F382558

General Info

Members Datasets Scaffolds Average Seq Length
278 161 266 195

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0011476|Ga0466965_0011476_1682_2395
Length 237
Sequence VRPVDERGNVNDELTADMPRTRYNPATLPHRSACANPRLFVEIVLNKRDFLVTAALGTLALSPSAHAATKRGNAGPVLLTVSGAIGNANRGPLDPALDQMMKKQSVKFDRAHAFDFAALAALPATTIKPTLEYDAKPHALSGPLLTDVLSAAGAKLDDKTKVVLRAIDGYAVVVPIADIRKYRFIIATHLDGKPMPLGGLGPLWAVYDADRFEDMMGKPVGDRFASCPWGLYHVEVQ

Samples

Sample ID Description Type Environment
1 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
2 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
5 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
6 2738541280 Massilia sp. GV090 Isolate Unclassified
7 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
8 2842711865 Duganella sp. R-73148 Isolate Unclassified
9 2904424332 Duganella sp. 1411 Isolate Rhizosphere
10 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
11 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
70 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
158 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
159 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0.72
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.76
Nodule 1.08
Rhizoplane 4.68
Rhizosphere 80.58
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10173875 3300003316 Bacteria 1296
2 rootH2_10147461 3300003320 Bacteria 1414
3 rootL2_10009010 3300003322 Bacteria 10437
4 rootL2_10017691 3300003322 Bacteria 4195
5 rootL2_10068879 3300003322 Bacteria 2387
6 rootH1_10225029 3300003323 Bacteria 2307
7 JGI25160J50197_1000083 3300003354 Bacteria 97669
8 Ga0055526_1000043 3300003771 Bacteria 123347
9 Ga0055540_1006823 3300003792 Bacteria 4448
10 Ga0055531_10000618 3300003794 Bacteria 30684
11 Ga0065165_1000445 3300005262 Bacteria 64885
12 Ga0065165_1022496 3300005262 Bacteria 2159
13 Ga0070658_11203267 3300005327 Bacteria 659
14 Ga0070674_100500815 3300005356 Bacteria 1011
15 Ga0070667_101190230 3300005367 Bacteria 713
16 Ga0070663_100446309 3300005455 Bacteria 1065
17 Ga0070693_100664019 3300005547 Unclassified 759
18 Ga0068855_100013105 3300005563 Bacteria 9998
19 Ga0070664_100036043 3300005564 Bacteria 4154
20 Ga0070664_100090535 3300005564 Bacteria 2648
21 Ga0070664_100561982 3300005564 Bacteria 1056
22 Ga0068856_100008694 3300005614 Bacteria 9879
23 Ga0068852_100082772 3300005616 Bacteria 2852
24 Ga0068852_100349733 3300005616 Bacteria 1443
25 Ga0075365_10337731 3300006038 Bacteria 1061
26 Ga0075370_10322070 3300006353 Bacteria 921
27 Ga0105251_10038737 3300009011 Bacteria 2333
28 Ga0105244_10000426 3300009036 Bacteria 39063
29 Ga0105243_10040548 3300009148 Bacteria 3637
30 Ga0105241_10005831 3300009174 Bacteria 9094
31 Ga0105248_10500869 3300009177 Bacteria 1369
32 Ga0157372_10390070 3300013307 Bacteria 1623
33 Ga0213872_10001778 3300021361 Bacteria 13464
34 Ga0213872_10038307 3300021361 Bacteria 2188
35 Ga0209130_1008028 3300025284 Bacteria 3170
36 Ga0209564_1000010 3300025295 Bacteria 885399
37 Ga0209564_1007497 3300025295 Bacteria 5627
38 Ga0207426_1000004 3300025302 Bacteria 1047900
39 Ga0209051_1000110 3300025303 Bacteria 153230
40 Ga0209257_1000012 3300025304 Bacteria 1111138
41 Ga0209257_1000045 3300025304 Bacteria 484429
42 Ga0207655_1000444 3300025728 Bacteria 54646
43 Ga0207705_10055584 3300025909 Bacteria 2854
44 Ga0207654_10005027 3300025911 Bacteria 6682
45 Ga0207650_10931785 3300025925 Bacteria 738
46 Ga0207709_10223341 3300025935 Bacteria 1360
47 Ga0207669_10468784 3300025937 Bacteria 1001
48 Ga0207679_10036835 3300025945 Bacteria 3473
49 Ga0207679_10334766 3300025945 Bacteria 1315
50 Ga0207667_10046752 3300025949 Bacteria 4583
51 Ga0207702_10434098 3300026078 Bacteria 1272
52 Ga0207648_10052279 3300026089 Bacteria 3572
53 Ga0207648_10727001 3300026089 Bacteria 921
54 Ga0207698_10134907 3300026142 Bacteria 2116
55 Ga0207698_11144745 3300026142 Bacteria 791
56 Ga0268265_10122906 3300028380 Bacteria 2142
57 Ga0307515_10221330 3300028794 Bacteria 1710
58 Ga0307406_10000848 3300031901 Bacteria 17206
59 Ga0307414_10519244 3300032004 Bacteria 1057
60 Ga0395899_0177851 3300037312 Bacteria 1495
61 Ga0395899_0328649 3300037312 Bacteria 1028
62 Ga0395900_0000947 3300037418 Bacteria 37852
63 Ga0395900_0019654 3300037418 Bacteria 6886
64 Ga0395900_0134841 3300037418 Bacteria 2529
65 Ga0395898_0001680 3300037466 Bacteria 29608
66 Ga0395898_0057298 3300037466 Bacteria 3797
67 Ga0395905_0003363 3300037471 Bacteria 17143
68 Ga0395905_0031650 3300037471 Bacteria 4978
69 Ga0395905_0139365 3300037471 Bacteria 2282
70 Ga0395901_0377547 3300038443 Bacteria 1459
71 Ga0436361_0507268 3300039447 Bacteria 1971
72 Ga0436361_0568335 3300039447 Bacteria 14489
73 Ga0436361_0762422 3300039447 Bacteria 2329
74 Ga0436361_0965909 3300039447 Bacteria 1562
75 Ga0439465_0070109 3300041413 Unclassified 1174
76 Ga0439448_0002465 3300042005 Bacteria 5041
77 Ga0439432_052455 3300042006 Bacteria 1270
78 Ga0439449_0035989 3300042007 Bacteria 1841
79 Ga0439455_0002095 3300042012 Bacteria 3552
80 Ga0450890_031369 3300042127 Bacteria 757
81 Ga0466969_0058508 3300044656 Bacteria 1876
82 Ga0466969_0074906 3300044656 Bacteria 1623
83 Ga0466972_0000018 3300044658 Bacteria 199161
84 Ga0466977_0000184 3300044666 Bacteria 16121
85 Ga0466965_0000968 3300044683 Bacteria 11103
86 Ga0466965_0011476 3300044683 Bacteria 4153
87 Ga0466966_0021258 3300044684 Bacteria 4262
88 Ga0466961_0014799 3300044693 Bacteria 5012
89 Ga0466964_0000220 3300044706 Bacteria 16319
90 Ga0466964_0005978 3300044706 Bacteria 4536
91 Ga0466964_0038141 3300044706 Bacteria 1931
92 Ga0466964_0180408 3300044706 Bacteria 1001
93 Ga0466971_0013616 3300044719 Bacteria 3574
94 Ga0466968_0000504 3300044735 Bacteria 13270
95 Ga0466970_0075270 3300044765 Bacteria 1818
96 Ga0466957_0084211 3300044842 Bacteria 1984
97 Ga0466957_0158974 3300044842 Bacteria 1466
98 Ga0466959_0009829 3300045049 Bacteria 6816
99 Ga0451576_0368903 3300045051 Bacteria 1504
100 Ga0466958_0449348 3300045836 Bacteria 834
101 Ga0466958_0489321 3300045836 Bacteria 798
102 Ga0466967_0056500 3300045976 Bacteria 3461
103 Ga0495627_008681 3300046453 Bacteria 3791
104 Ga0495603_0000805 3300046455 Bacteria 17989
105 Ga0495603_0282678 3300046455 Bacteria 954
106 Ga0495590_0025659 3300046457 Bacteria 2071
107 Ga0495590_0103324 3300046457 Bacteria 1013
108 Ga0495629_0296785 3300046459 Bacteria 1107
109 Ga0495638_0001311 3300046460 Bacteria 22988
110 Ga0495638_0444281 3300046460 Bacteria 663
111 Ga0495580_0000147 3300046472 Bacteria 51023
112 Ga0495605_0056451 3300046474 Bacteria 1893
113 Ga0495605_0062123 3300046474 Bacteria 1785
114 Ga0495584_0001087 3300046491 Bacteria 16890
115 Ga0495584_0006887 3300046491 Bacteria 5939
116 Ga0495584_0007430 3300046491 Bacteria 5717
117 Ga0495585_0000435 3300046492 Bacteria 39966
118 Ga0495585_0000462 3300046492 Bacteria 38823
119 Ga0495585_0003450 3300046492 Bacteria 10677
120 Ga0495585_0015630 3300046492 Bacteria 4408
121 Ga0495585_0026680 3300046492 Bacteria 3299
122 Ga0495585_0027544 3300046492 Bacteria 3243
123 Ga0495585_0151374 3300046492 Bacteria 1209
124 Ga0495594_0030242 3300046499 Bacteria 2928
125 Ga0495594_0470264 3300046499 Bacteria 714
126 Ga0495607_0006459 3300046501 Bacteria 8251
127 Ga0495607_0052383 3300046501 Bacteria 2364
128 Ga0495607_0158684 3300046501 Bacteria 1151
129 Ga0495583_0004664 3300046506 Bacteria 9664
130 Ga0495583_0028997 3300046506 Bacteria 2713
131 Ga0495583_0137609 3300046506 Bacteria 1018
132 Ga0495583_0155622 3300046506 Bacteria 945
133 Ga0495583_0198599 3300046506 Bacteria 815
134 Ga0495606_0001477 3300046507 Bacteria 31345
135 Ga0495606_0027829 3300046507 Bacteria 3999
136 Ga0495606_0029359 3300046507 Bacteria 3862
137 Ga0495606_0033535 3300046507 Bacteria 3540
138 Ga0495610_0071618 3300046512 Bacteria 1615
139 Ga0495610_0120037 3300046512 Bacteria 1153
140 Ga0495610_0167131 3300046512 Bacteria 925
141 Ga0495616_0000253 3300046513 Bacteria 43324
142 Ga0495616_0036320 3300046513 Bacteria 2543
143 Ga0495616_0101257 3300046513 Bacteria 1350
144 Ga0495616_0263708 3300046513 Bacteria 736
145 Ga0495628_0402181 3300046516 Bacteria 1000
146 Ga0495631_0004920 3300046518 Bacteria 7040
147 Ga0495631_0034404 3300046518 Bacteria 2272
148 Ga0495631_0041482 3300046518 Bacteria 2036
149 Ga0495631_0133309 3300046518 Bacteria 1067
150 Ga0495631_0271160 3300046518 Bacteria 723
151 Ga0495632_0012991 3300046519 Bacteria 4773
152 Ga0495632_0022582 3300046519 Bacteria 3370
153 Ga0495643_0025812 3300046522 Bacteria 3321
154 Ga0495644_0033798 3300046523 Bacteria 1931
155 Ga0495644_0042226 3300046523 Bacteria 1717
156 Ga0495648_0001796 3300046524 Bacteria 20647
157 Ga0495648_0123224 3300046524 Bacteria 1389
158 Ga0495648_0189417 3300046524 Bacteria 1039
159 Ga0495663_0009423 3300046525 Bacteria 2708
160 Ga0495666_0023765 3300046526 Bacteria 3031
161 Ga0495642_0000681 3300046528 Bacteria 16848
162 Ga0495642_0019233 3300046528 Bacteria 2676
163 Ga0495642_0026654 3300046528 Bacteria 2296
164 Ga0495642_0091163 3300046528 Bacteria 1290
165 Ga0495665_0149278 3300046531 Bacteria 1220
166 Ga0495640_0356819 3300046533 Bacteria 902
167 Ga0495586_0042311 3300046535 Bacteria 2454
168 Ga0495586_0448202 3300046535 Bacteria 744
169 Ga0495609_0002532 3300046538 Bacteria 11208
170 Ga0495609_0016808 3300046538 Bacteria 3407
171 Ga0495609_0173903 3300046538 Bacteria 908
172 Ga0495597_0004574 3300046542 Bacteria 7561
173 Ga0495597_0014877 3300046542 Bacteria 3698
174 Ga0495597_0027370 3300046542 Bacteria 2614
175 Ga0495597_0041733 3300046542 Bacteria 2048
176 Ga0495597_0079056 3300046542 Bacteria 1408
177 Ga0495597_0100477 3300046542 Bacteria 1220
178 Ga0495622_0010901 3300046557 Bacteria 4192
179 Ga0495622_0033768 3300046557 Bacteria 2388
180 Ga0495622_0115496 3300046557 Bacteria 1227
181 Ga0495633_0001108 3300046558 Bacteria 21676
182 Ga0495633_0002720 3300046558 Bacteria 12262
183 Ga0495633_0011157 3300046558 Bacteria 4867
184 Ga0495633_0047727 3300046558 Bacteria 2023
185 Ga0495633_0058953 3300046558 Bacteria 1801
186 Ga0495656_0246423 3300046615 Bacteria 901
187 Ga0495656_0464320 3300046615 Bacteria 668
188 Ga0495668_0002499 3300046616 Bacteria 15037
189 Ga0495668_0004545 3300046616 Bacteria 9785
190 Ga0495668_0025090 3300046616 Bacteria 3389
191 Ga0495668_0333142 3300046616 Bacteria 832
192 Ga0495611_0005833 3300046648 Bacteria 5253
193 Ga0495611_0102940 3300046648 Bacteria 1327
194 Ga0495611_0150635 3300046648 Bacteria 1086
195 Ga0495611_0285045 3300046648 Bacteria 762
196 Ga0495625_0018661 3300046660 Bacteria 5406
197 Ga0495625_0236020 3300046660 Bacteria 1192
198 Ga0495659_0143118 3300046664 Bacteria 956
199 Ga0495661_0006298 3300046665 Bacteria 8344
200 Ga0495661_0012585 3300046665 Bacteria 5711
201 Ga0495661_0045441 3300046665 Bacteria 2686
202 Ga0495661_0068382 3300046665 Bacteria 2083
203 Ga0495661_0072462 3300046665 Bacteria 2009
204 Ga0495661_0343464 3300046665 Bacteria 736
205 Ga0495669_0078992 3300046684 Bacteria 1508
206 Ga0495669_0114821 3300046684 Bacteria 1259
207 Ga0495624_0129474 3300046690 Bacteria 1548
208 Ga0495624_0329559 3300046690 Bacteria 919
209 Ga0495670_0007420 3300046691 Bacteria 5383
210 Ga0495670_0024674 3300046691 Bacteria 2972
211 Ga0495670_0115130 3300046691 Bacteria 1394
212 Ga0495670_0120363 3300046691 Bacteria 1363
213 Ga0495671_0005738 3300046692 Bacteria 7236
214 Ga0495671_0008200 3300046692 Bacteria 5893
215 Ga0495671_0008548 3300046692 Bacteria 5752
216 Ga0495671_0012074 3300046692 Bacteria 4722
217 Ga0495649_0001802 3300046694 Bacteria 15737
218 Ga0495649_0330138 3300046694 Bacteria 773
219 Ga0495589_0027884 3300046794 Bacteria 2854
220 Ga0495589_0041272 3300046794 Bacteria 2302
221 Ga0495660_0071804 3300046810 Bacteria 1834
222 Ga0495660_0167805 3300046810 Bacteria 1071
223 Ga0495674_0072490 3300047319 Bacteria 2970
224 Ga0495672_0000026 3300047320 Bacteria 340319
225 Ga0495676_0082694 3300047321 Bacteria 2429
226 Ga0495683_0000174 3300047323 Bacteria 63168
227 Ga0495683_0018105 3300047323 Bacteria 3645
228 Ga0495683_0065779 3300047323 Bacteria 1787
229 Ga0495687_001379 3300047443 Bacteria 22465
230 Ga0495687_087633 3300047443 Bacteria 1201
231 Ga0495687_198366 3300047443 Bacteria 639
232 Ga0495677_0006302 3300047445 Bacteria 4482
233 Ga0495677_0095231 3300047445 Bacteria 1124
234 Ga0495681_0027754 3300047470 Bacteria 2924
235 Ga0495681_0033693 3300047470 Bacteria 2561
236 Ga0495681_0039424 3300047470 Bacteria 2306
237 Ga0495614_0063256 3300048089 Bacteria 1591
238 Ga0495626_0023012 3300048091 Bacteria 3072
239 Ga0496100_0000284 3300048903 Bacteria 25765
240 Ga0496101_0000598 3300048904 Bacteria 21991
241 Ga0496101_0081874 3300048904 Bacteria 2388
242 Ga0496102_0000252 3300048905 Bacteria 69917
243 Ga0496103_0000252 3300048906 Bacteria 51764
244 Ga0496103_0001767 3300048906 Bacteria 14103
245 Ga0496104_0044458 3300048907 Bacteria 4173
246 Ga0496104_0131138 3300048907 Bacteria 2407
247 Ga0496105_0043425 3300048908 Bacteria 3707
248 Ga0496105_0431296 3300048908 Bacteria 1042
249 Ga0496107_0240121 3300048910 Bacteria 1348
250 Ga0496112_0247227 3300048915 Bacteria 1735
251 Ga0496113_0028756 3300048916 Bacteria 4002
252 Ga0496117_0000716 3300048920 Bacteria 52460
253 Ga0496118_0000218 3300048921 Bacteria 100056
254 Ga0496119_0045455 3300048922 Bacteria 2752
255 Ga0496121_0005580 3300048924 Bacteria 16069
256 Ga0496121_0072080 3300048924 Bacteria 2774
257 Ga0496122_0278378 3300048925 Bacteria 916
258 Ga0496124_0008202 3300048927 Bacteria 10958
259 Ga0496124_0049537 3300048927 Bacteria 3583
260 Ga0501308_011144 3300049128 Bacteria 1009
261 Ga0501304_005458 3300049160 Bacteria 998
262 Ga0495682_0013086 3300049460 Bacteria 3163
263 Ga0501269_000009 3300049766 Bacteria 70455
264 Ga0495655_0010430 3300053083 Bacteria 1835
265 Ga0500586_000312 3300053145 Bacteria 9675
266 Ga0466962_0025288 3300061719 Bacteria 2851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0470264 Ga0495594_0470264_49_552 163
2 3300046459 Ga0495629_0296785 Ga0495629_0296785_224_802 168
3 3300046492 Ga0495585_0151374 Ga0495585_0151374_139_717 168
4 3300046499 Ga0495594_0030242 Ga0495594_0030242_927_1505 168
5 3300046526 Ga0495666_0023765 Ga0495666_0023765_1357_1935 168
6 3300046557 Ga0495622_0115496 Ga0495622_0115496_251_829 168
7 3300047321 Ga0495676_0082694 Ga0495676_0082694_667_1245 168
8 3300046690 Ga0495624_0329559 Ga0495624_0329559_133_711 171
9 3300048089 Ga0495614_0063256 Ga0495614_0063256_454_1032 171
10 3300046492 Ga0495585_0000435 Ga0495585_0000435_5013_5591 172
11 3300046535 Ga0495586_0448202 Ga0495586_0448202_101_676 172
12 3300046616 Ga0495668_0002499 Ga0495668_0002499_3969_4565 173
13 3300046524 Ga0495648_0189417 Ga0495648_0189417_193_771 176
14 3300046542 Ga0495597_0004574 Ga0495597_0004574_4613_5191 176
15 3300046692 Ga0495671_0005738 Ga0495671_0005738_3440_4015 176
16 3300047470 Ga0495681_0027754 Ga0495681_0027754_885_1463 176
17 3300003771 Ga0055526_1000043 Ga0055526_100004346 177
18 3300009036 Ga0105244_10000426 Ga0105244_1000042639 177
19 3300025295 Ga0209564_1000010 Ga0209564_1000010290 177
20 3300025728 Ga0207655_1000444 Ga0207655_100044431 177
21 3300046507 Ga0495606_0001477 Ga0495606_0001477_23029_23655 178
22 3300049766 Ga0501269_000009 Ga0501269_000009_49162_49782 178
23 3300046538 Ga0495609_0173903 Ga0495609_0173903_156_785 180
24 3300047470 Ga0495681_0033693 Ga0495681_0033693_1741_2328 180
25 3300048906 Ga0496103_0001767 Ga0496103_0001767_11583_12179 180
26 3300046512 Ga0495610_0167131 Ga0495610_0167131_138_743 181
27 iso_pu_bacteria 2738541280 2738738455 184
28 iso_pu_bacteria 2842711865 2842717059 185
29 3300046512 Ga0495610_0071618 Ga0495610_0071618_852_1442 186
30 3300046535 Ga0495586_0042311 Ga0495586_0042311_1774_2352 186
31 3300046557 Ga0495622_0033768 Ga0495622_0033768_359_937 186
32 iso_pu_bacteria 2643221603 2644025923 186
33 3300037471 Ga0395905_0139365 Ga0395905_0139365_614_1210 187
34 3300046455 Ga0495603_0282678 Ga0495603_0282678_276_869 187
35 3300048925 Ga0496122_0278378 Ga0496122_0278378_32_619 187
36 iso_pu_bacteria 2904424332 2904428097 187
37 3300028794 Ga0307515_10221330 Ga0307515_102213302 188
38 3300046460 Ga0495638_0444281 Ga0495638_0444281_73_651 188
39 3300046512 Ga0495610_0120037 Ga0495610_0120037_172_753 188
40 3300046542 Ga0495597_0014877 Ga0495597_0014877_3039_3656 188
41 3300046558 Ga0495633_0002720 Ga0495633_0002720_9194_9775 188
42 3300046694 Ga0495649_0001802 Ga0495649_0001802_8193_8774 188
43 3300046694 Ga0495649_0330138 Ga0495649_0330138_87_665 188
44 3300047320 Ga0495672_0000026 Ga0495672_0000026_291310_291888 188
45 3300053145 Ga0500586_000312 Ga0500586_000312_6767_7348 188
46 3300006353 Ga0075370_10322070 Ga0075370_103220702 189
47 3300046492 Ga0495585_0026680 Ga0495585_0026680_1531_2103 189
48 3300046506 Ga0495583_0028997 Ga0495583_0028997_1010_1582 189
49 3300046507 Ga0495606_0027829 Ga0495606_0027829_3381_3953 189
50 3300046507 Ga0495606_0029359 Ga0495606_0029359_3065_3637 189
51 3300046518 Ga0495631_0133309 Ga0495631_0133309_107_679 189
52 3300046528 Ga0495642_0019233 Ga0495642_0019233_1665_2237 189
53 3300046528 Ga0495642_0091163 Ga0495642_0091163_535_1107 189
54 3300046542 Ga0495597_0100477 Ga0495597_0100477_124_696 189
55 3300046558 Ga0495633_0047727 Ga0495633_0047727_1365_1937 189
56 3300046616 Ga0495668_0025090 Ga0495668_0025090_2181_2753 189
57 3300046648 Ga0495611_0150635 Ga0495611_0150635_104_676 189
58 3300046660 Ga0495625_0018661 Ga0495625_0018661_4286_4873 189
59 3300046665 Ga0495661_0006298 Ga0495661_0006298_2892_3464 189
60 3300046691 Ga0495670_0115130 Ga0495670_0115130_629_1201 189
61 3300046691 Ga0495670_0120363 Ga0495670_0120363_598_1170 189
62 3300046692 Ga0495671_0008200 Ga0495671_0008200_2510_3082 189
63 3300046692 Ga0495671_0008548 Ga0495671_0008548_386_958 189
64 3300047445 Ga0495677_0095231 Ga0495677_0095231_516_1088 189
65 3300021361 Ga0213872_10001778 Ga0213872_100017784 190
66 3300039447 Ga0436361_0762422 Ga0436361_0762422_1736_2311 190
67 3300041413 Ga0439465_0070109 Ga0439465_0070109_343_918 190
68 3300042006 Ga0439432_052455 Ga0439432_052455_654_1229 190
69 3300046492 Ga0495585_0003450 Ga0495585_0003450_1585_2160 190
70 3300046507 Ga0495606_0033535 Ga0495606_0033535_260_835 190
71 3300046519 Ga0495632_0012991 Ga0495632_0012991_1160_1735 190
72 3300046538 Ga0495609_0002532 Ga0495609_0002532_6238_6822 190
73 3300046558 Ga0495633_0001108 Ga0495633_0001108_3277_3852 190
74 3300046558 Ga0495633_0058953 Ga0495633_0058953_242_814 190
75 3300046648 Ga0495611_0102940 Ga0495611_0102940_316_891 190
76 3300046665 Ga0495661_0012585 Ga0495661_0012585_2167_2742 190
77 3300046691 Ga0495670_0007420 Ga0495670_0007420_3185_3760 190
78 3300047443 Ga0495687_087633 Ga0495687_087633_457_1086 190
79 3300003322 rootL2_10009010 rootL2_1000901011 191
80 3300005327 Ga0070658_11203267 Ga0070658_112032671 191
81 3300005547 Ga0070693_100664019 Ga0070693_1006640191 191
82 3300005564 Ga0070664_100036043 Ga0070664_1000360435 191
83 3300005564 Ga0070664_100090535 Ga0070664_1000905353 191
84 3300005564 Ga0070664_100561982 Ga0070664_1005619822 191
85 3300005614 Ga0068856_100008694 Ga0068856_1000086943 191
86 3300013307 Ga0157372_10390070 Ga0157372_103900703 191
87 3300025945 Ga0207679_10036835 Ga0207679_100368353 191
88 3300026078 Ga0207702_10434098 Ga0207702_104340982 191
89 3300037312 Ga0395899_0177851 Ga0395899_0177851_492_1070 191
90 3300037418 Ga0395900_0134841 Ga0395900_0134841_1782_2360 191
91 3300039447 Ga0436361_0507268 Ga0436361_0507268_283_864 191
92 3300042005 Ga0439448_0002465 Ga0439448_0002465_324_902 191
93 3300042007 Ga0439449_0035989 Ga0439449_0035989_680_1258 191
94 3300042012 Ga0439455_0002095 Ga0439455_0002095_1912_2490 191
95 3300044656 Ga0466969_0058508 Ga0466969_0058508_1191_1769 191
96 3300044683 Ga0466965_0000968 Ga0466965_0000968_9688_10266 191
97 3300044706 Ga0466964_0000220 Ga0466964_0000220_1598_2176 191
98 3300044735 Ga0466968_0000504 Ga0466968_0000504_1291_1869 191
99 3300044765 Ga0466970_0075270 Ga0466970_0075270_384_962 191
100 3300044842 Ga0466957_0084211 Ga0466957_0084211_968_1546 191
101 3300045836 Ga0466958_0449348 Ga0466958_0449348_159_737 191
102 3300045836 Ga0466958_0489321 Ga0466958_0489321_94_672 191
103 3300045976 Ga0466967_0056500 Ga0466967_0056500_398_976 191
104 3300046453 Ga0495627_008681 Ga0495627_008681_84_674 191
105 3300046457 Ga0495590_0025659 Ga0495590_0025659_396_974 191
106 3300046460 Ga0495638_0001311 Ga0495638_0001311_13198_13788 191
107 3300046474 Ga0495605_0056451 Ga0495605_0056451_738_1328 191
108 3300046491 Ga0495584_0001087 Ga0495584_0001087_12336_12929 191
109 3300046491 Ga0495584_0006887 Ga0495584_0006887_1340_1930 191
110 3300046491 Ga0495584_0007430 Ga0495584_0007430_3059_3637 191
111 3300046492 Ga0495585_0000462 Ga0495585_0000462_11534_12127 191
112 3300046492 Ga0495585_0015630 Ga0495585_0015630_3083_3673 191
113 3300046492 Ga0495585_0027544 Ga0495585_0027544_192_782 191
114 3300046501 Ga0495607_0006459 Ga0495607_0006459_6057_6635 191
115 3300046501 Ga0495607_0052383 Ga0495607_0052383_573_1163 191
116 3300046501 Ga0495607_0158684 Ga0495607_0158684_12_641 191
117 3300046506 Ga0495583_0137609 Ga0495583_0137609_135_725 191
118 3300046506 Ga0495583_0155622 Ga0495583_0155622_62_652 191
119 3300046506 Ga0495583_0198599 Ga0495583_0198599_119_709 191
120 3300046513 Ga0495616_0000253 Ga0495616_0000253_30841_31473 191
121 3300046513 Ga0495616_0036320 Ga0495616_0036320_1039_1668 191
122 3300046513 Ga0495616_0101257 Ga0495616_0101257_579_1172 191
123 3300046513 Ga0495616_0263708 Ga0495616_0263708_74_664 191
124 3300046518 Ga0495631_0004920 Ga0495631_0004920_2592_3182 191
125 3300046518 Ga0495631_0034404 Ga0495631_0034404_137_787 191
126 3300046518 Ga0495631_0041482 Ga0495631_0041482_1174_1764 191
127 3300046518 Ga0495631_0271160 Ga0495631_0271160_26_655 191
128 3300046519 Ga0495632_0022582 Ga0495632_0022582_1485_2075 191
129 3300046522 Ga0495643_0025812 Ga0495643_0025812_1125_1703 191
130 3300046523 Ga0495644_0033798 Ga0495644_0033798_176_766 191
131 3300046523 Ga0495644_0042226 Ga0495644_0042226_220_849 191
132 3300046524 Ga0495648_0001796 Ga0495648_0001796_18485_19063 191
133 3300046525 Ga0495663_0009423 Ga0495663_0009423_84_674 191
134 3300046528 Ga0495642_0000681 Ga0495642_0000681_10184_10834 191
135 3300046528 Ga0495642_0026654 Ga0495642_0026654_37_627 191
136 3300046538 Ga0495609_0016808 Ga0495609_0016808_1850_2443 191
137 3300046542 Ga0495597_0027370 Ga0495597_0027370_858_1436 191
138 3300046542 Ga0495597_0079056 Ga0495597_0079056_141_731 191
139 3300046558 Ga0495633_0011157 Ga0495633_0011157_950_1579 191
140 3300046615 Ga0495656_0246423 Ga0495656_0246423_35_664 191
141 3300046615 Ga0495656_0464320 Ga0495656_0464320_10_588 191
142 3300046616 Ga0495668_0004545 Ga0495668_0004545_1327_1917 191
143 3300046616 Ga0495668_0333142 Ga0495668_0333142_92_682 191
144 3300046648 Ga0495611_0005833 Ga0495611_0005833_17_607 191
145 3300046648 Ga0495611_0285045 Ga0495611_0285045_20_610 191
146 3300046660 Ga0495625_0236020 Ga0495625_0236020_141_731 191
147 3300046664 Ga0495659_0143118 Ga0495659_0143118_345_935 191
148 3300046665 Ga0495661_0045441 Ga0495661_0045441_1206_1835 191
149 3300046665 Ga0495661_0068382 Ga0495661_0068382_116_694 191
150 3300046665 Ga0495661_0072462 Ga0495661_0072462_264_854 191
151 3300046665 Ga0495661_0343464 Ga0495661_0343464_122_712 191
152 3300046684 Ga0495669_0114821 Ga0495669_0114821_26_655 191
153 3300046691 Ga0495670_0024674 Ga0495670_0024674_515_1144 191
154 3300046794 Ga0495589_0027884 Ga0495589_0027884_801_1391 191
155 3300046794 Ga0495589_0041272 Ga0495589_0041272_838_1428 191
156 3300046810 Ga0495660_0071804 Ga0495660_0071804_215_793 191
157 3300046810 Ga0495660_0167805 Ga0495660_0167805_253_843 191
158 3300047323 Ga0495683_0000174 Ga0495683_0000174_27322_27915 191
159 3300047323 Ga0495683_0065779 Ga0495683_0065779_1039_1629 191
160 3300047443 Ga0495687_001379 Ga0495687_001379_10428_11099 191
161 3300047445 Ga0495677_0006302 Ga0495677_0006302_1389_1979 191
162 3300047470 Ga0495681_0039424 Ga0495681_0039424_19_609 191
163 3300048091 Ga0495626_0023012 Ga0495626_0023012_2038_2628 191
164 3300048927 Ga0496124_0008202 Ga0496124_0008202_51_641 191
165 3300049128 Ga0501308_011144 Ga0501308_011144_420_998 191
166 3300049160 Ga0501304_005458 Ga0501304_005458_18_596 191
167 3300049460 Ga0495682_0013086 Ga0495682_0013086_726_1316 191
168 3300003792 Ga0055540_1006823 Ga0055540_10068232 192
169 3300003794 Ga0055531_10000618 Ga0055531_100006188 192
170 3300005262 Ga0065165_1022496 Ga0065165_10224964 192
171 3300005356 Ga0070674_100500815 Ga0070674_1005008151 192
172 3300005563 Ga0068855_100013105 Ga0068855_1000131051 192
173 3300005616 Ga0068852_100082772 Ga0068852_1000827724 192
174 3300006038 Ga0075365_10337731 Ga0075365_103377312 192
175 3300009174 Ga0105241_10005831 Ga0105241_100058319 192
176 3300025303 Ga0209051_1000110 Ga0209051_100011081 192
177 3300025304 Ga0209257_1000012 Ga0209257_1000012920 192
178 3300025304 Ga0209257_1000045 Ga0209257_1000045326 192
179 3300025909 Ga0207705_10055584 Ga0207705_100555844 192
180 3300025911 Ga0207654_10005027 Ga0207654_100050274 192
181 3300025937 Ga0207669_10468784 Ga0207669_104687841 192
182 3300025949 Ga0207667_10046752 Ga0207667_100467525 192
183 3300026142 Ga0207698_10134907 Ga0207698_101349073 192
184 3300032004 Ga0307414_10519244 Ga0307414_105192441 192
185 3300037312 Ga0395899_0328649 Ga0395899_0328649_108_689 192
186 3300037418 Ga0395900_0019654 Ga0395900_0019654_1863_2456 192
187 3300037466 Ga0395898_0057298 Ga0395898_0057298_739_1332 192
188 3300037471 Ga0395905_0003363 Ga0395905_0003363_10760_11341 192
189 3300037471 Ga0395905_0031650 Ga0395905_0031650_1353_1934 192
190 3300038443 Ga0395901_0377547 Ga0395901_0377547_556_1149 192
191 3300044683 Ga0466965_0011476 Ga0466965_0011476_1682_2395 192
192 3300044706 Ga0466964_0005978 Ga0466964_0005978_1370_2083 192
193 3300044706 Ga0466964_0038141 Ga0466964_0038141_969_1562 192
194 3300046516 Ga0495628_0402181 Ga0495628_0402181_319_912 192
195 3300046533 Ga0495640_0356819 Ga0495640_0356819_265_882 192
196 3300048927 Ga0496124_0049537 Ga0496124_0049537_730_1386 192
197 3300042127 Ga0450890_031369 Ga0450890_031369_37_621 193
198 3300045051 Ga0451576_0368903 Ga0451576_0368903_284_877 193
199 3300053083 Ga0495655_0010430 Ga0495655_0010430_76_660 193
200 iso_pu_bacteria 2643221570 2643865537 193
201 3300021361 Ga0213872_10038307 Ga0213872_100383072 194
202 3300039447 Ga0436361_0568335 Ga0436361_0568335_10136_10726 194
203 3300044658 Ga0466972_0000018 Ga0466972_0000018_105341_106060 194
204 3300044706 Ga0466964_0180408 Ga0466964_0180408_100_735 194
205 iso_pu_bacteria 2513237166 2514049788 194
206 iso_pu_bacteria 2562617112 2563057221 194
207 iso_pu_bacteria 2711768613 2713480907 194
208 iso_pu_bacteria 2791355137 2792839038 194
209 iso_pu_bacteria 2904615490 2904620760 194
210 iso_pu_bacteria 2921643360 2921650252 194
211 iso_pu_bacteria 642555112 642598273 194
212 3300025925 Ga0207650_10931785 Ga0207650_109317851 195
213 3300026089 Ga0207648_10727001 Ga0207648_107270012 195
214 3300031901 Ga0307406_10000848 Ga0307406_100008489 195
215 3300037418 Ga0395900_0000947 Ga0395900_0000947_34448_35053 195
216 3300037466 Ga0395898_0001680 Ga0395898_0001680_1748_2353 195
217 3300044684 Ga0466966_0021258 Ga0466966_0021258_2241_2834 195
218 3300044693 Ga0466961_0014799 Ga0466961_0014799_3245_3838 195
219 3300044719 Ga0466971_0013616 Ga0466971_0013616_504_1097 195
220 3300044842 Ga0466957_0158974 Ga0466957_0158974_764_1357 195
221 3300045049 Ga0466959_0009829 Ga0466959_0009829_4024_4617 195
222 3300061719 Ga0466962_0025288 Ga0466962_0025288_2025_2618 195
223 3300005367 Ga0070667_101190230 Ga0070667_1011902301 196
224 3300005616 Ga0068852_100349733 Ga0068852_1003497332 196
225 3300009148 Ga0105243_10040548 Ga0105243_100405482 196
226 3300009177 Ga0105248_10500869 Ga0105248_105008691 196
227 3300025935 Ga0207709_10223341 Ga0207709_102233412 196
228 3300025945 Ga0207679_10334766 Ga0207679_103347662 196
229 3300026089 Ga0207648_10052279 Ga0207648_100522794 196
230 3300026142 Ga0207698_11144745 Ga0207698_111447451 196
231 3300028380 Ga0268265_10122906 Ga0268265_101229063 196
232 3300044656 Ga0466969_0074906 Ga0466969_0074906_455_1081 196
233 3300044666 Ga0466977_0000184 Ga0466977_0000184_308_934 196
234 3300003316 rootH1_10173875 rootH1_101738752 198
235 3300003320 rootH2_10147461 rootH2_101474612 198
236 3300003322 rootL2_10017691 rootL2_100176912 198
237 3300003322 rootL2_10068879 rootL2_100688792 198
238 3300003323 rootH1_10225029 rootH1_102250293 198
239 3300003354 JGI25160J50197_1000083 JGI25160J50197_100008347 198
240 3300005262 Ga0065165_1000445 Ga0065165_100044530 198
241 3300005455 Ga0070663_100446309 Ga0070663_1004463091 198
242 3300009011 Ga0105251_10038737 Ga0105251_100387371 198
243 3300025284 Ga0209130_1008028 Ga0209130_10080283 198
244 3300025295 Ga0209564_1007497 Ga0209564_10074972 198
245 3300025302 Ga0207426_1000004 Ga0207426_1000004193 198
246 3300039447 Ga0436361_0965909 Ga0436361_0965909_207_803 198
247 3300046455 Ga0495603_0000805 Ga0495603_0000805_16758_17354 198
248 3300046457 Ga0495590_0103324 Ga0495590_0103324_54_650 198
249 3300046472 Ga0495580_0000147 Ga0495580_0000147_30613_31209 198
250 3300046474 Ga0495605_0062123 Ga0495605_0062123_784_1380 198
251 3300046506 Ga0495583_0004664 Ga0495583_0004664_8056_8652 198
252 3300046524 Ga0495648_0123224 Ga0495648_0123224_400_996 198
253 3300046531 Ga0495665_0149278 Ga0495665_0149278_462_1058 198
254 3300046542 Ga0495597_0041733 Ga0495597_0041733_882_1478 198
255 3300046557 Ga0495622_0010901 Ga0495622_0010901_2847_3443 198
256 3300046684 Ga0495669_0078992 Ga0495669_0078992_504_1100 198
257 3300046690 Ga0495624_0129474 Ga0495624_0129474_390_986 198
258 3300046692 Ga0495671_0012074 Ga0495671_0012074_4035_4631 198
259 3300047319 Ga0495674_0072490 Ga0495674_0072490_776_1372 198
260 3300047323 Ga0495683_0018105 Ga0495683_0018105_1655_2251 198
261 3300047443 Ga0495687_198366 Ga0495687_198366_16_612 198
262 3300048903 Ga0496100_0000284 Ga0496100_0000284_23811_24407 198
263 3300048904 Ga0496101_0000598 Ga0496101_0000598_4591_5187 198
264 3300048904 Ga0496101_0081874 Ga0496101_0081874_957_1553 198
265 3300048905 Ga0496102_0000252 Ga0496102_0000252_15361_15957 198
266 3300048906 Ga0496103_0000252 Ga0496103_0000252_1332_1928 198
267 3300048907 Ga0496104_0044458 Ga0496104_0044458_805_1401 198
268 3300048907 Ga0496104_0131138 Ga0496104_0131138_869_1465 198
269 3300048908 Ga0496105_0043425 Ga0496105_0043425_2135_2731 198
270 3300048908 Ga0496105_0431296 Ga0496105_0431296_142_738 198
271 3300048910 Ga0496107_0240121 Ga0496107_0240121_637_1233 198
272 3300048915 Ga0496112_0247227 Ga0496112_0247227_262_858 198
273 3300048916 Ga0496113_0028756 Ga0496113_0028756_971_1567 198
274 3300048920 Ga0496117_0000716 Ga0496117_0000716_41725_42321 198
275 3300048921 Ga0496118_0000218 Ga0496118_0000218_45608_46204 198
276 3300048922 Ga0496119_0045455 Ga0496119_0045455_1999_2595 198
277 3300048924 Ga0496121_0005580 Ga0496121_0005580_1439_2035 198
278 3300048924 Ga0496121_0072080 Ga0496121_0072080_1377_1973 198

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rkb-assembly1.cif.gz_A crystal structure of putative pterin binding protein (prur) from klebsiella pneumoniae in complex with neopterin 0.911 33 195
7kom-assembly1.cif.gz_A high resolution crystal structure of putative pterin binding protein prur (vv2_1280) from vibrio vulnificus cmcp6 0.8893 70 195
7kou-assembly4.cif.gz_D 1.83 angstroms resolution crystal structure of putative pterin binding protein prur (atu3496) from agrobacterium fabrum str. c58 0.8803 33 194
7rkb-assembly1.cif.gz_A crystal structure of putative pterin binding protein (prur) from klebsiella pneumoniae in complex with neopterin 0.8638 33 195
7kp2-assembly1.cif.gz_A high resolution crystal structure of putative pterin binding protein (prur) from vibrio cholerae o1 biovar el tor str. n16961 in complex with neopterin 0.8429 35 198
ID Description Score Start End Superfamily
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7604 38 198 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7132 38 198 3.90.420.10
4pw9A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7071 70 198 3.90.420.10
af_A0A0R4IKF7_192_441_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7022 69 198 3.90.420.10
af_Q2G1Y7_1_160_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.6848 96 195 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A8A8VF18-F1-model_v4 deleted 0.9889 38 195
AF-A0A4Q3K5B9-F1-model_v4 deleted 0.9773 52 197
AF-A0A5C9CCR1-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9771 75 198
AF-A0A4Q3K5B9-F1-model_v4 deleted 0.9708 52 197
AF-A0A5C9CCR1-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9694 75 198

Feature Viewer

pLDDT pTM Quality
85.75 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map