ga0157375_10000156 3300013308 Bacteria 66009
87 Ga0157375_10031195 3300013308 Bacteria 5033
88 Ga0157375_10609213 3300013308 Bacteria 1251
89 Ga0157375_11687487 3300013308 Bacteria 750
90 Ga0157380_10305645 3300014326 Bacteria 1467
91 Ga0157380_10763895 3300014326 Bacteria 980
92 Ga0182008_10600726 3300014497 Bacteria 617
93 Ga0157376_10005014 3300014969 Bacteria 9237
94 Ga0157376_10058312 3300014969 Bacteria 3233
95 Ga0157376_10064239 3300014969 Bacteria 3095
96 Ga0209673_1041574 3300025273 Bacteria 1303
97 Ga0209675_1010033 3300025291 Bacteria 3276
98 Ga0209676_1045786 3300025292 Bacteria 1188
99 Ga0209025_1032876 3300025294 Bacteria 2413
100 Ga0209564_1007666 3300025295 Bacteria 5512
101 Ga0209256_1004843 3300025299 Bacteria 8141
102 Ga0207426_1046584 3300025302 Bacteria 1312
103 Ga0209257_1002276 3300025304 Bacteria 19574
104 Ga0207699_10847374 3300025906 Bacteria 673
105 Ga0207645_10187858 3300025907 Bacteria 1357
106 Ga0207654_10228084 3300025911 Bacteria 1239
107 Ga0207707_10011211 3300025912 Bacteria 7798
108 Ga0207707_10481401 3300025912 Bacteria 1060
109 Ga0207707_10640949 3300025912 Bacteria 896
110 Ga0207695_10001746 3300025913 Bacteria 34535
111 Ga0207695_10043274 3300025913 Bacteria 4800
112 Ga0207671_10630873 3300025914 Bacteria 854
113 Ga0207657_10816787 3300025919 Bacteria 720
114 Ga0207652_11210125 3300025921 Bacteria 657
115 Ga0207694_10000627 3300025924 Bacteria 32068
116 Ga0207694_10048426 3300025924 Bacteria 3289
117 Ga0207650_10770804 3300025925 Bacteria 814
118 Ga0207687_11548880 3300025927 Bacteria 569
119 Ga0207664_10185856 3300025929 Bacteria 1787
120 Ga0207644_10012209 3300025931 Bacteria 5700
121 Ga0207686_10023038 3300025934 Bacteria 3592
122 Ga0207691_10004868 3300025940 Bacteria 12984
123 Ga0207689_10047934 3300025942 Bacteria 3525
124 Ga0207667_10117069 3300025949 Bacteria 2746
125 Ga0207651_10112936 3300025960 Bacteria 2043
126 Ga0207712_10221584 3300025961 Bacteria 1513
127 Ga0207668_10038100 3300025972 Bacteria 3223
128 Ga0207640_10847650 3300025981 Bacteria 795
129 Ga0207639_10008534 3300026041 Bacteria 7031
130 Ga0207678_10690227 3300026067 Bacteria 898
131 Ga0207641_10310344 3300026088 Bacteria 1493
132 Ga0207641_12002961 3300026088 Bacteria 580
133 Ga0207648_10212788 3300026089 Bacteria 1716
134 Ga0207648_10382181 3300026089 Bacteria 1273
135 Ga0207674_10513434 3300026116 Bacteria 1157
136 Ga0207674_11013202 3300026116 Bacteria 800
137 Ga0207698_10021084 3300026142 Bacteria 4499
138 Ga0207698_12127480 3300026142 Bacteria 574
139 Ga0207698_12323798 3300026142 Bacteria 548
140 Ga0209967_1018348 3300027364 Bacteria 1013
141 Ga0209995_1006661 3300027471 Bacteria 1857
142 Ga0209999_1000714 3300027543 Bacteria 5385
143 Ga0209970_1006785 3300027614 Bacteria 1880
144 Ga0209983_1000296 3300027665 Bacteria 10384
145 Ga0209971_1013235 3300027682 Bacteria 1955
146 Ga0209974_10008039 3300027876 Bacteria 3614
147 Ga0268266_10060519 3300028379 Bacteria 3265
148 Ga0268266_10338979 3300028379 Bacteria 1411
149 Ga0268264_10005234 3300028381 Bacteria 10980
150 Ga0316177_1191026 3300030731 Bacteria 2923
151 Ga0314311_1031529 3300030733 Bacteria 1168
152 Ga0316178_1182566 3300030735 Bacteria 744
153 Ga0316180_1150849 3300030736 Bacteria 760
154 Ga0316181_1286399 3300030744 Bacteria 1562
155 Ga0307513_10015796 3300031456 Bacteria 9137
156 Ga0307408_100288800 3300031548 Bacteria 1369
157 Ga0307516_10047197 3300031730 Bacteria 4245
158 Ga0307516_10978244 3300031730 Bacteria 517
159 Ga0307405_11160375 3300031731 Bacteria 666
160 Ga0307413_10022156 3300031824 Bacteria 3418
161 Ga0307413_10438489 3300031824 Bacteria 1033
162 Ga0307412_10748543 3300031911 Bacteria 843
163 Ga0307409_101519682 3300031995 Bacteria 697
164 Ga0307409_101745899 3300031995 Bacteria 651
165 Ga0307416_103621864 3300032002 Bacteria 517
166 Ga0307414_10000300 3300032004 Bacteria 28812
167 Ga0307414_10240869 3300032004 Bacteria 1497
168 Ga0307414_10498646 3300032004 Bacteria 1077
169 Ga0307414_10599577 3300032004 Bacteria 988
170 Ga0307414_11003919 3300032004 Bacteria 768
171 Ga0307415_100561333 3300032126 Bacteria 1009
172 Ga0307415_101456351 3300032126 Bacteria 654
173 Ga0373934_0338898 3300035086 Bacteria 625
174 Ga0373944_0108141 3300035089 Bacteria 946
175 Ga0373936_0299300 3300035113 Bacteria 726
176 Ga0373935_0923989 3300035692 Bacteria 647
177 Ga0373937_0752623 3300036401 Bacteria 922
178 Ga0373925_1208454 3300037068 Bacteria 621
179 Ga0395899_0097343 3300037312 Bacteria 2127
180 Ga0395900_0000175 3300037418 Bacteria 102937
181 Ga0395900_0056989 3300037418 Bacteria 4022
182 Ga0395900_0295913 3300037418 Bacteria 1606
183 Ga0395900_0894211 3300037418 Bacteria 812
184 Ga0395898_0086681 3300037466 Bacteria 3017
185 Ga0395898_0436242 3300037466 Bacteria 1248
186 Ga0395905_0000630 3300037471 Bacteria 47216
187 Ga0395905_0133704 3300037471 Bacteria 2333
188 Ga0395901_0131268 3300038443 Bacteria 2632
189 Ga0395901_0816971 3300038443 Bacteria 920
190 Ga0395901_1681284 3300038443 Bacteria 586
191 Ga0439436_0025738 3300041404 Bacteria 1727
192 Ga0439436_0028700 3300041404 Bacteria 1623
193 Ga0439439_0135389 3300041406 Bacteria 693
194 Ga0439465_0000297 3300041413 Bacteria 14018
195 Ga0451800_0340878 3300041459 Bacteria 596
196 Ga0451800_1617507 3300041459 Bacteria 878
197 Ga0451807_0371901 3300041486 Bacteria 555
198 Ga0451807_0693854 3300041486 Bacteria 1094
199 Ga0451837_0374541 3300041494 Bacteria 981
200 Ga0451837_0990016 3300041494 Bacteria 1015
201 Ga0451837_1098651 3300041494 Bacteria 964
202 Ga0451843_1009909 3300041509 Bacteria 628
203 Ga0439431_0032445 3300041997 Bacteria 1302
204 Ga0439445_0114526 3300042004 Bacteria 771
205 Ga0439445_0115690 3300042004 Bacteria 767
206 Ga0439432_020431 3300042006 Bacteria 2201
207 Ga0439432_043098 3300042006 Bacteria 1425
208 Ga0439432_060999 3300042006 Bacteria 1163
209 Ga0439449_0000045 3300042007 Bacteria 38264
210 Ga0439449_0087864 3300042007 Bacteria 1147
211 Ga0439449_0136835 3300042007 Bacteria 911
212 Ga0450909_068498 3300042185 Bacteria 566
213 Ga0451577_0044594 3300042876 Bacteria 3970
214 Ga0453683_0124980 3300044673 Bacteria 1620
215 Ga0453684_0385725 3300044712 Bacteria 1572
216 Ga0466957_0337028 3300044842 Bacteria 1021
217 Ga0466967_1166120 3300045976 Bacteria 768
218 Ga0495638_0202337 3300046460 Bacteria 1120
219 Ga0495580_0778901 3300046472 Bacteria 621
220 Ga0495582_0105451 3300046473 Bacteria 1580
221 Ga0495639_0129997 3300046475 Bacteria 1205
222 Ga0495662_0197428 3300046476 Bacteria 992
223 Ga0495664_0299904 3300046477 Bacteria 970
224 Ga0495643_0377531 3300046522 Bacteria 629
225 Ga0495652_0532772 3300046529 Bacteria 810
226 Ga0495654_0158372 3300046530 Bacteria 996
227 Ga0495645_0473111 3300046543 Bacteria 787
228 Ga0495656_0000843 3300046615 Bacteria 9891
229 Ga0495647_0032619 3300046681 Bacteria 1942
230 Ga0495658_0028701 3300046683 Bacteria 3005
231 Ga0495613_0460975 3300046689 Bacteria 860
232 Ga0495636_0003708 3300047318 Bacteria 5942
233 Ga0496100_0187620 3300048903 Bacteria 1499
234 Ga0496100_1035426 3300048903 Bacteria 646
235 Ga0496101_1310068 3300048904 Bacteria 566
236 Ga0496103_0079268 3300048906 Bacteria 2063
237 Ga0496104_0000011 3300048907 Bacteria 459358
238 Ga0496105_0000015 3300048908 Bacteria 218758
239 Ga0496105_0618869 3300048908 Bacteria 839
240 Ga0496108_0013046 3300048911 Bacteria 6772
241 Ga0496109_0554441 3300048912 Bacteria 1084
242 Ga0496109_0611698 3300048912 Bacteria 1026
243 Ga0496112_0049966 3300048915 Bacteria 4099
244 Ga0496113_0015849 3300048916 Bacteria 5194
245 Ga0496115_0000065 3300048918 Bacteria 98148
246 Ga0496118_0027212 3300048921 Bacteria 4846
247 Ga0496126_0000185 3300048929 Bacteria 140051
248 Ga0501290_000954 3300049513 Bacteria 4184
249 Ga0501300_020371 3300049523 Bacteria 968
250 Ga0501031_0066151 3300049568 Bacteria 2355
251 Ga0501032_0047295 3300049569 Bacteria 2905
252 Ga0501032_0085984 3300049569 Bacteria 2090
253 Ga0501033_0250148 3300049570 Bacteria 1256
254 Ga0501034_0517432 3300049571 Bacteria 1105
255 Ga0501036_1346133 3300049572 Bacteria 580
256 Ga0501037_0309975 3300049573 Bacteria 1094
257 Ga0501039_0059402 3300049575 Bacteria 2962
258 Ga0501043_0001953 3300049579 Bacteria 17638
259 Ga0501043_0032273 3300049579 Bacteria 4117
260 Ga0501047_0230843 3300049581 Bacteria 1704
261 Ga0501070_0408149 3300049586 Bacteria 1098
262 Ga0501070_1113888 3300049586 Bacteria 608
263 Ga0501225_0003691 3300049705 Bacteria 4608
264 Ga0501265_000288 3300049762 Bacteria 5166
265 Ga0501276_026751 3300049773 Bacteria 583
266 Ga0501035_0078536 3300049822 Bacteria 2915
267 Ga0501044_0100640 3300049823 Bacteria 2908
268 Ga0501044_1331394 3300049823 Bacteria 584
269 nmdc:mga00v17_230224_c1 3300050491 Bacteria 1201
270 nmdc:mga00v17_248665_c1 3300050491 Bacteria 1153
271 nmdc:mga00v17_484369_c1 3300050491 Bacteria 802
272 Ga0500597_279175 3300053120 Bacteria 674
273 Ga0500614_143850 3300053123 Bacteria 715
274 Ga0500637_0407442 3300053178 Bacteria 704
275 2644529919 2643221695 Bacteria 3441323
276 2895502527 2895498888 Bacteria 5283788
277 2895514144 2895511927 Bacteria 6802080
278 2895524377 2895522137 Bacteria 3284416
279 2895526474 2895525241 Bacteria 3388457
280 Ga0070669_101381296
281 Ga0055526_1065423
282 Ga0055524_1011066
283 Ga0055524_1014164
284 Ga0055531_10097881
285 Ga0065714_10091994
286 Ga0070680_100235574
287 Ga0070680_100698855
288 Ga0070660_101292570
289 Ga0070691_10199644
290 Ga0070692_10771415
291 Ga0070668_100188470
292 Ga0070675_100295745
293 Ga0070659_100277880
294 Ga0070667_100290116
295 Ga0070714_100027856
296 Ga0070711_100537850
297 Ga0070678_100445127
298 Ga0070681_10000007
299 Ga0070681_10095162
300 Ga0070681_10569447
301 Ga0068867_100248422
302 Ga0068867_100510584
303 Ga0070679_100915459
304 Ga0068853_100006385
305 Ga0070672_100004380
306 Ga0070672_100010568
307 Ga0070696_100112148
308 Ga0070693_100007564
309 Ga0070693_100308020
310 Ga0070693_101194275
311 Ga0070665_100309634
312 Ga0068855_100077870
313 Ga0068855_100702714
314 Ga0068855_101810135
315 Ga0068857_100091286
316 Ga0068854_101763927
317 Ga0070702_100998986
318 Ga0068852_100120763
319 Ga0068852_102014267
320 Ga0068859_100076536
321 Ga0068859_101452708
322 Ga0068861_101087207
323 Ga0068863_100503415
324 Ga0068860_100009878
325 Ga0068862_101632388
326 Ga0081455_10259029
327 Ga0075364_10057092
328 Ga0075364_10060407
329 Ga0075364_10350399
330 Ga0068871_100115700
331 Ga0068865_100001867
332 Ga0097620_100076536
333 Ga0097620_101452632
334 Ga0105240_10007745
335 Ga0105240_10095359
336 Ga0105240_11352357
337 Ga0105240_12555636
338 Ga0105245_10762446
339 Ga0105245_12512095
340 Ga0105241_10060823
341 Ga0105242_10001918
342 Ga0105237_10016858
343 Ga0105237_12496965
344 Ga0105238_10015784
345 Ga0105238_10019466
346 Ga0105249_10071549
347 Ga0105239_10044931
348 Ga0105239_10111889
349 Ga0105239_12039930
350 Ga0157327_1008046
351 Ga0157326_1052637
352 Ga0157373_10188820
353 Ga0157373_11564704
354 Ga0157371_11363739
355 Ga0157370_10064917
356 Ga0157370_10352429
357 Ga0157370_10780219
358 Ga0157369_10000195
359 Ga0157374_10039767
360 Ga0157374_10121405
361 Ga0157378_10051445
362 Ga0163162_10001959
363 Ga0157372_10312351
364 Ga0157372_11124253
365 Ga0157375_10000156
366 Ga0157375_10031195
367 Ga0157375_10609213
368 Ga0157375_11687487
369 Ga0157380_10305645
370 Ga0157380_10763895
371 Ga0182008_10600726
372 Ga0157376_10005014
373 Ga0157376_10058312
374 Ga0157376_10064239
375 Ga0209673_1041574
376 Ga0209675_1010033
377 Ga0209676_1045786
378 Ga0209025_1032876
379 Ga0209564_1007666
380 Ga0209256_1004843
381 Ga0207426_1046584
382 Ga0209257_1002276
383 Ga0207699_10847374
384 Ga0207645_10187858
385 Ga0207654_10228084
386 Ga0207707_10011211
387 Ga0207707_10481401
388 Ga0207707_10640949
389 Ga0207695_10001746
390 Ga0207695_10043274
391 Ga0207671_10630873
392 Ga0207657_10816787
393 Ga0207652_11210125
394 Ga0207694_10000627
395 Ga0207694_10048426
396 Ga0207650_10770804
397 Ga0207687_11548880
398 Ga0207664_10185856
399 Ga0207644_10012209
400 Ga0207686_10023038
401 Ga0207691_10004868
402 Ga0207689_10047934
403 Ga0207667_10117069
404 Ga0207651_10112936
405 Ga0207712_10221584
406 Ga0207668_10038100
407 Ga0207640_10847650
408 Ga0207639_10008534
409 Ga0207678_10690227
410 Ga0207641_10310344
411 Ga0207641_12002961
412 Ga0207648_10212788
413 Ga0207648_10382181
414 Ga0207674_10513434
415 Ga0207674_11013202
416 Ga0207698_10021084
417 Ga0207698_12127480
418 Ga0207698_12323798
419 Ga0209967_1018348
420 Ga0209995_1006661
421 Ga0209999_1000714
422 Ga0209970_1006785
423 Ga0209983_1000296
424 Ga0209971_1013235
425 Ga0209974_10008039
426 Ga0268266_10060519
427 Ga0268266_10338979
428 Ga0268264_10005234
429 Ga0316177_1191026
430 Ga0314311_1031529
431 Ga0316178_1182566
432 Ga0316180_1150849
433 Ga0316181_1286399
434 Ga0307513_10015796
435 Ga0307408_100288800
436 Ga0307516_10047197
437 Ga0307516_10978244
438 Ga0307405_11160375
439 Ga0307413_10022156
440 Ga0307413_10438489
441 Ga0307412_10748543
442 Ga0307409_101519682
443 Ga0307409_101745899
444 Ga0307416_103621864
445 Ga0307414_10000300
446 Ga0307414_10240869
447 Ga0307414_10498646
448 Ga0307414_10599577
449 Ga0307414_11003919
450 Ga0307415_100561333
451 Ga0307415_101456351
452 Ga0373934_0338898
453 Ga0373944_0108141
454 Ga0373936_0299300
455 Ga0373935_0923989
456 Ga0373937_0752623
457 Ga0373925_1208454
458 Ga0395899_0097343
459 Ga0395900_0000175
460 Ga0395900_0056989
461 Ga0395900_0295913
462 Ga0395900_0894211
463 Ga0395898_0086681
464 Ga0395898_0436242
465 Ga0395905_0000630
466 Ga0395905_0133704
467 Ga0395901_0131268
468 Ga0395901_0816971
469 Ga0395901_1681284
470 Ga0439436_0025738
471 Ga0439436_0028700
472 Ga0439439_0135389
473 Ga0439465_0000297
474 Ga0451800_0340878
475 Ga0451800_1617507
476 Ga0451807_0371901
477 Ga0451807_0693854
478 Ga0451837_0374541
479 Ga0451837_0990016
480 Ga0451837_1098651
481 Ga0451843_1009909
482 Ga0439431_0032445
483 Ga0439445_0114526
484 Ga0439445_0115690
485 Ga0439432_020431
486 Ga0439432_043098
487 Ga0439432_060999
488 Ga0439449_0000045
489 Ga0439449_0087864
490 Ga0439449_0136835
491 Ga0450909_068498
492 Ga0451577_0044594
493 Ga0453683_0124980
494 Ga0453684_0385725
495 Ga0466957_0337028
496 Ga0466967_1166120
497 Ga0495638_0202337
498 Ga0495580_0778901
499 Ga0495582_0105451
500 Ga0495639_0129997
501 Ga0495662_0197428
502 Ga0495664_0299904
503 Ga0495643_0377531
504 Ga0495652_0532772
505 Ga0495654_0158372
506 Ga0495645_0473111
507 Ga0495656_0000843
508 Ga0495647_0032619
509 Ga0495658_0028701
510 Ga0495613_0460975
511 Ga0495636_0003708
512 Ga0496100_0187620
513 Ga0496100_1035426
514 Ga0496101_1310068
515 Ga0496103_0079268
516 Ga0496104_0000011
517 Ga0496105_0000015
518 Ga0496105_0618869
519 Ga0496108_0013046
520 Ga0496109_0554441
521 Ga0496109_0611698
522 Ga0496112_0049966
523 Ga0496113_0015849
524 Ga0496115_0000065
525 Ga0496118_0027212
526 Ga0496126_0000185
527 Ga0501290_000954
528 Ga0501300_020371
529 Ga0501031_0066151
530 Ga0501032_0047295
531 Ga0501032_0085984
532 Ga0501033_0250148
533 Ga0501034_0517432
534 Ga0501036_1346133
535 Ga0501037_0309975
536 Ga0501039_0059402
537 Ga0501043_0001953
538 Ga0501043_0032273
539 Ga0501047_0230843
540 Ga0501070_0408149
541 Ga0501070_1113888
542 Ga0501225_0003691
543 Ga0501265_000288
544 Ga0501276_026751
545 Ga0501035_0078536
546 Ga0501044_0100640
547 Ga0501044_1331394
548 nmdc:mga00v17_230224_c1
549 nmdc:mga00v17_248665_c1
550 nmdc:mga00v17_484369_c1
551 Ga0500597_279175
552 Ga0500614_143850
553 Ga0500637_0407442
554 2644529919
555 2895502527
556 2895514144
557 2895524377
558 2895526474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

7

81

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8718 2 79
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8654 2 79
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8519 2 79
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8458 2 79
1vjk-assembly1.cif.gz_A putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 0.8398 1 76
ID Description Score Start End Superfamily
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8503 3 79 3.10.20.30
af_P0C919_9_90_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8416 4 79 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8365 1 76 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.834 5 76 3.10.20.30
1vjkA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8298 1 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A3D2A1Q5-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9864 3 79 GO:0000166
GO:0006777
GO:1990133
AF-A0A3M8SVZ1-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9859 2 79 GO:0000166
GO:0006777
GO:1990133
AF-A0A0S7Z8A9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.983 1 79 GO:0000166
GO:0006777
GO:1990133
AF-K9RT74-F1-model_v4 Molybdopterin converting factor, subunit 1 0.9808 1 79
AF-Q2JXS8-F1-model_v4 Putative molybdopterin converting factor, subunit 1 0.9806 2 79

Map