F382505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 278 | 203 | 278 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0001392|Ga0316574_0001392_5298_6116 |
| Length | 272 |
| Sequence | LAINIGAAMRIRGALKFDDLPAILTERLRTMAGHSKWANIQHRKGRQDAKRGKIFTKLIKEITIAARLGGGDASTNPRLRLAIDKARDQNMPNDNIQRAIQRGTGELDGVSYEEIRYEGYGVGGAAVIVDCTTDNRTRCVAEVRHAFTKNGGNLGSDGSVAYQFKHCGQFIFAPGTSEDRVMEVGLEAGAEDVTTDEDGSIEVVCAPGDFSALRDAFAKGGLKPEIAEITMKASTESVLQGEDAMRMRRLLDALEELDDVQDVYTNAALETD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 112 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 113 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 114 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 115 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 116 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 117 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 119 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 124 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 125 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 126 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 129 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 139 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 140 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 141 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 142 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 143 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 144 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 145 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 146 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 177 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 189 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 98.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10131581 | 3300005295 | Bacteria | 1911 |
| 2 | Ga0070690_100003552 | 3300005330 | Bacteria | 8550 |
| 3 | Ga0068869_100004021 | 3300005334 | Bacteria | 9097 |
| 4 | Ga0070666_10159553 | 3300005335 | Bacteria | 1576 |
| 5 | Ga0070680_100013530 | 3300005336 | Bacteria | 6357 |
| 6 | Ga0070680_100105572 | 3300005336 | Bacteria | 2341 |
| 7 | Ga0070682_100006656 | 3300005337 | Bacteria | 6479 |
| 8 | Ga0068868_100020871 | 3300005338 | Bacteria | 4930 |
| 9 | Ga0070689_100003236 | 3300005340 | Bacteria | 10797 |
| 10 | Ga0070689_100118497 | 3300005340 | Bacteria | 2112 |
| 11 | Ga0070691_10000625 | 3300005341 | Bacteria | 13618 |
| 12 | Ga0070687_100000952 | 3300005343 | Bacteria | 9835 |
| 13 | Ga0070661_100043949 | 3300005344 | Bacteria | 3263 |
| 14 | Ga0070661_100177689 | 3300005344 | Bacteria | 1619 |
| 15 | Ga0070692_10000171 | 3300005345 | Bacteria | 16686 |
| 16 | Ga0070669_100186092 | 3300005353 | Bacteria | 1627 |
| 17 | Ga0070669_100598143 | 3300005353 | Bacteria | 924 |
| 18 | Ga0070673_100074354 | 3300005364 | Bacteria | 2738 |
| 19 | Ga0070713_100074332 | 3300005436 | Bacteria | 2879 |
| 20 | Ga0070701_10002853 | 3300005438 | Bacteria | 6736 |
| 21 | Ga0070705_100001385 | 3300005440 | Bacteria | 12885 |
| 22 | Ga0070705_100138903 | 3300005440 | Bacteria | 1596 |
| 23 | Ga0070700_100004484 | 3300005441 | Bacteria | 7297 |
| 24 | Ga0070694_100003309 | 3300005444 | Bacteria | 9641 |
| 25 | Ga0070694_100080997 | 3300005444 | Bacteria | 2257 |
| 26 | Ga0070694_100380539 | 3300005444 | Bacteria | 1100 |
| 27 | Ga0070678_100023449 | 3300005456 | Bacteria | 4113 |
| 28 | Ga0068867_100003994 | 3300005459 | Bacteria | 10375 |
| 29 | Ga0070698_100018504 | 3300005471 | Bacteria | 7335 |
| 30 | Ga0070679_100020633 | 3300005530 | Bacteria | 6426 |
| 31 | Ga0070679_100181840 | 3300005530 | Bacteria | 2075 |
| 32 | Ga0070697_100203842 | 3300005536 | Bacteria | 1681 |
| 33 | Ga0068853_100019035 | 3300005539 | Bacteria | 5688 |
| 34 | Ga0068853_100096021 | 3300005539 | Bacteria | 2615 |
| 35 | Ga0070686_100003129 | 3300005544 | Bacteria | 9062 |
| 36 | Ga0070686_100177117 | 3300005544 | Bacteria | 1512 |
| 37 | Ga0070686_100275539 | 3300005544 | Bacteria | 1238 |
| 38 | Ga0070695_100000140 | 3300005545 | Bacteria | 33449 |
| 39 | Ga0070695_100226718 | 3300005545 | Bacteria | 1349 |
| 40 | Ga0070696_100000008 | 3300005546 | Bacteria | 101365 |
| 41 | Ga0070693_100000154 | 3300005547 | Bacteria | 31511 |
| 42 | Ga0070704_100000956 | 3300005549 | Bacteria | 14644 |
| 43 | Ga0070704_100004775 | 3300005549 | Bacteria | 7845 |
| 44 | Ga0070704_100149941 | 3300005549 | Bacteria | 1832 |
| 45 | Ga0070704_100181550 | 3300005549 | Bacteria | 1684 |
| 46 | Ga0068855_100015523 | 3300005563 | Bacteria | 9170 |
| 47 | Ga0068855_100055072 | 3300005563 | Bacteria | 4672 |
| 48 | Ga0070664_100122628 | 3300005564 | Bacteria | 2277 |
| 49 | Ga0068854_100380559 | 3300005578 | Bacteria | 1163 |
| 50 | Ga0068856_100004633 | 3300005614 | Bacteria | 13658 |
| 51 | Ga0068856_100015177 | 3300005614 | Bacteria | 7441 |
| 52 | Ga0068856_100072473 | 3300005614 | Bacteria | 3410 |
| 53 | Ga0070702_100000421 | 3300005615 | Bacteria | 15080 |
| 54 | Ga0070702_100165710 | 3300005615 | Bacteria | 1433 |
| 55 | Ga0068852_100014630 | 3300005616 | Bacteria | 6050 |
| 56 | Ga0068852_100129271 | 3300005616 | Bacteria | 2324 |
| 57 | Ga0068859_100002186 | 3300005617 | Bacteria | 19854 |
| 58 | Ga0068859_100922168 | 3300005617 | Bacteria | 958 |
| 59 | Ga0068866_10002041 | 3300005718 | Bacteria | 8407 |
| 60 | Ga0068861_100006714 | 3300005719 | Bacteria | 7860 |
| 61 | Ga0068863_100158087 | 3300005841 | Bacteria | 2170 |
| 62 | Ga0068858_100012318 | 3300005842 | Bacteria | 8063 |
| 63 | Ga0068860_100009594 | 3300005843 | Bacteria | 9618 |
| 64 | Ga0068862_100006076 | 3300005844 | Bacteria | 10053 |
| 65 | Ga0081539_10032688 | 3300005985 | Bacteria | 3182 |
| 66 | Ga0097621_100003516 | 3300006237 | Bacteria | 10822 |
| 67 | Ga0068871_100000152 | 3300006358 | Bacteria | 45602 |
| 68 | Ga0075428_100000202 | 3300006844 | Bacteria | 56911 |
| 69 | Ga0075428_100209494 | 3300006844 | Bacteria | 2106 |
| 70 | Ga0075430_100081967 | 3300006846 | Bacteria | 2703 |
| 71 | Ga0075434_100029724 | 3300006871 | Bacteria | 5378 |
| 72 | Ga0075429_100000184 | 3300006880 | Bacteria | 40869 |
| 73 | Ga0075429_100004272 | 3300006880 | Bacteria | 12256 |
| 74 | Ga0068865_100005212 | 3300006881 | Bacteria | 7860 |
| 75 | Ga0097620_100002187 | 3300006931 | Bacteria | 19854 |
| 76 | Ga0097620_100922228 | 3300006931 | Bacteria | 958 |
| 77 | Ga0099794_10117441 | 3300007265 | Bacteria | 1336 |
| 78 | Ga0105240_10381551 | 3300009093 | Bacteria | 1592 |
| 79 | Ga0111539_10711994 | 3300009094 | Bacteria | 1169 |
| 80 | Ga0105245_10007290 | 3300009098 | Bacteria | 9683 |
| 81 | Ga0114129_10000677 | 3300009147 | Bacteria | 42898 |
| 82 | Ga0114129_10090138 | 3300009147 | Bacteria | 4251 |
| 83 | Ga0114129_10817431 | 3300009147 | Bacteria | 1187 |
| 84 | Ga0105243_10007189 | 3300009148 | Bacteria | 8557 |
| 85 | Ga0105241_10013561 | 3300009174 | Bacteria | 5973 |
| 86 | Ga0105241_10392785 | 3300009174 | Bacteria | 1215 |
| 87 | Ga0105242_10004711 | 3300009176 | Bacteria | 10560 |
| 88 | Ga0105242_10497355 | 3300009176 | Bacteria | 1159 |
| 89 | Ga0105248_10765610 | 3300009177 | Bacteria | 1089 |
| 90 | Ga0105238_10017575 | 3300009551 | Bacteria | 7271 |
| 91 | Ga0105249_10005527 | 3300009553 | Bacteria | 10917 |
| 92 | Ga0105239_10015553 | 3300010375 | Bacteria | 8427 |
| 93 | Ga0105239_10046921 | 3300010375 | Bacteria | 4733 |
| 94 | Ga0105246_10115080 | 3300011119 | Bacteria | 1983 |
| 95 | Ga0157345_1007163 | 3300012498 | Bacteria | 905 |
| 96 | Ga0157369_10019210 | 3300013105 | Bacteria | 7647 |
| 97 | Ga0157369_10744697 | 3300013105 | Bacteria | 1008 |
| 98 | Ga0157378_10007547 | 3300013297 | Bacteria | 9496 |
| 99 | Ga0157372_10014221 | 3300013307 | Bacteria | 8505 |
| 100 | Ga0157372_10149645 | 3300013307 | Bacteria | 2694 |
| 101 | Ga0157372_10237316 | 3300013307 | Bacteria | 2115 |
| 102 | Ga0157375_10181088 | 3300013308 | Bacteria | 2258 |
| 103 | Ga0157379_10282335 | 3300014968 | Unclassified | 1511 |
| 104 | Ga0157376_10055681 | 3300014969 | Bacteria | 3301 |
| 105 | Ga0207642_10002187 | 3300025899 | Bacteria | 6062 |
| 106 | Ga0207688_10038449 | 3300025901 | Bacteria | 2656 |
| 107 | Ga0207645_10025549 | 3300025907 | Bacteria | 3821 |
| 108 | Ga0207643_10049140 | 3300025908 | Bacteria | 2390 |
| 109 | Ga0207705_10052358 | 3300025909 | Bacteria | 2939 |
| 110 | Ga0207654_10158791 | 3300025911 | Bacteria | 1459 |
| 111 | Ga0207707_10003609 | 3300025912 | Bacteria | 13717 |
| 112 | Ga0207660_10010473 | 3300025917 | Bacteria | 6020 |
| 113 | Ga0207662_10001772 | 3300025918 | Bacteria | 10599 |
| 114 | Ga0207662_10126964 | 3300025918 | Bacteria | 1604 |
| 115 | Ga0207649_10079572 | 3300025920 | Bacteria | 2118 |
| 116 | Ga0207649_10112478 | 3300025920 | Bacteria | 1822 |
| 117 | Ga0207652_10003546 | 3300025921 | Bacteria | 12882 |
| 118 | Ga0207652_10174850 | 3300025921 | Bacteria | 1928 |
| 119 | Ga0207659_10539977 | 3300025926 | Bacteria | 990 |
| 120 | Ga0207687_10001190 | 3300025927 | Bacteria | 17765 |
| 121 | Ga0207664_10176265 | 3300025929 | Bacteria | 1833 |
| 122 | Ga0207686_10000246 | 3300025934 | Bacteria | 41384 |
| 123 | Ga0207709_10003128 | 3300025935 | Bacteria | 9955 |
| 124 | Ga0207670_10000747 | 3300025936 | Bacteria | 17073 |
| 125 | Ga0207670_10436664 | 3300025936 | Bacteria | 1053 |
| 126 | Ga0207704_10001629 | 3300025938 | Bacteria | 10062 |
| 127 | Ga0207704_10298442 | 3300025938 | Bacteria | 1233 |
| 128 | Ga0207711_10092090 | 3300025941 | Bacteria | 2667 |
| 129 | Ga0207689_10007929 | 3300025942 | Bacteria | 9275 |
| 130 | Ga0207667_10010577 | 3300025949 | Bacteria | 10777 |
| 131 | Ga0207667_10092435 | 3300025949 | Bacteria | 3124 |
| 132 | Ga0207667_10095649 | 3300025949 | Bacteria | 3066 |
| 133 | Ga0207667_10210419 | 3300025949 | Bacteria | 1993 |
| 134 | Ga0207712_10001322 | 3300025961 | Bacteria | 16967 |
| 135 | Ga0207640_10169618 | 3300025981 | Bacteria | 1625 |
| 136 | Ga0207677_10008880 | 3300026023 | Bacteria | 5634 |
| 137 | Ga0207703_10008914 | 3300026035 | Bacteria | 7901 |
| 138 | Ga0207639_10130909 | 3300026041 | Bacteria | 2077 |
| 139 | Ga0207639_10376553 | 3300026041 | Bacteria | 1274 |
| 140 | Ga0207708_10000601 | 3300026075 | Bacteria | 27771 |
| 141 | Ga0207702_10007845 | 3300026078 | Bacteria | 9055 |
| 142 | Ga0207702_10018247 | 3300026078 | Bacteria | 5804 |
| 143 | Ga0207702_10084040 | 3300026078 | Bacteria | 2770 |
| 144 | Ga0207648_10002542 | 3300026089 | Bacteria | 19564 |
| 145 | Ga0207674_10042924 | 3300026116 | Bacteria | 4666 |
| 146 | Ga0207675_100009511 | 3300026118 | Bacteria | 9094 |
| 147 | Ga0207683_10075461 | 3300026121 | Bacteria | 2984 |
| 148 | Ga0207698_10099905 | 3300026142 | Bacteria | 2401 |
| 149 | Ga0207698_10122875 | 3300026142 | Bacteria | 2201 |
| 150 | Ga0207698_10134858 | 3300026142 | Bacteria | 2117 |
| 151 | Ga0209996_1013635 | 3300027395 | Bacteria | 1099 |
| 152 | Ga0209588_1022154 | 3300027671 | Bacteria | 1999 |
| 153 | Ga0207428_10000453 | 3300027907 | Bacteria | 49756 |
| 154 | Ga0268265_10005081 | 3300028380 | Bacteria | 9021 |
| 155 | Ga0268265_11050006 | 3300028380 | Bacteria | 807 |
| 156 | Ga0268264_10009530 | 3300028381 | Bacteria | 8044 |
| 157 | Ga0307508_10372057 | 3300031616 | Bacteria | 1020 |
| 158 | Ga0316575_10002726 | 3300031665 | Bacteria | 5961 |
| 159 | Ga0316575_10037945 | 3300031665 | Bacteria | 1899 |
| 160 | Ga0316576_10006856 | 3300031727 | Bacteria | 7120 |
| 161 | Ga0316576_10078293 | 3300031727 | Bacteria | 2450 |
| 162 | Ga0373930_0016484 | 3300034816 | Bacteria | 1398 |
| 163 | Ga0373950_0006866 | 3300034818 | Bacteria | 1751 |
| 164 | Ga0373928_0002911 | 3300035084 | Bacteria | 3302 |
| 165 | Ga0373928_0039024 | 3300035084 | Bacteria | 1083 |
| 166 | Ga0373949_0006258 | 3300035090 | Bacteria | 2627 |
| 167 | Ga0373936_0047270 | 3300035113 | Bacteria | 1735 |
| 168 | Ga0373941_0006951 | 3300035115 | Bacteria | 2748 |
| 169 | Ga0373953_0062634 | 3300035117 | Bacteria | 1523 |
| 170 | Ga0373954_0000014 | 3300035118 | Bacteria | 71012 |
| 171 | Ga0373955_0346939 | 3300035172 | Bacteria | 899 |
| 172 | Ga0373962_0012010 | 3300035242 | Bacteria | 2177 |
| 173 | Ga0316574_0001392 | 3300035398 | Bacteria | 11427 |
| 174 | Ga0316574_0001987 | 3300035398 | Bacteria | 10049 |
| 175 | Ga0373924_0022995 | 3300035410 | Bacteria | 2440 |
| 176 | Ga0373931_0005178 | 3300035691 | Bacteria | 6012 |
| 177 | Ga0373931_0042287 | 3300035691 | Bacteria | 2396 |
| 178 | Ga0373935_0007820 | 3300035692 | Bacteria | 6410 |
| 179 | Ga0373935_0030000 | 3300035692 | Bacteria | 3367 |
| 180 | Ga0373927_0017581 | 3300035695 | Bacteria | 4705 |
| 181 | Ga0373933_0002300 | 3300035724 | Bacteria | 10867 |
| 182 | Ga0373933_0070383 | 3300035724 | Bacteria | 2128 |
| 183 | Ga0373947_0266850 | 3300035725 | Bacteria | 1135 |
| 184 | Ga0373937_0000218 | 3300036401 | Bacteria | 55605 |
| 185 | Ga0373937_0049232 | 3300036401 | Bacteria | 3859 |
| 186 | Ga0373937_0080227 | 3300036401 | Bacteria | 3017 |
| 187 | Ga0373937_0227231 | 3300036401 | Bacteria | 1757 |
| 188 | Ga0373937_0601795 | 3300036401 | Bacteria | 1043 |
| 189 | Ga0316584_0128672 | 3300036712 | Bacteria | 1891 |
| 190 | Ga0316584_0333567 | 3300036712 | Bacteria | 1092 |
| 191 | Ga0373925_0010477 | 3300037068 | Bacteria | 6723 |
| 192 | Ga0395900_0452987 | 3300037418 | Bacteria | 1239 |
| 193 | Ga0395898_0324866 | 3300037466 | Bacteria | 1468 |
| 194 | Ga0395905_0009395 | 3300037471 | Bacteria | 9561 |
| 195 | Ga0395901_0162259 | 3300038443 | Bacteria | 2347 |
| 196 | Ga0400487_04715 | 3300039110 | Bacteria | 43923 |
| 197 | Ga0439461_0041784 | 3300041410 | Bacteria | 993 |
| 198 | Ga0439441_000050 | 3300042001 | Bacteria | 8751 |
| 199 | Ga0439451_033631 | 3300042009 | Bacteria | 1031 |
| 200 | Ga0439434_0051526 | 3300042435 | Bacteria | 1276 |
| 201 | Ga0439435_0000239 | 3300042436 | Bacteria | 7877 |
| 202 | Ga0439435_0000340 | 3300042436 | Bacteria | 7077 |
| 203 | Ga0439444_0002357 | 3300042437 | Bacteria | 2576 |
| 204 | Ga0439460_0014124 | 3300042461 | Bacteria | 2096 |
| 205 | Ga0450893_0013893 | 3300042532 | Bacteria | 1346 |
| 206 | Ga0451577_0202923 | 3300042876 | Bacteria | 1790 |
| 207 | Ga0451577_0257951 | 3300042876 | Bacteria | 1578 |
| 208 | Ga0466972_0002152 | 3300044658 | Bacteria | 9677 |
| 209 | Ga0466966_0044714 | 3300044684 | Bacteria | 2834 |
| 210 | Ga0466963_0089250 | 3300044694 | Bacteria | 2097 |
| 211 | Ga0453684_0052853 | 3300044712 | Bacteria | 5308 |
| 212 | Ga0453684_0079997 | 3300044712 | Bacteria | 4083 |
| 213 | Ga0466957_0009472 | 3300044842 | Bacteria | 5561 |
| 214 | Ga0466959_0238683 | 3300045049 | Bacteria | 1256 |
| 215 | Ga0451576_0177512 | 3300045051 | Bacteria | 2224 |
| 216 | Ga0451576_0533263 | 3300045051 | Bacteria | 1233 |
| 217 | Ga0466958_0018967 | 3300045836 | Bacteria | 3999 |
| 218 | Ga0495592_0007798 | 3300046454 | Bacteria | 8021 |
| 219 | Ga0495592_0185258 | 3300046454 | Bacteria | 1415 |
| 220 | Ga0495592_0223410 | 3300046454 | Bacteria | 1258 |
| 221 | Ga0495629_0168474 | 3300046459 | Bacteria | 1521 |
| 222 | Ga0495651_0132892 | 3300046462 | Bacteria | 1815 |
| 223 | Ga0495580_0088975 | 3300046472 | Bacteria | 2150 |
| 224 | Ga0495662_0005722 | 3300046476 | Bacteria | 6216 |
| 225 | Ga0495662_0075257 | 3300046476 | Bacteria | 1638 |
| 226 | Ga0495628_0005080 | 3300046516 | Bacteria | 11566 |
| 227 | Ga0495628_0049048 | 3300046516 | Bacteria | 3344 |
| 228 | Ga0495652_0324884 | 3300046529 | Bacteria | 1110 |
| 229 | Ga0495640_0030961 | 3300046533 | Bacteria | 3825 |
| 230 | Ga0495634_0022994 | 3300046642 | Bacteria | 4388 |
| 231 | Ga0495635_0100811 | 3300046663 | Bacteria | 1974 |
| 232 | Ga0495659_0020683 | 3300046664 | Bacteria | 2213 |
| 233 | Ga0495659_0020909 | 3300046664 | Bacteria | 2202 |
| 234 | Ga0495669_0003720 | 3300046684 | Bacteria | 6275 |
| 235 | Ga0495613_0175836 | 3300046689 | Bacteria | 1517 |
| 236 | Ga0495624_0151061 | 3300046690 | Bacteria | 1421 |
| 237 | Ga0495581_0244689 | 3300047315 | Bacteria | 1049 |
| 238 | Ga0495604_0048208 | 3300047317 | Bacteria | 3314 |
| 239 | Ga0495636_0052650 | 3300047318 | Bacteria | 1708 |
| 240 | Ga0495680_0011731 | 3300047322 | Bacteria | 7740 |
| 241 | Ga0495593_0121089 | 3300047673 | Bacteria | 1332 |
| 242 | Ga0495602_0277959 | 3300048088 | Bacteria | 1235 |
| 243 | Ga0496117_0000088 | 3300048920 | Bacteria | 211093 |
| 244 | Ga0501033_0375548 | 3300049570 | Bacteria | 994 |
| 245 | Ga0501037_0220706 | 3300049573 | Bacteria | 1334 |
| 246 | Ga0501038_0161591 | 3300049574 | Bacteria | 1820 |
| 247 | Ga0501038_0172167 | 3300049574 | Bacteria | 1752 |
| 248 | Ga0501038_0361278 | 3300049574 | Bacteria | 1129 |
| 249 | Ga0501039_0355058 | 3300049575 | Bacteria | 1152 |
| 250 | Ga0501040_0108584 | 3300049576 | Bacteria | 1940 |
| 251 | Ga0501040_0275242 | 3300049576 | Bacteria | 1202 |
| 252 | Ga0501042_0402177 | 3300049578 | Bacteria | 992 |
| 253 | Ga0501043_0583144 | 3300049579 | Bacteria | 828 |
| 254 | Ga0501047_0381591 | 3300049581 | Bacteria | 1244 |
| 255 | Ga0501071_0211726 | 3300049587 | Bacteria | 1457 |
| 256 | Ga0501072_0098416 | 3300049588 | Bacteria | 2325 |
| 257 | Ga0501075_0081082 | 3300049591 | Bacteria | 2456 |
| 258 | Ga0501075_0238456 | 3300049591 | Bacteria | 1386 |
| 259 | Ga0501230_004093 | 3300049667 | Bacteria | 1981 |
| 260 | Ga0501079_0336967 | 3300049741 | Bacteria | 1181 |
| 261 | Ga0501080_0355542 | 3300049742 | Bacteria | 1322 |
| 262 | Ga0501081_0400614 | 3300049743 | Bacteria | 1016 |
| 263 | Ga0501045_0098593 | 3300049824 | Bacteria | 2162 |
| 264 | Ga0501045_0247785 | 3300049824 | Bacteria | 1326 |
| 265 | Ga0501045_0309078 | 3300049824 | Bacteria | 1176 |
| 266 | nmdc:mga05p37_39402_c1 | 3300050507 | Bacteria | 5802 |
| 267 | nmdc:mga09592_13045_c1 | 3300050508 | Bacteria | 6783 |
| 268 | nmdc:mga0qj67_28305_c1 | 3300050509 | Bacteria | 4350 |
| 269 | nmdc:mga0qj67_94263_c1 | 3300050509 | Bacteria | 2408 |
| 270 | nmdc:mga06r32_431911_c1 | 3300050510 | Bacteria | 1298 |
| 271 | nmdc:mga0n895_5601_c1 | 3300050512 | Bacteria | 10515 |
| 272 | nmdc:mga0rr50_374822_c1 | 3300050513 | Bacteria | 1199 |
| 273 | nmdc:mga0a205_485376_c1 | 3300050515 | Bacteria | 1093 |
| 274 | Ga0495601_0166595 | 3300053077 | Bacteria | 1440 |
| 275 | Ga0501084_0338395 | 3300054114 | Bacteria | 1271 |
| 276 | Ga0501082_0245144 | 3300060353 | Bacteria | 1559 |
| 277 | Ga0530510_0237829 | 3300061734 | Bacteria | 1355 |
| 278 | Ga0530510_0303010 | 3300061734 | Bacteria | 1196 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0168474 | Ga0495629_0168474_50_796 | 211 |
| 2 | 3300005985 | Ga0081539_10032688 | Ga0081539_100326882 | 212 |
| 3 | 3300005539 | Ga0068853_100019035 | Ga0068853_1000190353 | 216 |
| 4 | 3300026041 | Ga0207639_10130909 | Ga0207639_101309093 | 216 |
| 5 | 3300026142 | Ga0207698_10122875 | Ga0207698_101228753 | 216 |
| 6 | 3300035398 | Ga0316574_0001987 | Ga0316574_0001987_6468_7211 | 216 |
| 7 | 3300036712 | Ga0316584_0333567 | Ga0316584_0333567_169_915 | 216 |
| 8 | 3300031727 | Ga0316576_10078293 | Ga0316576_100782933 | 217 |
| 9 | 3300036712 | Ga0316584_0128672 | Ga0316584_0128672_998_1741 | 217 |
| 10 | 3300035691 | Ga0373931_0042287 | Ga0373931_0042287_1132_1851 | 218 |
| 11 | 3300042001 | Ga0439441_000050 | Ga0439441_000050_2768_3490 | 218 |
| 12 | 3300042436 | Ga0439435_0000239 | Ga0439435_0000239_4559_5281 | 218 |
| 13 | 3300042437 | Ga0439444_0002357 | Ga0439444_0002357_1824_2546 | 218 |
| 14 | 3300042461 | Ga0439460_0014124 | Ga0439460_0014124_221_943 | 218 |
| 15 | 3300046454 | Ga0495592_0223410 | Ga0495592_0223410_378_1097 | 218 |
| 16 | 3300049576 | Ga0501040_0275242 | Ga0501040_0275242_113_835 | 218 |
| 17 | 3300061734 | Ga0530510_0303010 | Ga0530510_0303010_457_1179 | 218 |
| 18 | 3300005615 | Ga0070702_100165710 | Ga0070702_1001657102 | 219 |
| 19 | 3300009176 | Ga0105242_10497355 | Ga0105242_104973552 | 219 |
| 20 | 3300009551 | Ga0105238_10017575 | Ga0105238_100175753 | 219 |
| 21 | 3300010375 | Ga0105239_10046921 | Ga0105239_100469212 | 219 |
| 22 | 3300025936 | Ga0207670_10436664 | Ga0207670_104366642 | 219 |
| 23 | 3300044658 | Ga0466972_0002152 | Ga0466972_0002152_4107_4820 | 219 |
| 24 | 3300042876 | Ga0451577_0257951 | Ga0451577_0257951_604_1329 | 220 |
| 25 | 3300045051 | Ga0451576_0177512 | Ga0451576_0177512_322_1047 | 220 |
| 26 | 3300049570 | Ga0501033_0375548 | Ga0501033_0375548_147_872 | 220 |
| 27 | 3300049573 | Ga0501037_0220706 | Ga0501037_0220706_152_877 | 220 |
| 28 | 3300049574 | Ga0501038_0172167 | Ga0501038_0172167_661_1386 | 220 |
| 29 | 3300049581 | Ga0501047_0381591 | Ga0501047_0381591_239_964 | 220 |
| 30 | 3300005614 | Ga0068856_100004633 | Ga0068856_1000046332 | 221 |
| 31 | 3300026078 | Ga0207702_10007845 | Ga0207702_100078457 | 221 |
| 32 | 3300028380 | Ga0268265_11050006 | Ga0268265_110500061 | 222 |
| 33 | 3300031665 | Ga0316575_10037945 | Ga0316575_100379452 | 222 |
| 34 | 3300042435 | Ga0439434_0051526 | Ga0439434_0051526_535_1260 | 222 |
| 35 | 3300048920 | Ga0496117_0000088 | Ga0496117_0000088_21060_21803 | 222 |
| 36 | 3300049743 | Ga0501081_0400614 | Ga0501081_0400614_228_959 | 223 |
| 37 | 3300009093 | Ga0105240_10381551 | Ga0105240_103815511 | 224 |
| 38 | 3300025949 | Ga0207667_10095649 | Ga0207667_100956494 | 224 |
| 39 | 3300037418 | Ga0395900_0452987 | Ga0395900_0452987_484_1206 | 224 |
| 40 | 3300037466 | Ga0395898_0324866 | Ga0395898_0324866_26_748 | 224 |
| 41 | 3300037471 | Ga0395905_0009395 | Ga0395905_0009395_3197_3919 | 224 |
| 42 | 3300038443 | Ga0395901_0162259 | Ga0395901_0162259_903_1625 | 224 |
| 43 | 3300042009 | Ga0439451_033631 | Ga0439451_033631_235_978 | 224 |
| 44 | 3300025938 | Ga0207704_10298442 | Ga0207704_102984422 | 225 |
| 45 | 3300044684 | Ga0466966_0044714 | Ga0466966_0044714_1622_2344 | 225 |
| 46 | 3300044712 | Ga0453684_0079997 | Ga0453684_0079997_724_1449 | 225 |
| 47 | 3300044842 | Ga0466957_0009472 | Ga0466957_0009472_1970_2692 | 225 |
| 48 | 3300045049 | Ga0466959_0238683 | Ga0466959_0238683_219_941 | 225 |
| 49 | 3300045836 | Ga0466958_0018967 | Ga0466958_0018967_1817_2539 | 225 |
| 50 | 3300005344 | Ga0070661_100043949 | Ga0070661_1000439494 | 226 |
| 51 | 3300005344 | Ga0070661_100177689 | Ga0070661_1001776892 | 226 |
| 52 | 3300005471 | Ga0070698_100018504 | Ga0070698_1000185046 | 226 |
| 53 | 3300005530 | Ga0070679_100181840 | Ga0070679_1001818402 | 226 |
| 54 | 3300005539 | Ga0068853_100096021 | Ga0068853_1000960212 | 226 |
| 55 | 3300005563 | Ga0068855_100055072 | Ga0068855_1000550724 | 226 |
| 56 | 3300005564 | Ga0070664_100122628 | Ga0070664_1001226282 | 226 |
| 57 | 3300005614 | Ga0068856_100072473 | Ga0068856_1000724733 | 226 |
| 58 | 3300005616 | Ga0068852_100014630 | Ga0068852_1000146307 | 226 |
| 59 | 3300009174 | Ga0105241_10392785 | Ga0105241_103927852 | 226 |
| 60 | 3300013105 | Ga0157369_10019210 | Ga0157369_100192108 | 226 |
| 61 | 3300013307 | Ga0157372_10014221 | Ga0157372_100142217 | 226 |
| 62 | 3300013307 | Ga0157372_10149645 | Ga0157372_101496452 | 226 |
| 63 | 3300013307 | Ga0157372_10237316 | Ga0157372_102373163 | 226 |
| 64 | 3300025909 | Ga0207705_10052358 | Ga0207705_100523583 | 226 |
| 65 | 3300025911 | Ga0207654_10158791 | Ga0207654_101587912 | 226 |
| 66 | 3300025912 | Ga0207707_10003609 | Ga0207707_1000360911 | 226 |
| 67 | 3300025920 | Ga0207649_10079572 | Ga0207649_100795722 | 226 |
| 68 | 3300025920 | Ga0207649_10112478 | Ga0207649_101124782 | 226 |
| 69 | 3300025921 | Ga0207652_10174850 | Ga0207652_101748502 | 226 |
| 70 | 3300026078 | Ga0207702_10084040 | Ga0207702_100840403 | 226 |
| 71 | 3300026116 | Ga0207674_10042924 | Ga0207674_100429245 | 226 |
| 72 | 3300026142 | Ga0207698_10099905 | Ga0207698_100999052 | 226 |
| 73 | 3300035118 | Ga0373954_0000014 | Ga0373954_0000014_28764_29486 | 226 |
| 74 | 3300035410 | Ga0373924_0022995 | Ga0373924_0022995_1688_2410 | 226 |
| 75 | 3300035724 | Ga0373933_0002300 | Ga0373933_0002300_4627_5349 | 226 |
| 76 | 3300036401 | Ga0373937_0000218 | Ga0373937_0000218_27286_28008 | 226 |
| 77 | 3300042532 | Ga0450893_0013893 | Ga0450893_0013893_582_1307 | 226 |
| 78 | 3300044694 | Ga0466963_0089250 | Ga0466963_0089250_1346_2074 | 226 |
| 79 | 3300046462 | Ga0495651_0132892 | Ga0495651_0132892_223_945 | 226 |
| 80 | 3300048088 | Ga0495602_0277959 | Ga0495602_0277959_378_1100 | 226 |
| 81 | 3300031727 | Ga0316576_10006856 | Ga0316576_100068565 | 227 |
| 82 | 3300046664 | Ga0495659_0020683 | Ga0495659_0020683_1224_1946 | 227 |
| 83 | 3300005340 | Ga0070689_100118497 | Ga0070689_1001184973 | 228 |
| 84 | 3300005536 | Ga0070697_100203842 | Ga0070697_1002038423 | 228 |
| 85 | 3300005544 | Ga0070686_100177117 | Ga0070686_1001771172 | 228 |
| 86 | 3300006844 | Ga0075428_100000202 | Ga0075428_10000020247 | 228 |
| 87 | 3300006880 | Ga0075429_100000184 | Ga0075429_10000018448 | 228 |
| 88 | 3300009147 | Ga0114129_10000677 | Ga0114129_1000067749 | 228 |
| 89 | 3300035113 | Ga0373936_0047270 | Ga0373936_0047270_335_1057 | 228 |
| 90 | 3300035692 | Ga0373935_0030000 | Ga0373935_0030000_1444_2166 | 228 |
| 91 | 3300035695 | Ga0373927_0017581 | Ga0373927_0017581_307_1029 | 228 |
| 92 | 3300035725 | Ga0373947_0266850 | Ga0373947_0266850_256_978 | 228 |
| 93 | 3300037068 | Ga0373925_0010477 | Ga0373925_0010477_2246_2968 | 228 |
| 94 | 3300041410 | Ga0439461_0041784 | Ga0439461_0041784_229_951 | 228 |
| 95 | 3300047315 | Ga0495581_0244689 | Ga0495581_0244689_44_766 | 228 |
| 96 | 3300050515 | nmdc:mga0a205_485376_c1 | nmdc:mga0a205_485376_c1_138_860 | 228 |
| 97 | 3300009147 | Ga0114129_10817431 | Ga0114129_108174312 | 229 |
| 98 | 3300025929 | Ga0207664_10176265 | Ga0207664_101762653 | 229 |
| 99 | 3300025949 | Ga0207667_10210419 | Ga0207667_102104192 | 229 |
| 100 | 3300006844 | Ga0075428_100209494 | Ga0075428_1002094942 | 231 |
| 101 | 3300006880 | Ga0075429_100004272 | Ga0075429_10000427214 | 231 |
| 102 | 3300007265 | Ga0099794_10117441 | Ga0099794_101174412 | 231 |
| 103 | 3300009147 | Ga0114129_10090138 | Ga0114129_100901382 | 231 |
| 104 | 3300027671 | Ga0209588_1022154 | Ga0209588_10221542 | 231 |
| 105 | 3300036401 | Ga0373937_0049232 | Ga0373937_0049232_2210_2932 | 231 |
| 106 | 3300042436 | Ga0439435_0000340 | Ga0439435_0000340_2870_3592 | 231 |
| 107 | 3300046454 | Ga0495592_0007798 | Ga0495592_0007798_5664_6386 | 231 |
| 108 | 3300046476 | Ga0495662_0005722 | Ga0495662_0005722_3588_4310 | 231 |
| 109 | 3300046516 | Ga0495628_0005080 | Ga0495628_0005080_4415_5137 | 231 |
| 110 | 3300046533 | Ga0495640_0030961 | Ga0495640_0030961_2322_3044 | 231 |
| 111 | 3300046642 | Ga0495634_0022994 | Ga0495634_0022994_2152_2874 | 231 |
| 112 | 3300046663 | Ga0495635_0100811 | Ga0495635_0100811_260_982 | 231 |
| 113 | 3300046689 | Ga0495613_0175836 | Ga0495613_0175836_572_1294 | 231 |
| 114 | 3300046690 | Ga0495624_0151061 | Ga0495624_0151061_65_787 | 231 |
| 115 | 3300047317 | Ga0495604_0048208 | Ga0495604_0048208_2551_3273 | 231 |
| 116 | 3300047318 | Ga0495636_0052650 | Ga0495636_0052650_79_801 | 231 |
| 117 | 3300047322 | Ga0495680_0011731 | Ga0495680_0011731_4363_5085 | 231 |
| 118 | 3300049574 | Ga0501038_0361278 | Ga0501038_0361278_271_1014 | 231 |
| 119 | 3300049578 | Ga0501042_0402177 | Ga0501042_0402177_233_976 | 231 |
| 120 | 3300049587 | Ga0501071_0211726 | Ga0501071_0211726_664_1407 | 231 |
| 121 | 3300049588 | Ga0501072_0098416 | Ga0501072_0098416_1454_2197 | 231 |
| 122 | 3300049591 | Ga0501075_0238456 | Ga0501075_0238456_356_1099 | 231 |
| 123 | 3300049741 | Ga0501079_0336967 | Ga0501079_0336967_357_1100 | 231 |
| 124 | 3300049742 | Ga0501080_0355542 | Ga0501080_0355542_139_882 | 231 |
| 125 | 3300049824 | Ga0501045_0247785 | Ga0501045_0247785_116_859 | 231 |
| 126 | 3300050507 | nmdc:mga05p37_39402_c1 | nmdc:mga05p37_39402_c1_4896_5624 | 231 |
| 127 | 3300050508 | nmdc:mga09592_13045_c1 | nmdc:mga09592_13045_c1_585_1313 | 231 |
| 128 | 3300050510 | nmdc:mga06r32_431911_c1 | nmdc:mga06r32_431911_c1_314_1042 | 231 |
| 129 | 3300050513 | nmdc:mga0rr50_374822_c1 | nmdc:mga0rr50_374822_c1_138_863 | 231 |
| 130 | 3300054114 | Ga0501084_0338395 | Ga0501084_0338395_338_1081 | 231 |
| 131 | 3300060353 | Ga0501082_0245144 | Ga0501082_0245144_711_1454 | 231 |
| 132 | 3300061734 | Ga0530510_0237829 | Ga0530510_0237829_564_1307 | 231 |
| 133 | 3300031616 | Ga0307508_10372057 | Ga0307508_103720572 | 232 |
| 134 | 3300050509 | nmdc:mga0qj67_94263_c1 | nmdc:mga0qj67_94263_c1_935_1681 | 233 |
| 135 | 3300035692 | Ga0373935_0007820 | Ga0373935_0007820_1747_2472 | 239 |
| 136 | 3300005330 | Ga0070690_100003552 | Ga0070690_1000035526 | 240 |
| 137 | 3300005334 | Ga0068869_100004021 | Ga0068869_1000040216 | 240 |
| 138 | 3300005335 | Ga0070666_10159553 | Ga0070666_101595532 | 240 |
| 139 | 3300005336 | Ga0070680_100013530 | Ga0070680_1000135303 | 240 |
| 140 | 3300005336 | Ga0070680_100105572 | Ga0070680_1001055722 | 240 |
| 141 | 3300005337 | Ga0070682_100006656 | Ga0070682_1000066566 | 240 |
| 142 | 3300005338 | Ga0068868_100020871 | Ga0068868_1000208716 | 240 |
| 143 | 3300005340 | Ga0070689_100003236 | Ga0070689_1000032367 | 240 |
| 144 | 3300005341 | Ga0070691_10000625 | Ga0070691_1000062512 | 240 |
| 145 | 3300005343 | Ga0070687_100000952 | Ga0070687_1000009526 | 240 |
| 146 | 3300005345 | Ga0070692_10000171 | Ga0070692_100001716 | 240 |
| 147 | 3300005353 | Ga0070669_100186092 | Ga0070669_1001860922 | 240 |
| 148 | 3300005353 | Ga0070669_100598143 | Ga0070669_1005981432 | 240 |
| 149 | 3300005364 | Ga0070673_100074354 | Ga0070673_1000743544 | 240 |
| 150 | 3300005438 | Ga0070701_10002853 | Ga0070701_100028533 | 240 |
| 151 | 3300005440 | Ga0070705_100001385 | Ga0070705_1000013859 | 240 |
| 152 | 3300005440 | Ga0070705_100138903 | Ga0070705_1001389032 | 240 |
| 153 | 3300005441 | Ga0070700_100004484 | Ga0070700_1000044848 | 240 |
| 154 | 3300005444 | Ga0070694_100003309 | Ga0070694_1000033096 | 240 |
| 155 | 3300005444 | Ga0070694_100380539 | Ga0070694_1003805392 | 240 |
| 156 | 3300005456 | Ga0070678_100023449 | Ga0070678_1000234496 | 240 |
| 157 | 3300005459 | Ga0068867_100003994 | Ga0068867_1000039946 | 240 |
| 158 | 3300005530 | Ga0070679_100020633 | Ga0070679_1000206332 | 240 |
| 159 | 3300005544 | Ga0070686_100003129 | Ga0070686_1000031296 | 240 |
| 160 | 3300005544 | Ga0070686_100275539 | Ga0070686_1002755391 | 240 |
| 161 | 3300005545 | Ga0070695_100000140 | Ga0070695_1000001403 | 240 |
| 162 | 3300005546 | Ga0070696_100000008 | Ga0070696_100000008104 | 240 |
| 163 | 3300005547 | Ga0070693_100000154 | Ga0070693_1000001549 | 240 |
| 164 | 3300005549 | Ga0070704_100000956 | Ga0070704_10000095618 | 240 |
| 165 | 3300005549 | Ga0070704_100004775 | Ga0070704_1000047759 | 240 |
| 166 | 3300005563 | Ga0068855_100015523 | Ga0068855_1000155238 | 240 |
| 167 | 3300005578 | Ga0068854_100380559 | Ga0068854_1003805592 | 240 |
| 168 | 3300005614 | Ga0068856_100015177 | Ga0068856_1000151775 | 240 |
| 169 | 3300005615 | Ga0070702_100000421 | Ga0070702_1000004213 | 240 |
| 170 | 3300005616 | Ga0068852_100129271 | Ga0068852_1001292712 | 240 |
| 171 | 3300005617 | Ga0068859_100002186 | Ga0068859_1000021867 | 240 |
| 172 | 3300005718 | Ga0068866_10002041 | Ga0068866_100020417 | 240 |
| 173 | 3300005719 | Ga0068861_100006714 | Ga0068861_1000067146 | 240 |
| 174 | 3300005841 | Ga0068863_100158087 | Ga0068863_1001580873 | 240 |
| 175 | 3300005842 | Ga0068858_100012318 | Ga0068858_1000123187 | 240 |
| 176 | 3300005843 | Ga0068860_100009594 | Ga0068860_1000095947 | 240 |
| 177 | 3300005844 | Ga0068862_100006076 | Ga0068862_1000060767 | 240 |
| 178 | 3300006237 | Ga0097621_100003516 | Ga0097621_1000035167 | 240 |
| 179 | 3300006358 | Ga0068871_100000152 | Ga0068871_1000001529 | 240 |
| 180 | 3300006846 | Ga0075430_100081967 | Ga0075430_1000819673 | 240 |
| 181 | 3300006871 | Ga0075434_100029724 | Ga0075434_1000297245 | 240 |
| 182 | 3300006881 | Ga0068865_100005212 | Ga0068865_1000052126 | 240 |
| 183 | 3300006931 | Ga0097620_100002187 | Ga0097620_1000021877 | 240 |
| 184 | 3300009098 | Ga0105245_10007290 | Ga0105245_100072907 | 240 |
| 185 | 3300009148 | Ga0105243_10007189 | Ga0105243_100071896 | 240 |
| 186 | 3300009174 | Ga0105241_10013561 | Ga0105241_100135612 | 240 |
| 187 | 3300009176 | Ga0105242_10004711 | Ga0105242_100047117 | 240 |
| 188 | 3300009177 | Ga0105248_10765610 | Ga0105248_107656102 | 240 |
| 189 | 3300009553 | Ga0105249_10005527 | Ga0105249_100055278 | 240 |
| 190 | 3300010375 | Ga0105239_10015553 | Ga0105239_100155536 | 240 |
| 191 | 3300011119 | Ga0105246_10115080 | Ga0105246_101150803 | 240 |
| 192 | 3300012498 | Ga0157345_1007163 | Ga0157345_10071631 | 240 |
| 193 | 3300013105 | Ga0157369_10744697 | Ga0157369_107446972 | 240 |
| 194 | 3300013297 | Ga0157378_10007547 | Ga0157378_100075477 | 240 |
| 195 | 3300013308 | Ga0157375_10181088 | Ga0157375_101810882 | 240 |
| 196 | 3300014968 | Ga0157379_10282335 | Ga0157379_102823351 | 240 |
| 197 | 3300014969 | Ga0157376_10055681 | Ga0157376_100556812 | 240 |
| 198 | 3300025899 | Ga0207642_10002187 | Ga0207642_100021876 | 240 |
| 199 | 3300025901 | Ga0207688_10038449 | Ga0207688_100384492 | 240 |
| 200 | 3300025907 | Ga0207645_10025549 | Ga0207645_100255492 | 240 |
| 201 | 3300025908 | Ga0207643_10049140 | Ga0207643_100491401 | 240 |
| 202 | 3300025917 | Ga0207660_10010473 | Ga0207660_100104736 | 240 |
| 203 | 3300025918 | Ga0207662_10001772 | Ga0207662_100017728 | 240 |
| 204 | 3300025918 | Ga0207662_10126964 | Ga0207662_101269642 | 240 |
| 205 | 3300025921 | Ga0207652_10003546 | Ga0207652_100035467 | 240 |
| 206 | 3300025926 | Ga0207659_10539977 | Ga0207659_105399771 | 240 |
| 207 | 3300025927 | Ga0207687_10001190 | Ga0207687_100011908 | 240 |
| 208 | 3300025934 | Ga0207686_10000246 | Ga0207686_100002466 | 240 |
| 209 | 3300025935 | Ga0207709_10003128 | Ga0207709_100031288 | 240 |
| 210 | 3300025936 | Ga0207670_10000747 | Ga0207670_1000074713 | 240 |
| 211 | 3300025938 | Ga0207704_10001629 | Ga0207704_100016298 | 240 |
| 212 | 3300025941 | Ga0207711_10092090 | Ga0207711_100920902 | 240 |
| 213 | 3300025942 | Ga0207689_10007929 | Ga0207689_100079296 | 240 |
| 214 | 3300025949 | Ga0207667_10010577 | Ga0207667_100105776 | 240 |
| 215 | 3300025961 | Ga0207712_10001322 | Ga0207712_100013228 | 240 |
| 216 | 3300025981 | Ga0207640_10169618 | Ga0207640_101696183 | 240 |
| 217 | 3300026023 | Ga0207677_10008880 | Ga0207677_100088802 | 240 |
| 218 | 3300026035 | Ga0207703_10008914 | Ga0207703_100089146 | 240 |
| 219 | 3300026041 | Ga0207639_10376553 | Ga0207639_103765532 | 240 |
| 220 | 3300026075 | Ga0207708_10000601 | Ga0207708_1000060115 | 240 |
| 221 | 3300026078 | Ga0207702_10018247 | Ga0207702_100182474 | 240 |
| 222 | 3300026089 | Ga0207648_10002542 | Ga0207648_1000254220 | 240 |
| 223 | 3300026118 | Ga0207675_100009511 | Ga0207675_1000095115 | 240 |
| 224 | 3300026121 | Ga0207683_10075461 | Ga0207683_100754612 | 240 |
| 225 | 3300026142 | Ga0207698_10134858 | Ga0207698_101348582 | 240 |
| 226 | 3300027907 | Ga0207428_10000453 | Ga0207428_1000045324 | 240 |
| 227 | 3300028380 | Ga0268265_10005081 | Ga0268265_100050816 | 240 |
| 228 | 3300028381 | Ga0268264_10009530 | Ga0268264_100095306 | 240 |
| 229 | 3300034816 | Ga0373930_0016484 | Ga0373930_0016484_291_1013 | 240 |
| 230 | 3300034818 | Ga0373950_0006866 | Ga0373950_0006866_819_1541 | 240 |
| 231 | 3300035084 | Ga0373928_0002911 | Ga0373928_0002911_253_975 | 240 |
| 232 | 3300035084 | Ga0373928_0039024 | Ga0373928_0039024_255_977 | 240 |
| 233 | 3300035090 | Ga0373949_0006258 | Ga0373949_0006258_1881_2603 | 240 |
| 234 | 3300035115 | Ga0373941_0006951 | Ga0373941_0006951_1995_2717 | 240 |
| 235 | 3300035117 | Ga0373953_0062634 | Ga0373953_0062634_266_988 | 240 |
| 236 | 3300035172 | Ga0373955_0346939 | Ga0373955_0346939_132_854 | 240 |
| 237 | 3300035242 | Ga0373962_0012010 | Ga0373962_0012010_1193_1915 | 240 |
| 238 | 3300035691 | Ga0373931_0005178 | Ga0373931_0005178_5081_5803 | 240 |
| 239 | 3300035724 | Ga0373933_0070383 | Ga0373933_0070383_532_1254 | 240 |
| 240 | 3300036401 | Ga0373937_0227231 | Ga0373937_0227231_775_1497 | 240 |
| 241 | 3300036401 | Ga0373937_0601795 | Ga0373937_0601795_149_871 | 240 |
| 242 | 3300044712 | Ga0453684_0052853 | Ga0453684_0052853_3923_4648 | 240 |
| 243 | 3300045051 | Ga0451576_0533263 | Ga0451576_0533263_33_755 | 240 |
| 244 | 3300046454 | Ga0495592_0185258 | Ga0495592_0185258_359_1081 | 240 |
| 245 | 3300046476 | Ga0495662_0075257 | Ga0495662_0075257_348_1070 | 240 |
| 246 | 3300046516 | Ga0495628_0049048 | Ga0495628_0049048_2359_3081 | 240 |
| 247 | 3300046529 | Ga0495652_0324884 | Ga0495652_0324884_239_961 | 240 |
| 248 | 3300046664 | Ga0495659_0020909 | Ga0495659_0020909_54_776 | 240 |
| 249 | 3300046684 | Ga0495669_0003720 | Ga0495669_0003720_1878_2600 | 240 |
| 250 | 3300047673 | Ga0495593_0121089 | Ga0495593_0121089_546_1268 | 240 |
| 251 | 3300049574 | Ga0501038_0161591 | Ga0501038_0161591_485_1207 | 240 |
| 252 | 3300049575 | Ga0501039_0355058 | Ga0501039_0355058_203_925 | 240 |
| 253 | 3300049576 | Ga0501040_0108584 | Ga0501040_0108584_57_779 | 240 |
| 254 | 3300049591 | Ga0501075_0081082 | Ga0501075_0081082_1654_2376 | 240 |
| 255 | 3300049824 | Ga0501045_0098593 | Ga0501045_0098593_815_1537 | 240 |
| 256 | 3300049824 | Ga0501045_0309078 | Ga0501045_0309078_88_810 | 240 |
| 257 | 3300050509 | nmdc:mga0qj67_28305_c1 | nmdc:mga0qj67_28305_c1_2198_2920 | 240 |
| 258 | 3300050512 | nmdc:mga0n895_5601_c1 | nmdc:mga0n895_5601_c1_3947_4669 | 240 |
| 259 | 3300053077 | Ga0495601_0166595 | Ga0495601_0166595_459_1181 | 240 |
| 260 | 3300005436 | Ga0070713_100074332 | Ga0070713_1000743323 | 241 |
| 261 | 3300036401 | Ga0373937_0080227 | Ga0373937_0080227_1197_1922 | 241 |
| 262 | 3300042876 | Ga0451577_0202923 | Ga0451577_0202923_189_938 | 241 |
| 263 | 3300049579 | Ga0501043_0583144 | Ga0501043_0583144_18_743 | 241 |
| 264 | 3300049667 | Ga0501230_004093 | Ga0501230_004093_984_1709 | 241 |
| 265 | 3300005295 | Ga0065707_10131581 | Ga0065707_101315812 | 242 |
| 266 | 3300005444 | Ga0070694_100080997 | Ga0070694_1000809973 | 242 |
| 267 | 3300005545 | Ga0070695_100226718 | Ga0070695_1002267182 | 242 |
| 268 | 3300005549 | Ga0070704_100149941 | Ga0070704_1001499412 | 242 |
| 269 | 3300005549 | Ga0070704_100181550 | Ga0070704_1001815502 | 242 |
| 270 | 3300005617 | Ga0068859_100922168 | Ga0068859_1009221682 | 242 |
| 271 | 3300006931 | Ga0097620_100922228 | Ga0097620_1009222282 | 242 |
| 272 | 3300009094 | Ga0111539_10711994 | Ga0111539_107119942 | 242 |
| 273 | 3300025949 | Ga0207667_10092435 | Ga0207667_100924354 | 242 |
| 274 | 3300027395 | Ga0209996_1013635 | Ga0209996_10136352 | 242 |
| 275 | 3300031665 | Ga0316575_10002726 | Ga0316575_100027266 | 242 |
| 276 | 3300035398 | Ga0316574_0001392 | Ga0316574_0001392_5298_6116 | 242 |
| 277 | 3300039110 | Ga0400487_04715 | Ga0400487_04715_3998_4744 | 242 |
| 278 | 3300046472 | Ga0495580_0088975 | Ga0495580_0088975_92_820 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kon-assembly1.cif.gz_A | crystal structure of e.coli yebc | 0.9007 | 3 | 241 |
| 1kon-assembly1.cif.gz_A | crystal structure of e.coli yebc | 0.8754 | 3 | 241 |
| 1lfp-assembly1.cif.gz_A | crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus | 0.8544 | 18 | 242 |
| 1mw7-assembly1.cif.gz_A | x-ray structure of y162_helpy northeast structural genomics consortium target pr6 | 0.8113 | 24 | 238 |
| 4f3q-assembly1.cif.gz_A | structure of a yebc family protein (cbu_1566) from coxiella burnetii | 0.8051 | 6 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lfpA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9611 | 82 | 242 | 3.30.70.980 |
| 1mw7A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9262 | 24 | 77 | 1.10.10.200 |
| 1mw7A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9144 | 83 | 238 | 3.30.70.980 |
| 1lfpA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9104 | 82 | 242 | 3.30.70.980 |
| 1lfpA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9088 | 19 | 79 | 1.10.10.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9L7U6-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9937 | 61 | 241 |
GO:0003677
GO:0005829 |
| AF-A0A3B9L7U6-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9883 | 61 | 241 |
GO:0003677
GO:0005829 |
| AF-A0A258LN40-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9821 | 134 | 239 |
GO:0003677
GO:0005829 |
| AF-Q3A233-F1-model_v4 | Probable transcriptional regulatory protein Pcar_2335 | 0.9776 | 1 | 237 |
GO:0003677
GO:0005829 GO:0006355 |
| AF-A0A7Z9XSW8-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9765 | 79 | 241 |
GO:0003677
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar