F382505

General Info

Members Datasets Scaffolds Average Seq Length
278 203 278 234

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0001392|Ga0316574_0001392_5298_6116
Length 272
Sequence LAINIGAAMRIRGALKFDDLPAILTERLRTMAGHSKWANIQHRKGRQDAKRGKIFTKLIKEITIAARLGGGDASTNPRLRLAIDKARDQNMPNDNIQRAIQRGTGELDGVSYEEIRYEGYGVGGAAVIVDCTTDNRTRCVAEVRHAFTKNGGNLGSDGSVAYQFKHCGQFIFAPGTSEDRVMEVGLEAGAEDVTTDEDGSIEVVCAPGDFSALRDAFAKGGLKPEIAEITMKASTESVLQGEDAMRMRRLLDALEELDDVQDVYTNAALETD

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
141 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.92
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10131581 3300005295 Bacteria 1911
2 Ga0070690_100003552 3300005330 Bacteria 8550
3 Ga0068869_100004021 3300005334 Bacteria 9097
4 Ga0070666_10159553 3300005335 Bacteria 1576
5 Ga0070680_100013530 3300005336 Bacteria 6357
6 Ga0070680_100105572 3300005336 Bacteria 2341
7 Ga0070682_100006656 3300005337 Bacteria 6479
8 Ga0068868_100020871 3300005338 Bacteria 4930
9 Ga0070689_100003236 3300005340 Bacteria 10797
10 Ga0070689_100118497 3300005340 Bacteria 2112
11 Ga0070691_10000625 3300005341 Bacteria 13618
12 Ga0070687_100000952 3300005343 Bacteria 9835
13 Ga0070661_100043949 3300005344 Bacteria 3263
14 Ga0070661_100177689 3300005344 Bacteria 1619
15 Ga0070692_10000171 3300005345 Bacteria 16686
16 Ga0070669_100186092 3300005353 Bacteria 1627
17 Ga0070669_100598143 3300005353 Bacteria 924
18 Ga0070673_100074354 3300005364 Bacteria 2738
19 Ga0070713_100074332 3300005436 Bacteria 2879
20 Ga0070701_10002853 3300005438 Bacteria 6736
21 Ga0070705_100001385 3300005440 Bacteria 12885
22 Ga0070705_100138903 3300005440 Bacteria 1596
23 Ga0070700_100004484 3300005441 Bacteria 7297
24 Ga0070694_100003309 3300005444 Bacteria 9641
25 Ga0070694_100080997 3300005444 Bacteria 2257
26 Ga0070694_100380539 3300005444 Bacteria 1100
27 Ga0070678_100023449 3300005456 Bacteria 4113
28 Ga0068867_100003994 3300005459 Bacteria 10375
29 Ga0070698_100018504 3300005471 Bacteria 7335
30 Ga0070679_100020633 3300005530 Bacteria 6426
31 Ga0070679_100181840 3300005530 Bacteria 2075
32 Ga0070697_100203842 3300005536 Bacteria 1681
33 Ga0068853_100019035 3300005539 Bacteria 5688
34 Ga0068853_100096021 3300005539 Bacteria 2615
35 Ga0070686_100003129 3300005544 Bacteria 9062
36 Ga0070686_100177117 3300005544 Bacteria 1512
37 Ga0070686_100275539 3300005544 Bacteria 1238
38 Ga0070695_100000140 3300005545 Bacteria 33449
39 Ga0070695_100226718 3300005545 Bacteria 1349
40 Ga0070696_100000008 3300005546 Bacteria 101365
41 Ga0070693_100000154 3300005547 Bacteria 31511
42 Ga0070704_100000956 3300005549 Bacteria 14644
43 Ga0070704_100004775 3300005549 Bacteria 7845
44 Ga0070704_100149941 3300005549 Bacteria 1832
45 Ga0070704_100181550 3300005549 Bacteria 1684
46 Ga0068855_100015523 3300005563 Bacteria 9170
47 Ga0068855_100055072 3300005563 Bacteria 4672
48 Ga0070664_100122628 3300005564 Bacteria 2277
49 Ga0068854_100380559 3300005578 Bacteria 1163
50 Ga0068856_100004633 3300005614 Bacteria 13658
51 Ga0068856_100015177 3300005614 Bacteria 7441
52 Ga0068856_100072473 3300005614 Bacteria 3410
53 Ga0070702_100000421 3300005615 Bacteria 15080
54 Ga0070702_100165710 3300005615 Bacteria 1433
55 Ga0068852_100014630 3300005616 Bacteria 6050
56 Ga0068852_100129271 3300005616 Bacteria 2324
57 Ga0068859_100002186 3300005617 Bacteria 19854
58 Ga0068859_100922168 3300005617 Bacteria 958
59 Ga0068866_10002041 3300005718 Bacteria 8407
60 Ga0068861_100006714 3300005719 Bacteria 7860
61 Ga0068863_100158087 3300005841 Bacteria 2170
62 Ga0068858_100012318 3300005842 Bacteria 8063
63 Ga0068860_100009594 3300005843 Bacteria 9618
64 Ga0068862_100006076 3300005844 Bacteria 10053
65 Ga0081539_10032688 3300005985 Bacteria 3182
66 Ga0097621_100003516 3300006237 Bacteria 10822
67 Ga0068871_100000152 3300006358 Bacteria 45602
68 Ga0075428_100000202 3300006844 Bacteria 56911
69 Ga0075428_100209494 3300006844 Bacteria 2106
70 Ga0075430_100081967 3300006846 Bacteria 2703
71 Ga0075434_100029724 3300006871 Bacteria 5378
72 Ga0075429_100000184 3300006880 Bacteria 40869
73 Ga0075429_100004272 3300006880 Bacteria 12256
74 Ga0068865_100005212 3300006881 Bacteria 7860
75 Ga0097620_100002187 3300006931 Bacteria 19854
76 Ga0097620_100922228 3300006931 Bacteria 958
77 Ga0099794_10117441 3300007265 Bacteria 1336
78 Ga0105240_10381551 3300009093 Bacteria 1592
79 Ga0111539_10711994 3300009094 Bacteria 1169
80 Ga0105245_10007290 3300009098 Bacteria 9683
81 Ga0114129_10000677 3300009147 Bacteria 42898
82 Ga0114129_10090138 3300009147 Bacteria 4251
83 Ga0114129_10817431 3300009147 Bacteria 1187
84 Ga0105243_10007189 3300009148 Bacteria 8557
85 Ga0105241_10013561 3300009174 Bacteria 5973
86 Ga0105241_10392785 3300009174 Bacteria 1215
87 Ga0105242_10004711 3300009176 Bacteria 10560
88 Ga0105242_10497355 3300009176 Bacteria 1159
89 Ga0105248_10765610 3300009177 Bacteria 1089
90 Ga0105238_10017575 3300009551 Bacteria 7271
91 Ga0105249_10005527 3300009553 Bacteria 10917
92 Ga0105239_10015553 3300010375 Bacteria 8427
93 Ga0105239_10046921 3300010375 Bacteria 4733
94 Ga0105246_10115080 3300011119 Bacteria 1983
95 Ga0157345_1007163 3300012498 Bacteria 905
96 Ga0157369_10019210 3300013105 Bacteria 7647
97 Ga0157369_10744697 3300013105 Bacteria 1008
98 Ga0157378_10007547 3300013297 Bacteria 9496
99 Ga0157372_10014221 3300013307 Bacteria 8505
100 Ga0157372_10149645 3300013307 Bacteria 2694
101 Ga0157372_10237316 3300013307 Bacteria 2115
102 Ga0157375_10181088 3300013308 Bacteria 2258
103 Ga0157379_10282335 3300014968 Unclassified 1511
104 Ga0157376_10055681 3300014969 Bacteria 3301
105 Ga0207642_10002187 3300025899 Bacteria 6062
106 Ga0207688_10038449 3300025901 Bacteria 2656
107 Ga0207645_10025549 3300025907 Bacteria 3821
108 Ga0207643_10049140 3300025908 Bacteria 2390
109 Ga0207705_10052358 3300025909 Bacteria 2939
110 Ga0207654_10158791 3300025911 Bacteria 1459
111 Ga0207707_10003609 3300025912 Bacteria 13717
112 Ga0207660_10010473 3300025917 Bacteria 6020
113 Ga0207662_10001772 3300025918 Bacteria 10599
114 Ga0207662_10126964 3300025918 Bacteria 1604
115 Ga0207649_10079572 3300025920 Bacteria 2118
116 Ga0207649_10112478 3300025920 Bacteria 1822
117 Ga0207652_10003546 3300025921 Bacteria 12882
118 Ga0207652_10174850 3300025921 Bacteria 1928
119 Ga0207659_10539977 3300025926 Bacteria 990
120 Ga0207687_10001190 3300025927 Bacteria 17765
121 Ga0207664_10176265 3300025929 Bacteria 1833
122 Ga0207686_10000246 3300025934 Bacteria 41384
123 Ga0207709_10003128 3300025935 Bacteria 9955
124 Ga0207670_10000747 3300025936 Bacteria 17073
125 Ga0207670_10436664 3300025936 Bacteria 1053
126 Ga0207704_10001629 3300025938 Bacteria 10062
127 Ga0207704_10298442 3300025938 Bacteria 1233
128 Ga0207711_10092090 3300025941 Bacteria 2667
129 Ga0207689_10007929 3300025942 Bacteria 9275
130 Ga0207667_10010577 3300025949 Bacteria 10777
131 Ga0207667_10092435 3300025949 Bacteria 3124
132 Ga0207667_10095649 3300025949 Bacteria 3066
133 Ga0207667_10210419 3300025949 Bacteria 1993
134 Ga0207712_10001322 3300025961 Bacteria 16967
135 Ga0207640_10169618 3300025981 Bacteria 1625
136 Ga0207677_10008880 3300026023 Bacteria 5634
137 Ga0207703_10008914 3300026035 Bacteria 7901
138 Ga0207639_10130909 3300026041 Bacteria 2077
139 Ga0207639_10376553 3300026041 Bacteria 1274
140 Ga0207708_10000601 3300026075 Bacteria 27771
141 Ga0207702_10007845 3300026078 Bacteria 9055
142 Ga0207702_10018247 3300026078 Bacteria 5804
143 Ga0207702_10084040 3300026078 Bacteria 2770
144 Ga0207648_10002542 3300026089 Bacteria 19564
145 Ga0207674_10042924 3300026116 Bacteria 4666
146 Ga0207675_100009511 3300026118 Bacteria 9094
147 Ga0207683_10075461 3300026121 Bacteria 2984
148 Ga0207698_10099905 3300026142 Bacteria 2401
149 Ga0207698_10122875 3300026142 Bacteria 2201
150 Ga0207698_10134858 3300026142 Bacteria 2117
151 Ga0209996_1013635 3300027395 Bacteria 1099
152 Ga0209588_1022154 3300027671 Bacteria 1999
153 Ga0207428_10000453 3300027907 Bacteria 49756
154 Ga0268265_10005081 3300028380 Bacteria 9021
155 Ga0268265_11050006 3300028380 Bacteria 807
156 Ga0268264_10009530 3300028381 Bacteria 8044
157 Ga0307508_10372057 3300031616 Bacteria 1020
158 Ga0316575_10002726 3300031665 Bacteria 5961
159 Ga0316575_10037945 3300031665 Bacteria 1899
160 Ga0316576_10006856 3300031727 Bacteria 7120
161 Ga0316576_10078293 3300031727 Bacteria 2450
162 Ga0373930_0016484 3300034816 Bacteria 1398
163 Ga0373950_0006866 3300034818 Bacteria 1751
164 Ga0373928_0002911 3300035084 Bacteria 3302
165 Ga0373928_0039024 3300035084 Bacteria 1083
166 Ga0373949_0006258 3300035090 Bacteria 2627
167 Ga0373936_0047270 3300035113 Bacteria 1735
168 Ga0373941_0006951 3300035115 Bacteria 2748
169 Ga0373953_0062634 3300035117 Bacteria 1523
170 Ga0373954_0000014 3300035118 Bacteria 71012
171 Ga0373955_0346939 3300035172 Bacteria 899
172 Ga0373962_0012010 3300035242 Bacteria 2177
173 Ga0316574_0001392 3300035398 Bacteria 11427
174 Ga0316574_0001987 3300035398 Bacteria 10049
175 Ga0373924_0022995 3300035410 Bacteria 2440
176 Ga0373931_0005178 3300035691 Bacteria 6012
177 Ga0373931_0042287 3300035691 Bacteria 2396
178 Ga0373935_0007820 3300035692 Bacteria 6410
179 Ga0373935_0030000 3300035692 Bacteria 3367
180 Ga0373927_0017581 3300035695 Bacteria 4705
181 Ga0373933_0002300 3300035724 Bacteria 10867
182 Ga0373933_0070383 3300035724 Bacteria 2128
183 Ga0373947_0266850 3300035725 Bacteria 1135
184 Ga0373937_0000218 3300036401 Bacteria 55605
185 Ga0373937_0049232 3300036401 Bacteria 3859
186 Ga0373937_0080227 3300036401 Bacteria 3017
187 Ga0373937_0227231 3300036401 Bacteria 1757
188 Ga0373937_0601795 3300036401 Bacteria 1043
189 Ga0316584_0128672 3300036712 Bacteria 1891
190 Ga0316584_0333567 3300036712 Bacteria 1092
191 Ga0373925_0010477 3300037068 Bacteria 6723
192 Ga0395900_0452987 3300037418 Bacteria 1239
193 Ga0395898_0324866 3300037466 Bacteria 1468
194 Ga0395905_0009395 3300037471 Bacteria 9561
195 Ga0395901_0162259 3300038443 Bacteria 2347
196 Ga0400487_04715 3300039110 Bacteria 43923
197 Ga0439461_0041784 3300041410 Bacteria 993
198 Ga0439441_000050 3300042001 Bacteria 8751
199 Ga0439451_033631 3300042009 Bacteria 1031
200 Ga0439434_0051526 3300042435 Bacteria 1276
201 Ga0439435_0000239 3300042436 Bacteria 7877
202 Ga0439435_0000340 3300042436 Bacteria 7077
203 Ga0439444_0002357 3300042437 Bacteria 2576
204 Ga0439460_0014124 3300042461 Bacteria 2096
205 Ga0450893_0013893 3300042532 Bacteria 1346
206 Ga0451577_0202923 3300042876 Bacteria 1790
207 Ga0451577_0257951 3300042876 Bacteria 1578
208 Ga0466972_0002152 3300044658 Bacteria 9677
209 Ga0466966_0044714 3300044684 Bacteria 2834
210 Ga0466963_0089250 3300044694 Bacteria 2097
211 Ga0453684_0052853 3300044712 Bacteria 5308
212 Ga0453684_0079997 3300044712 Bacteria 4083
213 Ga0466957_0009472 3300044842 Bacteria 5561
214 Ga0466959_0238683 3300045049 Bacteria 1256
215 Ga0451576_0177512 3300045051 Bacteria 2224
216 Ga0451576_0533263 3300045051 Bacteria 1233
217 Ga0466958_0018967 3300045836 Bacteria 3999
218 Ga0495592_0007798 3300046454 Bacteria 8021
219 Ga0495592_0185258 3300046454 Bacteria 1415
220 Ga0495592_0223410 3300046454 Bacteria 1258
221 Ga0495629_0168474 3300046459 Bacteria 1521
222 Ga0495651_0132892 3300046462 Bacteria 1815
223 Ga0495580_0088975 3300046472 Bacteria 2150
224 Ga0495662_0005722 3300046476 Bacteria 6216
225 Ga0495662_0075257 3300046476 Bacteria 1638
226 Ga0495628_0005080 3300046516 Bacteria 11566
227 Ga0495628_0049048 3300046516 Bacteria 3344
228 Ga0495652_0324884 3300046529 Bacteria 1110
229 Ga0495640_0030961 3300046533 Bacteria 3825
230 Ga0495634_0022994 3300046642 Bacteria 4388
231 Ga0495635_0100811 3300046663 Bacteria 1974
232 Ga0495659_0020683 3300046664 Bacteria 2213
233 Ga0495659_0020909 3300046664 Bacteria 2202
234 Ga0495669_0003720 3300046684 Bacteria 6275
235 Ga0495613_0175836 3300046689 Bacteria 1517
236 Ga0495624_0151061 3300046690 Bacteria 1421
237 Ga0495581_0244689 3300047315 Bacteria 1049
238 Ga0495604_0048208 3300047317 Bacteria 3314
239 Ga0495636_0052650 3300047318 Bacteria 1708
240 Ga0495680_0011731 3300047322 Bacteria 7740
241 Ga0495593_0121089 3300047673 Bacteria 1332
242 Ga0495602_0277959 3300048088 Bacteria 1235
243 Ga0496117_0000088 3300048920 Bacteria 211093
244 Ga0501033_0375548 3300049570 Bacteria 994
245 Ga0501037_0220706 3300049573 Bacteria 1334
246 Ga0501038_0161591 3300049574 Bacteria 1820
247 Ga0501038_0172167 3300049574 Bacteria 1752
248 Ga0501038_0361278 3300049574 Bacteria 1129
249 Ga0501039_0355058 3300049575 Bacteria 1152
250 Ga0501040_0108584 3300049576 Bacteria 1940
251 Ga0501040_0275242 3300049576 Bacteria 1202
252 Ga0501042_0402177 3300049578 Bacteria 992
253 Ga0501043_0583144 3300049579 Bacteria 828
254 Ga0501047_0381591 3300049581 Bacteria 1244
255 Ga0501071_0211726 3300049587 Bacteria 1457
256 Ga0501072_0098416 3300049588 Bacteria 2325
257 Ga0501075_0081082 3300049591 Bacteria 2456
258 Ga0501075_0238456 3300049591 Bacteria 1386
259 Ga0501230_004093 3300049667 Bacteria 1981
260 Ga0501079_0336967 3300049741 Bacteria 1181
261 Ga0501080_0355542 3300049742 Bacteria 1322
262 Ga0501081_0400614 3300049743 Bacteria 1016
263 Ga0501045_0098593 3300049824 Bacteria 2162
264 Ga0501045_0247785 3300049824 Bacteria 1326
265 Ga0501045_0309078 3300049824 Bacteria 1176
266 nmdc:mga05p37_39402_c1 3300050507 Bacteria 5802
267 nmdc:mga09592_13045_c1 3300050508 Bacteria 6783
268 nmdc:mga0qj67_28305_c1 3300050509 Bacteria 4350
269 nmdc:mga0qj67_94263_c1 3300050509 Bacteria 2408
270 nmdc:mga06r32_431911_c1 3300050510 Bacteria 1298
271 nmdc:mga0n895_5601_c1 3300050512 Bacteria 10515
272 nmdc:mga0rr50_374822_c1 3300050513 Bacteria 1199
273 nmdc:mga0a205_485376_c1 3300050515 Bacteria 1093
274 Ga0495601_0166595 3300053077 Bacteria 1440
275 Ga0501084_0338395 3300054114 Bacteria 1271
276 Ga0501082_0245144 3300060353 Bacteria 1559
277 Ga0530510_0237829 3300061734 Bacteria 1355
278 Ga0530510_0303010 3300061734 Bacteria 1196

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0168474 Ga0495629_0168474_50_796 211
2 3300005985 Ga0081539_10032688 Ga0081539_100326882 212
3 3300005539 Ga0068853_100019035 Ga0068853_1000190353 216
4 3300026041 Ga0207639_10130909 Ga0207639_101309093 216
5 3300026142 Ga0207698_10122875 Ga0207698_101228753 216
6 3300035398 Ga0316574_0001987 Ga0316574_0001987_6468_7211 216
7 3300036712 Ga0316584_0333567 Ga0316584_0333567_169_915 216
8 3300031727 Ga0316576_10078293 Ga0316576_100782933 217
9 3300036712 Ga0316584_0128672 Ga0316584_0128672_998_1741 217
10 3300035691 Ga0373931_0042287 Ga0373931_0042287_1132_1851 218
11 3300042001 Ga0439441_000050 Ga0439441_000050_2768_3490 218
12 3300042436 Ga0439435_0000239 Ga0439435_0000239_4559_5281 218
13 3300042437 Ga0439444_0002357 Ga0439444_0002357_1824_2546 218
14 3300042461 Ga0439460_0014124 Ga0439460_0014124_221_943 218
15 3300046454 Ga0495592_0223410 Ga0495592_0223410_378_1097 218
16 3300049576 Ga0501040_0275242 Ga0501040_0275242_113_835 218
17 3300061734 Ga0530510_0303010 Ga0530510_0303010_457_1179 218
18 3300005615 Ga0070702_100165710 Ga0070702_1001657102 219
19 3300009176 Ga0105242_10497355 Ga0105242_104973552 219
20 3300009551 Ga0105238_10017575 Ga0105238_100175753 219
21 3300010375 Ga0105239_10046921 Ga0105239_100469212 219
22 3300025936 Ga0207670_10436664 Ga0207670_104366642 219
23 3300044658 Ga0466972_0002152 Ga0466972_0002152_4107_4820 219
24 3300042876 Ga0451577_0257951 Ga0451577_0257951_604_1329 220
25 3300045051 Ga0451576_0177512 Ga0451576_0177512_322_1047 220
26 3300049570 Ga0501033_0375548 Ga0501033_0375548_147_872 220
27 3300049573 Ga0501037_0220706 Ga0501037_0220706_152_877 220
28 3300049574 Ga0501038_0172167 Ga0501038_0172167_661_1386 220
29 3300049581 Ga0501047_0381591 Ga0501047_0381591_239_964 220
30 3300005614 Ga0068856_100004633 Ga0068856_1000046332 221
31 3300026078 Ga0207702_10007845 Ga0207702_100078457 221
32 3300028380 Ga0268265_11050006 Ga0268265_110500061 222
33 3300031665 Ga0316575_10037945 Ga0316575_100379452 222
34 3300042435 Ga0439434_0051526 Ga0439434_0051526_535_1260 222
35 3300048920 Ga0496117_0000088 Ga0496117_0000088_21060_21803 222
36 3300049743 Ga0501081_0400614 Ga0501081_0400614_228_959 223
37 3300009093 Ga0105240_10381551 Ga0105240_103815511 224
38 3300025949 Ga0207667_10095649 Ga0207667_100956494 224
39 3300037418 Ga0395900_0452987 Ga0395900_0452987_484_1206 224
40 3300037466 Ga0395898_0324866 Ga0395898_0324866_26_748 224
41 3300037471 Ga0395905_0009395 Ga0395905_0009395_3197_3919 224
42 3300038443 Ga0395901_0162259 Ga0395901_0162259_903_1625 224
43 3300042009 Ga0439451_033631 Ga0439451_033631_235_978 224
44 3300025938 Ga0207704_10298442 Ga0207704_102984422 225
45 3300044684 Ga0466966_0044714 Ga0466966_0044714_1622_2344 225
46 3300044712 Ga0453684_0079997 Ga0453684_0079997_724_1449 225
47 3300044842 Ga0466957_0009472 Ga0466957_0009472_1970_2692 225
48 3300045049 Ga0466959_0238683 Ga0466959_0238683_219_941 225
49 3300045836 Ga0466958_0018967 Ga0466958_0018967_1817_2539 225
50 3300005344 Ga0070661_100043949 Ga0070661_1000439494 226
51 3300005344 Ga0070661_100177689 Ga0070661_1001776892 226
52 3300005471 Ga0070698_100018504 Ga0070698_1000185046 226
53 3300005530 Ga0070679_100181840 Ga0070679_1001818402 226
54 3300005539 Ga0068853_100096021 Ga0068853_1000960212 226
55 3300005563 Ga0068855_100055072 Ga0068855_1000550724 226
56 3300005564 Ga0070664_100122628 Ga0070664_1001226282 226
57 3300005614 Ga0068856_100072473 Ga0068856_1000724733 226
58 3300005616 Ga0068852_100014630 Ga0068852_1000146307 226
59 3300009174 Ga0105241_10392785 Ga0105241_103927852 226
60 3300013105 Ga0157369_10019210 Ga0157369_100192108 226
61 3300013307 Ga0157372_10014221 Ga0157372_100142217 226
62 3300013307 Ga0157372_10149645 Ga0157372_101496452 226
63 3300013307 Ga0157372_10237316 Ga0157372_102373163 226
64 3300025909 Ga0207705_10052358 Ga0207705_100523583 226
65 3300025911 Ga0207654_10158791 Ga0207654_101587912 226
66 3300025912 Ga0207707_10003609 Ga0207707_1000360911 226
67 3300025920 Ga0207649_10079572 Ga0207649_100795722 226
68 3300025920 Ga0207649_10112478 Ga0207649_101124782 226
69 3300025921 Ga0207652_10174850 Ga0207652_101748502 226
70 3300026078 Ga0207702_10084040 Ga0207702_100840403 226
71 3300026116 Ga0207674_10042924 Ga0207674_100429245 226
72 3300026142 Ga0207698_10099905 Ga0207698_100999052 226
73 3300035118 Ga0373954_0000014 Ga0373954_0000014_28764_29486 226
74 3300035410 Ga0373924_0022995 Ga0373924_0022995_1688_2410 226
75 3300035724 Ga0373933_0002300 Ga0373933_0002300_4627_5349 226
76 3300036401 Ga0373937_0000218 Ga0373937_0000218_27286_28008 226
77 3300042532 Ga0450893_0013893 Ga0450893_0013893_582_1307 226
78 3300044694 Ga0466963_0089250 Ga0466963_0089250_1346_2074 226
79 3300046462 Ga0495651_0132892 Ga0495651_0132892_223_945 226
80 3300048088 Ga0495602_0277959 Ga0495602_0277959_378_1100 226
81 3300031727 Ga0316576_10006856 Ga0316576_100068565 227
82 3300046664 Ga0495659_0020683 Ga0495659_0020683_1224_1946 227
83 3300005340 Ga0070689_100118497 Ga0070689_1001184973 228
84 3300005536 Ga0070697_100203842 Ga0070697_1002038423 228
85 3300005544 Ga0070686_100177117 Ga0070686_1001771172 228
86 3300006844 Ga0075428_100000202 Ga0075428_10000020247 228
87 3300006880 Ga0075429_100000184 Ga0075429_10000018448 228
88 3300009147 Ga0114129_10000677 Ga0114129_1000067749 228
89 3300035113 Ga0373936_0047270 Ga0373936_0047270_335_1057 228
90 3300035692 Ga0373935_0030000 Ga0373935_0030000_1444_2166 228
91 3300035695 Ga0373927_0017581 Ga0373927_0017581_307_1029 228
92 3300035725 Ga0373947_0266850 Ga0373947_0266850_256_978 228
93 3300037068 Ga0373925_0010477 Ga0373925_0010477_2246_2968 228
94 3300041410 Ga0439461_0041784 Ga0439461_0041784_229_951 228
95 3300047315 Ga0495581_0244689 Ga0495581_0244689_44_766 228
96 3300050515 nmdc:mga0a205_485376_c1 nmdc:mga0a205_485376_c1_138_860 228
97 3300009147 Ga0114129_10817431 Ga0114129_108174312 229
98 3300025929 Ga0207664_10176265 Ga0207664_101762653 229
99 3300025949 Ga0207667_10210419 Ga0207667_102104192 229
100 3300006844 Ga0075428_100209494 Ga0075428_1002094942 231
101 3300006880 Ga0075429_100004272 Ga0075429_10000427214 231
102 3300007265 Ga0099794_10117441 Ga0099794_101174412 231
103 3300009147 Ga0114129_10090138 Ga0114129_100901382 231
104 3300027671 Ga0209588_1022154 Ga0209588_10221542 231
105 3300036401 Ga0373937_0049232 Ga0373937_0049232_2210_2932 231
106 3300042436 Ga0439435_0000340 Ga0439435_0000340_2870_3592 231
107 3300046454 Ga0495592_0007798 Ga0495592_0007798_5664_6386 231
108 3300046476 Ga0495662_0005722 Ga0495662_0005722_3588_4310 231
109 3300046516 Ga0495628_0005080 Ga0495628_0005080_4415_5137 231
110 3300046533 Ga0495640_0030961 Ga0495640_0030961_2322_3044 231
111 3300046642 Ga0495634_0022994 Ga0495634_0022994_2152_2874 231
112 3300046663 Ga0495635_0100811 Ga0495635_0100811_260_982 231
113 3300046689 Ga0495613_0175836 Ga0495613_0175836_572_1294 231
114 3300046690 Ga0495624_0151061 Ga0495624_0151061_65_787 231
115 3300047317 Ga0495604_0048208 Ga0495604_0048208_2551_3273 231
116 3300047318 Ga0495636_0052650 Ga0495636_0052650_79_801 231
117 3300047322 Ga0495680_0011731 Ga0495680_0011731_4363_5085 231
118 3300049574 Ga0501038_0361278 Ga0501038_0361278_271_1014 231
119 3300049578 Ga0501042_0402177 Ga0501042_0402177_233_976 231
120 3300049587 Ga0501071_0211726 Ga0501071_0211726_664_1407 231
121 3300049588 Ga0501072_0098416 Ga0501072_0098416_1454_2197 231
122 3300049591 Ga0501075_0238456 Ga0501075_0238456_356_1099 231
123 3300049741 Ga0501079_0336967 Ga0501079_0336967_357_1100 231
124 3300049742 Ga0501080_0355542 Ga0501080_0355542_139_882 231
125 3300049824 Ga0501045_0247785 Ga0501045_0247785_116_859 231
126 3300050507 nmdc:mga05p37_39402_c1 nmdc:mga05p37_39402_c1_4896_5624 231
127 3300050508 nmdc:mga09592_13045_c1 nmdc:mga09592_13045_c1_585_1313 231
128 3300050510 nmdc:mga06r32_431911_c1 nmdc:mga06r32_431911_c1_314_1042 231
129 3300050513 nmdc:mga0rr50_374822_c1 nmdc:mga0rr50_374822_c1_138_863 231
130 3300054114 Ga0501084_0338395 Ga0501084_0338395_338_1081 231
131 3300060353 Ga0501082_0245144 Ga0501082_0245144_711_1454 231
132 3300061734 Ga0530510_0237829 Ga0530510_0237829_564_1307 231
133 3300031616 Ga0307508_10372057 Ga0307508_103720572 232
134 3300050509 nmdc:mga0qj67_94263_c1 nmdc:mga0qj67_94263_c1_935_1681 233
135 3300035692 Ga0373935_0007820 Ga0373935_0007820_1747_2472 239
136 3300005330 Ga0070690_100003552 Ga0070690_1000035526 240
137 3300005334 Ga0068869_100004021 Ga0068869_1000040216 240
138 3300005335 Ga0070666_10159553 Ga0070666_101595532 240
139 3300005336 Ga0070680_100013530 Ga0070680_1000135303 240
140 3300005336 Ga0070680_100105572 Ga0070680_1001055722 240
141 3300005337 Ga0070682_100006656 Ga0070682_1000066566 240
142 3300005338 Ga0068868_100020871 Ga0068868_1000208716 240
143 3300005340 Ga0070689_100003236 Ga0070689_1000032367 240
144 3300005341 Ga0070691_10000625 Ga0070691_1000062512 240
145 3300005343 Ga0070687_100000952 Ga0070687_1000009526 240
146 3300005345 Ga0070692_10000171 Ga0070692_100001716 240
147 3300005353 Ga0070669_100186092 Ga0070669_1001860922 240
148 3300005353 Ga0070669_100598143 Ga0070669_1005981432 240
149 3300005364 Ga0070673_100074354 Ga0070673_1000743544 240
150 3300005438 Ga0070701_10002853 Ga0070701_100028533 240
151 3300005440 Ga0070705_100001385 Ga0070705_1000013859 240
152 3300005440 Ga0070705_100138903 Ga0070705_1001389032 240
153 3300005441 Ga0070700_100004484 Ga0070700_1000044848 240
154 3300005444 Ga0070694_100003309 Ga0070694_1000033096 240
155 3300005444 Ga0070694_100380539 Ga0070694_1003805392 240
156 3300005456 Ga0070678_100023449 Ga0070678_1000234496 240
157 3300005459 Ga0068867_100003994 Ga0068867_1000039946 240
158 3300005530 Ga0070679_100020633 Ga0070679_1000206332 240
159 3300005544 Ga0070686_100003129 Ga0070686_1000031296 240
160 3300005544 Ga0070686_100275539 Ga0070686_1002755391 240
161 3300005545 Ga0070695_100000140 Ga0070695_1000001403 240
162 3300005546 Ga0070696_100000008 Ga0070696_100000008104 240
163 3300005547 Ga0070693_100000154 Ga0070693_1000001549 240
164 3300005549 Ga0070704_100000956 Ga0070704_10000095618 240
165 3300005549 Ga0070704_100004775 Ga0070704_1000047759 240
166 3300005563 Ga0068855_100015523 Ga0068855_1000155238 240
167 3300005578 Ga0068854_100380559 Ga0068854_1003805592 240
168 3300005614 Ga0068856_100015177 Ga0068856_1000151775 240
169 3300005615 Ga0070702_100000421 Ga0070702_1000004213 240
170 3300005616 Ga0068852_100129271 Ga0068852_1001292712 240
171 3300005617 Ga0068859_100002186 Ga0068859_1000021867 240
172 3300005718 Ga0068866_10002041 Ga0068866_100020417 240
173 3300005719 Ga0068861_100006714 Ga0068861_1000067146 240
174 3300005841 Ga0068863_100158087 Ga0068863_1001580873 240
175 3300005842 Ga0068858_100012318 Ga0068858_1000123187 240
176 3300005843 Ga0068860_100009594 Ga0068860_1000095947 240
177 3300005844 Ga0068862_100006076 Ga0068862_1000060767 240
178 3300006237 Ga0097621_100003516 Ga0097621_1000035167 240
179 3300006358 Ga0068871_100000152 Ga0068871_1000001529 240
180 3300006846 Ga0075430_100081967 Ga0075430_1000819673 240
181 3300006871 Ga0075434_100029724 Ga0075434_1000297245 240
182 3300006881 Ga0068865_100005212 Ga0068865_1000052126 240
183 3300006931 Ga0097620_100002187 Ga0097620_1000021877 240
184 3300009098 Ga0105245_10007290 Ga0105245_100072907 240
185 3300009148 Ga0105243_10007189 Ga0105243_100071896 240
186 3300009174 Ga0105241_10013561 Ga0105241_100135612 240
187 3300009176 Ga0105242_10004711 Ga0105242_100047117 240
188 3300009177 Ga0105248_10765610 Ga0105248_107656102 240
189 3300009553 Ga0105249_10005527 Ga0105249_100055278 240
190 3300010375 Ga0105239_10015553 Ga0105239_100155536 240
191 3300011119 Ga0105246_10115080 Ga0105246_101150803 240
192 3300012498 Ga0157345_1007163 Ga0157345_10071631 240
193 3300013105 Ga0157369_10744697 Ga0157369_107446972 240
194 3300013297 Ga0157378_10007547 Ga0157378_100075477 240
195 3300013308 Ga0157375_10181088 Ga0157375_101810882 240
196 3300014968 Ga0157379_10282335 Ga0157379_102823351 240
197 3300014969 Ga0157376_10055681 Ga0157376_100556812 240
198 3300025899 Ga0207642_10002187 Ga0207642_100021876 240
199 3300025901 Ga0207688_10038449 Ga0207688_100384492 240
200 3300025907 Ga0207645_10025549 Ga0207645_100255492 240
201 3300025908 Ga0207643_10049140 Ga0207643_100491401 240
202 3300025917 Ga0207660_10010473 Ga0207660_100104736 240
203 3300025918 Ga0207662_10001772 Ga0207662_100017728 240
204 3300025918 Ga0207662_10126964 Ga0207662_101269642 240
205 3300025921 Ga0207652_10003546 Ga0207652_100035467 240
206 3300025926 Ga0207659_10539977 Ga0207659_105399771 240
207 3300025927 Ga0207687_10001190 Ga0207687_100011908 240
208 3300025934 Ga0207686_10000246 Ga0207686_100002466 240
209 3300025935 Ga0207709_10003128 Ga0207709_100031288 240
210 3300025936 Ga0207670_10000747 Ga0207670_1000074713 240
211 3300025938 Ga0207704_10001629 Ga0207704_100016298 240
212 3300025941 Ga0207711_10092090 Ga0207711_100920902 240
213 3300025942 Ga0207689_10007929 Ga0207689_100079296 240
214 3300025949 Ga0207667_10010577 Ga0207667_100105776 240
215 3300025961 Ga0207712_10001322 Ga0207712_100013228 240
216 3300025981 Ga0207640_10169618 Ga0207640_101696183 240
217 3300026023 Ga0207677_10008880 Ga0207677_100088802 240
218 3300026035 Ga0207703_10008914 Ga0207703_100089146 240
219 3300026041 Ga0207639_10376553 Ga0207639_103765532 240
220 3300026075 Ga0207708_10000601 Ga0207708_1000060115 240
221 3300026078 Ga0207702_10018247 Ga0207702_100182474 240
222 3300026089 Ga0207648_10002542 Ga0207648_1000254220 240
223 3300026118 Ga0207675_100009511 Ga0207675_1000095115 240
224 3300026121 Ga0207683_10075461 Ga0207683_100754612 240
225 3300026142 Ga0207698_10134858 Ga0207698_101348582 240
226 3300027907 Ga0207428_10000453 Ga0207428_1000045324 240
227 3300028380 Ga0268265_10005081 Ga0268265_100050816 240
228 3300028381 Ga0268264_10009530 Ga0268264_100095306 240
229 3300034816 Ga0373930_0016484 Ga0373930_0016484_291_1013 240
230 3300034818 Ga0373950_0006866 Ga0373950_0006866_819_1541 240
231 3300035084 Ga0373928_0002911 Ga0373928_0002911_253_975 240
232 3300035084 Ga0373928_0039024 Ga0373928_0039024_255_977 240
233 3300035090 Ga0373949_0006258 Ga0373949_0006258_1881_2603 240
234 3300035115 Ga0373941_0006951 Ga0373941_0006951_1995_2717 240
235 3300035117 Ga0373953_0062634 Ga0373953_0062634_266_988 240
236 3300035172 Ga0373955_0346939 Ga0373955_0346939_132_854 240
237 3300035242 Ga0373962_0012010 Ga0373962_0012010_1193_1915 240
238 3300035691 Ga0373931_0005178 Ga0373931_0005178_5081_5803 240
239 3300035724 Ga0373933_0070383 Ga0373933_0070383_532_1254 240
240 3300036401 Ga0373937_0227231 Ga0373937_0227231_775_1497 240
241 3300036401 Ga0373937_0601795 Ga0373937_0601795_149_871 240
242 3300044712 Ga0453684_0052853 Ga0453684_0052853_3923_4648 240
243 3300045051 Ga0451576_0533263 Ga0451576_0533263_33_755 240
244 3300046454 Ga0495592_0185258 Ga0495592_0185258_359_1081 240
245 3300046476 Ga0495662_0075257 Ga0495662_0075257_348_1070 240
246 3300046516 Ga0495628_0049048 Ga0495628_0049048_2359_3081 240
247 3300046529 Ga0495652_0324884 Ga0495652_0324884_239_961 240
248 3300046664 Ga0495659_0020909 Ga0495659_0020909_54_776 240
249 3300046684 Ga0495669_0003720 Ga0495669_0003720_1878_2600 240
250 3300047673 Ga0495593_0121089 Ga0495593_0121089_546_1268 240
251 3300049574 Ga0501038_0161591 Ga0501038_0161591_485_1207 240
252 3300049575 Ga0501039_0355058 Ga0501039_0355058_203_925 240
253 3300049576 Ga0501040_0108584 Ga0501040_0108584_57_779 240
254 3300049591 Ga0501075_0081082 Ga0501075_0081082_1654_2376 240
255 3300049824 Ga0501045_0098593 Ga0501045_0098593_815_1537 240
256 3300049824 Ga0501045_0309078 Ga0501045_0309078_88_810 240
257 3300050509 nmdc:mga0qj67_28305_c1 nmdc:mga0qj67_28305_c1_2198_2920 240
258 3300050512 nmdc:mga0n895_5601_c1 nmdc:mga0n895_5601_c1_3947_4669 240
259 3300053077 Ga0495601_0166595 Ga0495601_0166595_459_1181 240
260 3300005436 Ga0070713_100074332 Ga0070713_1000743323 241
261 3300036401 Ga0373937_0080227 Ga0373937_0080227_1197_1922 241
262 3300042876 Ga0451577_0202923 Ga0451577_0202923_189_938 241
263 3300049579 Ga0501043_0583144 Ga0501043_0583144_18_743 241
264 3300049667 Ga0501230_004093 Ga0501230_004093_984_1709 241
265 3300005295 Ga0065707_10131581 Ga0065707_101315812 242
266 3300005444 Ga0070694_100080997 Ga0070694_1000809973 242
267 3300005545 Ga0070695_100226718 Ga0070695_1002267182 242
268 3300005549 Ga0070704_100149941 Ga0070704_1001499412 242
269 3300005549 Ga0070704_100181550 Ga0070704_1001815502 242
270 3300005617 Ga0068859_100922168 Ga0068859_1009221682 242
271 3300006931 Ga0097620_100922228 Ga0097620_1009222282 242
272 3300009094 Ga0111539_10711994 Ga0111539_107119942 242
273 3300025949 Ga0207667_10092435 Ga0207667_100924354 242
274 3300027395 Ga0209996_1013635 Ga0209996_10136352 242
275 3300031665 Ga0316575_10002726 Ga0316575_100027266 242
276 3300035398 Ga0316574_0001392 Ga0316574_0001392_5298_6116 242
277 3300039110 Ga0400487_04715 Ga0400487_04715_3998_4744 242
278 3300046472 Ga0495580_0088975 Ga0495580_0088975_92_820 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

35

106

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

112

267

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.9007 3 241
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8754 3 241
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8544 18 242
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8113 24 238
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8051 6 238
ID Description Score Start End Superfamily
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9611 82 242 3.30.70.980
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9262 24 77 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9144 83 238 3.30.70.980
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9104 82 242 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9088 19 79 1.10.10.200
ID Description Score Start End GO Terms
AF-A0A3B9L7U6-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9937 61 241 GO:0003677
GO:0005829
AF-A0A3B9L7U6-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9883 61 241 GO:0003677
GO:0005829
AF-A0A258LN40-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9821 134 239 GO:0003677
GO:0005829
AF-Q3A233-F1-model_v4 Probable transcriptional regulatory protein Pcar_2335 0.9776 1 237 GO:0003677
GO:0005829
GO:0006355
AF-A0A7Z9XSW8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9765 79 241 GO:0003677
GO:0005829

Feature Viewer

pLDDT pTM Quality
89.31 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map