F382859

General Info

Members Datasets Scaffolds Average Seq Length
279 204 558 143

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100096242|Ga0070687_1000962423
Length 135
Sequence MLALVVQNLALVAAAVFAGAAIYVNVAEQPARLTLDNRSLLAEWKPSYQRGKAMQASLALVATALGLWAGYLTGDWVWYLGAAIVIMPVNKVLEATPTDAANAQTRALIEKWGTLHAGRTALGCAATLVYLWAII

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
197 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
201 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
202 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
203 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
204 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.36
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0.36
Rhizoplane 2.51
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100096242 3300005343 Bacteria 1648
2 Ga0065707_10126592 3300005295 Bacteria 1971
3 Ga0070669_101398439 3300005353 Bacteria 607
4 Ga0070675_100606920 3300005354 Bacteria 993
5 Ga0070674_100240603 3300005356 Bacteria 1417
6 Ga0070674_100300711 3300005356 Bacteria 1279
7 Ga0070709_10006428 3300005434 Bacteria 6409
8 Ga0070714_100022614 3300005435 Bacteria 5155
9 Ga0070714_100059437 3300005435 Bacteria 3278
10 Ga0070714_100492100 3300005435 Unclassified 1169
11 Ga0070713_100023769 3300005436 Bacteria 4763
12 Ga0070713_100042750 3300005436 Bacteria 3700
13 Ga0070710_10015363 3300005437 Bacteria 3874
14 Ga0070710_10269488 3300005437 Bacteria 1101
15 Ga0070701_10215016 3300005438 Bacteria 1143
16 Ga0070711_100002422 3300005439 Bacteria 10632
17 Ga0070711_100004859 3300005439 Bacteria 7979
18 Ga0070711_100248292 3300005439 Bacteria 1394
19 Ga0070711_100812632 3300005439 Bacteria 793
20 Ga0070700_100317832 3300005441 Bacteria 1143
21 Ga0070663_100905120 3300005455 Bacteria 762
22 Ga0070678_101239267 3300005456 Unclassified 693
23 Ga0070662_101282490 3300005457 Bacteria 630
24 Ga0070681_11503251 3300005458 Bacteria 598
25 Ga0070706_100085201 3300005467 Bacteria 2928
26 Ga0070706_100228044 3300005467 Bacteria 1739
27 Ga0070707_100070322 3300005468 Bacteria 3371
28 Ga0070698_100133666 3300005471 Bacteria 2435
29 Ga0070698_100932085 3300005471 Bacteria 815
30 Ga0070698_101963779 3300005471 Bacteria 538
31 Ga0070679_100371960 3300005530 Bacteria 1376
32 Ga0070697_100200881 3300005536 Bacteria 1695
33 Ga0070697_101226893 3300005536 Bacteria 668
34 Ga0070686_101717459 3300005544 Bacteria 533
35 Ga0070695_100032374 3300005545 Bacteria 3268
36 Ga0070696_100087296 3300005546 Bacteria 2216
37 Ga0070696_100902986 3300005546 Unclassified 733
38 Ga0070704_100469029 3300005549 Bacteria 1087
39 Ga0068855_100444853 3300005563 Bacteria 1415
40 Ga0068857_100338470 3300005577 Bacteria 1392
41 Ga0068857_101314998 3300005577 Bacteria 702
42 Ga0068856_100272323 3300005614 Bacteria 1709
43 Ga0068852_100141978 3300005616 Bacteria 2224
44 Ga0068852_102279053 3300005616 Bacteria 563
45 Ga0068859_100333729 3300005617 Bacteria 1610
46 Ga0068864_100070077 3300005618 Bacteria 3050
47 Ga0068861_100643532 3300005719 Bacteria 978
48 Ga0068858_100024817 3300005842 Bacteria 5581
49 Ga0068862_101647003 3300005844 Bacteria 649
50 Ga0081539_10013254 3300005985 Bacteria 6229
51 Ga0070717_10067726 3300006028 Bacteria 2971
52 Ga0070717_10954217 3300006028 Unclassified 781
53 Ga0070717_11557187 3300006028 Unclassified 599
54 Ga0075363_100094070 3300006048 Bacteria 1652
55 Ga0070716_100014065 3300006173 Bacteria 4094
56 Ga0070716_100939360 3300006173 Bacteria 680
57 Ga0070712_100033745 3300006175 Bacteria 3464
58 Ga0070712_100081384 3300006175 Bacteria 2346
59 Ga0070712_100204856 3300006175 Bacteria 1552
60 Ga0070712_100688634 3300006175 Unclassified 871
61 Ga0075367_10019219 3300006178 Bacteria 3786
62 Ga0075369_10011832 3300006186 Bacteria 3437
63 Ga0097621_101569947 3300006237 Bacteria 625
64 Ga0075428_100072535 3300006844 Bacteria 3761
65 Ga0075431_101551142 3300006847 Unclassified 620
66 Ga0075431_101684129 3300006847 Bacteria 591
67 Ga0075433_10004414 3300006852 Bacteria 10950
68 Ga0075434_100003399 3300006871 Bacteria 14250
69 Ga0097620_100333755 3300006931 Bacteria 1610
70 Ga0075435_100100852 3300007076 Bacteria 2392
71 Ga0099794_10250444 3300007265 Unclassified 913
72 Ga0111539_10026493 3300009094 Bacteria 7087
73 Ga0111539_10418893 3300009094 Unclassified 1560
74 Ga0105245_11804938 3300009098 Bacteria 664
75 Ga0105247_10105813 3300009101 Bacteria 1804
76 Ga0114129_10000558 3300009147 Bacteria 45754
77 Ga0114129_10031861 3300009147 Bacteria 7453
78 Ga0114129_10675020 3300009147 Unclassified 1331
79 Ga0114129_10980987 3300009147 Bacteria 1065
80 Ga0105243_10366822 3300009148 Bacteria 1327
81 Ga0105242_11358670 3300009176 Bacteria 736
82 Ga0105249_10313581 3300009553 Bacteria 1578
83 Ga0105249_10433699 3300009553 Bacteria 1350
84 Ga0105249_10632014 3300009553 Bacteria 1127
85 Ga0105239_10243325 3300010375 Bacteria 2019
86 Ga0105246_10141917 3300011119 Bacteria 1807
87 Ga0157370_11094522 3300013104 Bacteria 720
88 Ga0157369_10012236 3300013105 Bacteria 9744
89 Ga0157369_10026947 3300013105 Bacteria 6374
90 Ga0163162_10638649 3300013306 Bacteria 1189
91 Ga0157372_10047361 3300013307 Bacteria 4777
92 Ga0157372_12093344 3300013307 Bacteria 650
93 Ga0157375_10733868 3300013308 Bacteria 1140
94 Ga0157375_11262153 3300013308 Bacteria 868
95 Ga0157375_12917410 3300013308 Unclassified 571
96 Ga0197907_10679688 3300020069 Bacteria 768
97 Ga0213874_10019287 3300021377 Bacteria 1854
98 Ga0213876_10030109 3300021384 Bacteria 2862
99 Ga0213876_10311636 3300021384 Bacteria 837
100 Ga0209758_1175438 3300025297 Bacteria 520
101 Ga0207692_10115894 3300025898 Bacteria 1493
102 Ga0207710_10038900 3300025900 Bacteria 2104
103 Ga0207680_11376875 3300025903 Bacteria 501
104 Ga0207647_10427060 3300025904 Bacteria 744
105 Ga0207699_10025645 3300025906 Bacteria 3238
106 Ga0207699_10503688 3300025906 Bacteria 874
107 Ga0207643_10014942 3300025908 Bacteria 4223
108 Ga0207684_10069492 3300025910 Bacteria 2993
109 Ga0207707_10092841 3300025912 Bacteria 2637
110 Ga0207695_10022857 3300025913 Bacteria 7083
111 Ga0207671_10043998 3300025914 Bacteria 3301
112 Ga0207693_10005063 3300025915 Bacteria 11062
113 Ga0207693_10224584 3300025915 Bacteria 1475
114 Ga0207693_10360147 3300025915 Bacteria 1138
115 Ga0207693_11052426 3300025915 Unclassified 620
116 Ga0207663_10082828 3300025916 Bacteria 2106
117 Ga0207663_10331502 3300025916 Bacteria 1146
118 Ga0207663_10512059 3300025916 Unclassified 933
119 Ga0207649_11192084 3300025920 Unclassified 602
120 Ga0207646_10251835 3300025922 Bacteria 1596
121 Ga0207681_10719053 3300025923 Bacteria 831
122 Ga0207694_10239733 3300025924 Bacteria 1482
123 Ga0207694_10418223 3300025924 Bacteria 1116
124 Ga0207650_10164699 3300025925 Bacteria 1759
125 Ga0207659_10171486 3300025926 Bacteria 1712
126 Ga0207700_10009391 3300025928 Bacteria 6105
127 Ga0207700_10396236 3300025928 Unclassified 1209
128 Ga0207700_11674549 3300025928 Unclassified 561
129 Ga0207664_10310697 3300025929 Bacteria 1389
130 Ga0207664_10394709 3300025929 Bacteria 1230
131 Ga0207690_10686513 3300025932 Bacteria 841
132 Ga0207706_10369342 3300025933 Bacteria 1246
133 Ga0207709_10158986 3300025935 Bacteria 1574
134 Ga0207669_10267374 3300025937 Bacteria 1282
135 Ga0207669_10324317 3300025937 Bacteria 1180
136 Ga0207669_10427988 3300025937 Bacteria 1043
137 Ga0207665_10022593 3300025939 Bacteria 4139
138 Ga0207665_10228844 3300025939 Bacteria 1366
139 Ga0207711_11620355 3300025941 Bacteria 591
140 Ga0207689_10063729 3300025942 Bacteria 3032
141 Ga0207667_10470999 3300025949 Bacteria 1275
142 Ga0207712_10393418 3300025961 Bacteria 1163
143 Ga0207640_10782367 3300025981 Bacteria 825
144 Ga0207703_10312304 3300026035 Bacteria 1437
145 Ga0207639_11952271 3300026041 Bacteria 548
146 Ga0207708_10325668 3300026075 Bacteria 1255
147 Ga0207702_10166717 3300026078 Bacteria 2016
148 Ga0207676_10086159 3300026095 Bacteria 2565
149 Ga0207674_11262638 3300026116 Bacteria 708
150 Ga0207675_100182631 3300026118 Bacteria 2009
151 Ga0207675_100439562 3300026118 Bacteria 1291
152 Ga0207683_10076182 3300026121 Bacteria 2970
153 Ga0207698_10209459 3300026142 Bacteria 1753
154 Ga0207428_10058752 3300027907 Bacteria 3051
155 Ga0268266_10266879 3300028379 Unclassified 1588
156 Ga0268265_10121238 3300028380 Bacteria 2155
157 Ga0268265_10273160 3300028380 Bacteria 1509
158 Ga0268265_10760592 3300028380 Bacteria 941
159 Ga0307513_10352824 3300031456 Bacteria 1218
160 Ga0373948_0018576 3300034817 Bacteria 1307
161 Ga0373950_0013934 3300034818 Unclassified 1347
162 Ga0373958_0035290 3300034819 Bacteria 1000
163 Ga0373928_0025589 3300035084 Bacteria 1273
164 Ga0373929_0046171 3300035085 Bacteria 983
165 Ga0373940_0004728 3300035088 Bacteria 2899
166 Ga0373949_0004893 3300035090 Bacteria 3030
167 Ga0373951_0020975 3300035091 Bacteria 1499
168 Ga0373939_0006974 3300035114 Bacteria 2735
169 Ga0373942_0017165 3300035207 Bacteria 1783
170 Ga0373962_0000810 3300035242 Bacteria 7149
171 Ga0373931_0000718 3300035691 Bacteria 13735
172 Ga0395898_1104113 3300037466 Unclassified 726
173 Ga0436364_0840660 3300037853 Bacteria 1012
174 Ga0436364_1345550 3300037853 Bacteria 3289
175 Ga0436365_1164232 3300039437 Bacteria 2780
176 Ga0436365_1364139 3300039437 Bacteria 706
177 Ga0436361_0113516 3300039447 Bacteria 1425
178 Ga0436363_1698598 3300039450 Bacteria 8141
179 Ga0436362_0872351 3300039453 Bacteria 901
180 Ga0439465_0133205 3300041413 Bacteria 879
181 Ga0451577_0008551 3300042876 Bacteria 9954
182 Ga0453684_0021322 3300044712 Bacteria 9689
183 Ga0466967_2511794 3300045976 Unclassified 510
184 Ga0495605_0043887 3300046474 Bacteria 2214
185 Ga0495664_0183639 3300046477 Bacteria 1268
186 Ga0495594_0272259 3300046499 Bacteria 965
187 Ga0495628_0294294 3300046516 Bacteria 1203
188 Ga0495631_0286744 3300046518 Unclassified 701
189 Ga0495652_0301276 3300046529 Bacteria 1165
190 Ga0495640_0361490 3300046533 Bacteria 895
191 Ga0495587_0278973 3300046536 Bacteria 937
192 Ga0495587_0682803 3300046536 Bacteria 563
193 Ga0495645_0039157 3300046543 Bacteria 3458
194 Ga0495656_0131182 3300046615 Bacteria 1193
195 Ga0495674_0257584 3300047319 Bacteria 1434
196 Ga0495672_0015631 3300047320 Bacteria 5144
197 Ga0495684_0874852 3300047471 Bacteria 581
198 Ga0496101_0375077 3300048904 Bacteria 1119
199 Ga0496102_0730901 3300048905 Bacteria 913
200 Ga0496103_0153119 3300048906 Bacteria 1477
201 Ga0496106_0129133 3300048909 Bacteria 1981
202 Ga0496107_0982864 3300048910 Bacteria 613
203 Ga0496114_0236283 3300048917 Bacteria 1606
204 Ga0496115_1059823 3300048918 Unclassified 616
205 Ga0501033_0386482 3300049570 Bacteria 977
206 Ga0501034_0740193 3300049571 Unclassified 879
207 Ga0501036_0026122 3300049572 Bacteria 4929
208 Ga0501037_0385764 3300049573 Bacteria 962
209 Ga0501038_0243110 3300049574 Bacteria 1428
210 Ga0501039_0051729 3300049575 Bacteria 3178
211 Ga0501040_0012675 3300049576 Bacteria 5530
212 Ga0501041_0020472 3300049577 Bacteria 3956
213 Ga0501041_0678145 3300049577 Bacteria 659
214 Ga0501042_0045796 3300049578 Bacteria 3118
215 Ga0501042_0281472 3300049578 Bacteria 1201
216 Ga0501042_0512858 3300049578 Unclassified 871
217 Ga0501048_0110859 3300049582 Bacteria 1937
218 Ga0501069_0158010 3300049585 Bacteria 1305
219 Ga0501069_0887627 3300049585 Unclassified 542
220 Ga0501071_0062282 3300049587 Bacteria 2702
221 Ga0501071_0839216 3300049587 Bacteria 709
222 Ga0501072_0010966 3300049588 Bacteria 6910
223 Ga0501073_0504139 3300049589 Bacteria 837
224 Ga0501074_0066229 3300049590 Bacteria 2598
225 Ga0501075_0035824 3300049591 Bacteria 3701
226 Ga0501075_0778758 3300049591 Bacteria 728
227 Ga0501076_0059787 3300049592 Bacteria 3031
228 Ga0501076_1452661 3300049592 Bacteria 563
229 Ga0501076_1806773 3300049592 Bacteria 501
230 Ga0501077_0006520 3300049593 Bacteria 7163
231 Ga0501077_0261793 3300049593 Bacteria 1100
232 Ga0501079_0083647 3300049741 Bacteria 2469
233 Ga0501079_0084564 3300049741 Bacteria 2454
234 Ga0501080_0038377 3300049742 Bacteria 4472
235 Ga0501081_0046811 3300049743 Bacteria 2974
236 Ga0501081_0069694 3300049743 Bacteria 2450
237 Ga0501081_0615423 3300049743 Bacteria 813
238 Ga0501083_0042287 3300049744 Bacteria 3090
239 Ga0501083_0087148 3300049744 Bacteria 2065
240 Ga0501035_1494155 3300049822 Bacteria 515
241 Ga0501044_0657232 3300049823 Bacteria 937
242 Ga0501045_0088569 3300049824 Bacteria 2286
243 nmdc:mga03n38_256010_c1 3300050490 Bacteria 926
244 nmdc:mga03n38_56037_c1 3300050490 Bacteria 1358
245 nmdc:mga0yw44_105987_c1 3300050492 Bacteria 1796
246 nmdc:mga06z11_31752_c1 3300050494 Bacteria 2569
247 nmdc:mga05p37_1526_c1 3300050507 Bacteria 22128
248 nmdc:mga05p37_1793546_c1 3300050507 Bacteria 592
249 nmdc:mga05p37_969929_c1 3300050507 Bacteria 907
250 nmdc:mga06r32_1564813_c1 3300050510 Unclassified 598
251 nmdc:mga08y16_356833_c1 3300050511 Unclassified 1501
252 nmdc:mga08y16_582341_c1 3300050511 Bacteria 1130
253 nmdc:mga0n895_1961561_c1 3300050512 Unclassified 544
254 nmdc:mga0n895_8761_c1 3300050512 Bacteria 8796
255 nmdc:mga0rr50_8706_c1 3300050513 Bacteria 6328
256 nmdc:mga0a205_16437_c1 3300050515 Bacteria 6930
257 nmdc:mga0sz30_140891_c1 3300050516 Bacteria 1065
258 Ga0495601_0061725 3300053077 Bacteria 2379
259 Ga0495612_0022980 3300053078 Bacteria 2500
260 Ga0495595_0117123 3300053084 Bacteria 1296
261 Ga0495619_0018785 3300053085 Bacteria 4388
262 Ga0500644_0037651 3300053088 Bacteria 1583
263 Ga0500641_0054653 3300053096 Bacteria 1651
264 Ga0500577_0171063 3300053142 Bacteria 929
265 Ga0500616_0076112 3300053153 Bacteria 1697
266 Ga0500616_0114668 3300053153 Bacteria 1296
267 Ga0500627_0123096 3300053158 Bacteria 1170
268 Ga0500636_0271994 3300053177 Bacteria 851
269 Ga0501084_0029838 3300054114 Bacteria 4560
270 Ga0501084_1323622 3300054114 Bacteria 604
271 Ga0501082_0063108 3300060353 Bacteria 3190
272 Ga0501082_0080083 3300060353 Bacteria 2818
273 Ga0530510_0042239 3300061734 Bacteria 3294
274 Ga0530510_0064923 3300061734 Bacteria 2644
275 Ga0530510_0087426 3300061734 Bacteria 2271
276 2513591391 2513237087 Bacteria 5817514
277 2657681520 2657244999 Bacteria 5946535
278 2804752712 2802429268 Bacteria 6094027
279 2883357199 2883354860 Bacteria 5865246
280 Ga0070687_100096242
281 Ga0065707_10126592
282 Ga0070669_101398439
283 Ga0070675_100606920
284 Ga0070674_100240603
285 Ga0070674_100300711
286 Ga0070709_10006428
287 Ga0070714_100022614
288 Ga0070714_100059437
289 Ga0070714_100492100
290 Ga0070713_100023769
291 Ga0070713_100042750
292 Ga0070710_10015363
293 Ga0070710_10269488
294 Ga0070701_10215016
295 Ga0070711_100002422
296 Ga0070711_100004859
297 Ga0070711_100248292
298 Ga0070711_100812632
299 Ga0070700_100317832
300 Ga0070663_100905120
301 Ga0070678_101239267
302 Ga0070662_101282490
303 Ga0070681_11503251
304 Ga0070706_100085201
305 Ga0070706_100228044
306 Ga0070707_100070322
307 Ga0070698_100133666
308 Ga0070698_100932085
309 Ga0070698_101963779
310 Ga0070679_100371960
311 Ga0070697_100200881
312 Ga0070697_101226893
313 Ga0070686_101717459
314 Ga0070695_100032374
315 Ga0070696_100087296
316 Ga0070696_100902986
317 Ga0070704_100469029
318 Ga0068855_100444853
319 Ga0068857_100338470
320 Ga0068857_101314998
321 Ga0068856_100272323
322 Ga0068852_100141978
323 Ga0068852_102279053
324 Ga0068859_100333729
325 Ga0068864_100070077
326 Ga0068861_100643532
327 Ga0068858_100024817
328 Ga0068862_101647003
329 Ga0081539_10013254
330 Ga0070717_10067726
331 Ga0070717_10954217
332 Ga0070717_11557187
333 Ga0075363_100094070
334 Ga0070716_100014065
335 Ga0070716_100939360
336 Ga0070712_100033745
337 Ga0070712_100081384
338 Ga0070712_100204856
339 Ga0070712_100688634
340 Ga0075367_10019219
341 Ga0075369_10011832
342 Ga0097621_101569947
343 Ga0075428_100072535
344 Ga0075431_101551142
345 Ga0075431_101684129
346 Ga0075433_10004414
347 Ga0075434_100003399
348 Ga0097620_100333755
349 Ga0075435_100100852
350 Ga0099794_10250444
351 Ga0111539_10026493
352 Ga0111539_10418893
353 Ga0105245_11804938
354 Ga0105247_10105813
355 Ga0114129_10000558
356 Ga0114129_10031861
357 Ga0114129_10675020
358 Ga0114129_10980987
359 Ga0105243_10366822
360 Ga0105242_11358670
361 Ga0105249_10313581
362 Ga0105249_10433699
363 Ga0105249_10632014
364 Ga0105239_10243325
365 Ga0105246_10141917
366 Ga0157370_11094522
367 Ga0157369_10012236
368 Ga0157369_10026947
369 Ga0163162_10638649
370 Ga0157372_10047361
371 Ga0157372_12093344
372 Ga0157375_10733868
373 Ga0157375_11262153
374 Ga0157375_12917410
375 Ga0197907_10679688
376 Ga0213874_10019287
377 Ga0213876_10030109
378 Ga0213876_10311636
379 Ga0209758_1175438
380 Ga0207692_10115894
381 Ga0207710_10038900
382 Ga0207680_11376875
383 Ga0207647_10427060
384 Ga0207699_10025645
385 Ga0207699_10503688
386 Ga0207643_10014942
387 Ga0207684_10069492
388 Ga0207707_10092841
389 Ga0207695_10022857
390 Ga0207671_10043998
391 Ga0207693_10005063
392 Ga0207693_10224584
393 Ga0207693_10360147
394 Ga0207693_11052426
395 Ga0207663_10082828
396 Ga0207663_10331502
397 Ga0207663_10512059
398 Ga0207649_11192084
399 Ga0207646_10251835
400 Ga0207681_10719053
401 Ga0207694_10239733
402 Ga0207694_10418223
403 Ga0207650_10164699
404 Ga0207659_10171486
405 Ga0207700_10009391
406 Ga0207700_10396236
407 Ga0207700_11674549
408 Ga0207664_10310697
409 Ga0207664_10394709
410 Ga0207690_10686513
411 Ga0207706_10369342
412 Ga0207709_10158986
413 Ga0207669_10267374
414 Ga0207669_10324317
415 Ga0207669_10427988
416 Ga0207665_10022593
417 Ga0207665_10228844
418 Ga0207711_11620355
419 Ga0207689_10063729
420 Ga0207667_10470999
421 Ga0207712_10393418
422 Ga0207640_10782367
423 Ga0207703_10312304
424 Ga0207639_11952271
425 Ga0207708_10325668
426 Ga0207702_10166717
427 Ga0207676_10086159
428 Ga0207674_11262638
429 Ga0207675_100182631
430 Ga0207675_100439562
431 Ga0207683_10076182
432 Ga0207698_10209459
433 Ga0207428_10058752
434 Ga0268266_10266879
435 Ga0268265_10121238
436 Ga0268265_10273160
437 Ga0268265_10760592
438 Ga0307513_10352824
439 Ga0373948_0018576
440 Ga0373950_0013934
441 Ga0373958_0035290
442 Ga0373928_0025589
443 Ga0373929_0046171
444 Ga0373940_0004728
445 Ga0373949_0004893
446 Ga0373951_0020975
447 Ga0373939_0006974
448 Ga0373942_0017165
449 Ga0373962_0000810
450 Ga0373931_0000718
451 Ga0395898_1104113
452 Ga0436364_0840660
453 Ga0436364_1345550
454 Ga0436365_1164232
455 Ga0436365_1364139
456 Ga0436361_0113516
457 Ga0436363_1698598
458 Ga0436362_0872351
459 Ga0439465_0133205
460 Ga0451577_0008551
461 Ga0453684_0021322
462 Ga0466967_2511794
463 Ga0495605_0043887
464 Ga0495664_0183639
465 Ga0495594_0272259
466 Ga0495628_0294294
467 Ga0495631_0286744
468 Ga0495652_0301276
469 Ga0495640_0361490
470 Ga0495587_0278973
471 Ga0495587_0682803
472 Ga0495645_0039157
473 Ga0495656_0131182
474 Ga0495674_0257584
475 Ga0495672_0015631
476 Ga0495684_0874852
477 Ga0496101_0375077
478 Ga0496102_0730901
479 Ga0496103_0153119
480 Ga0496106_0129133
481 Ga0496107_0982864
482 Ga0496114_0236283
483 Ga0496115_1059823
484 Ga0501033_0386482
485 Ga0501034_0740193
486 Ga0501036_0026122
487 Ga0501037_0385764
488 Ga0501038_0243110
489 Ga0501039_0051729
490 Ga0501040_0012675
491 Ga0501041_0020472
492 Ga0501041_0678145
493 Ga0501042_0045796
494 Ga0501042_0281472
495 Ga0501042_0512858
496 Ga0501048_0110859
497 Ga0501069_0158010
498 Ga0501069_0887627
499 Ga0501071_0062282
500 Ga0501071_0839216
501 Ga0501072_0010966
502 Ga0501073_0504139
503 Ga0501074_0066229
504 Ga0501075_0035824
505 Ga0501075_0778758
506 Ga0501076_0059787
507 Ga0501076_1452661
508 Ga0501076_1806773
509 Ga0501077_0006520
510 Ga0501077_0261793
511 Ga0501079_0083647
512 Ga0501079_0084564
513 Ga0501080_0038377
514 Ga0501081_0046811
515 Ga0501081_0069694
516 Ga0501081_0615423
517 Ga0501083_0042287
518 Ga0501083_0087148
519 Ga0501035_1494155
520 Ga0501044_0657232
521 Ga0501045_0088569
522 nmdc:mga03n38_256010_c1
523 nmdc:mga03n38_56037_c1
524 nmdc:mga0yw44_105987_c1
525 nmdc:mga06z11_31752_c1
526 nmdc:mga05p37_1526_c1
527 nmdc:mga05p37_1793546_c1
528 nmdc:mga05p37_969929_c1
529 nmdc:mga06r32_1564813_c1
530 nmdc:mga08y16_356833_c1
531 nmdc:mga08y16_582341_c1
532 nmdc:mga0n895_1961561_c1
533 nmdc:mga0n895_8761_c1
534 nmdc:mga0rr50_8706_c1
535 nmdc:mga0a205_16437_c1
536 nmdc:mga0sz30_140891_c1
537 Ga0495601_0061725
538 Ga0495612_0022980
539 Ga0495595_0117123
540 Ga0495619_0018785
541 Ga0500644_0037651
542 Ga0500641_0054653
543 Ga0500577_0171063
544 Ga0500616_0076112
545 Ga0500616_0114668
546 Ga0500627_0123096
547 Ga0500636_0271994
548 Ga0501084_0029838
549 Ga0501084_1323622
550 Ga0501082_0063108
551 Ga0501082_0080083
552 Ga0530510_0042239
553 Ga0530510_0064923
554 Ga0530510_0087426
555 2513591391
556 2657681520
557 2804752712
558 2883357199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08592

Anthrone_oxy

Anthrone oxygenase

44

129

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.6643 6 139
6peq-assembly1.cif.gz_F glua2 in complex with its auxiliary subunit cnih3 - map lbd-tmd-c3 - with antagonist zk200775 -without ntd 0.6571 2 143
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.6515 6 139
6upw-assembly1.cif.gz_M metavinculin abd-f-actin complex 0.645 6 140
2b0h-assembly1.cif.gz_A solution structure of vbs3 fragment of talin 0.624 3 137
ID Description Score Start End Superfamily
af_Q9C0W5_1_160_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9592 2 141 1.20.120.550
af_Q555E4_30_180_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9374 21 139 1.20.120.550
af_Q9C0W5_1_160_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9208 2 141 1.20.120.550
af_Q555E4_30_180_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7695 21 139 1.20.120.550
af_A0A1D6N6L5_139_312_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7174 3 137 1.20.120.520
ID Description Score Start End GO Terms
AF-A0A3S0TDF3-F1-model_v4 DUF1772 domain-containing protein 0.9997 6 145 GO:0016020
AF-A0A1W9IFF1-F1-model_v4 DUF1772 domain-containing protein 0.9993 6 143 GO:0016020
AF-F8JEV1-F1-model_v4 DUF1772 domain-containing protein 0.9986 6 145 GO:0016020
AF-A0A6I3KKT5-F1-model_v4 DUF1772 domain-containing protein 0.9982 5 145 GO:0016020
AF-A0A259KU54-F1-model_v4 DUF1772 domain-containing protein 0.9965 5 143 GO:0016020

Map