F382493

General Info

Members Datasets Scaffolds Average Seq Length
278 201 556 150

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10052430|Ga0307510_100524303
Length 171
Sequence MQTTLEAPKLSNRIDYAKASPEPYKAFGGVHVSVQKSGLPQELINLVYLRVSQINGCAYCIDMHSRDLLRLGVPVNKLVLVPVWHEAGKVFSTRERRALAWAETVTRVAETGVPDVDYEAAAAEFSDKELADLTYAIALMNAFNRLGVTFRMPPAAAVNAATSVDGLAAAR

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
77 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
78 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
183 2511231021 Pseudomonas sp. GM78 Isolate Nodule
184 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
185 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
186 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
187 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
188 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
189 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
190 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
191 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
192 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
193 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
194 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
195 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
196 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
197 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
198 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
199 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
200 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
201 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 1.44
Rhizoplane 5.4
Rhizosphere 77.7
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10052430 3300033180 Bacteria 4300
2 Ga0058692_1004318 3300003856 Bacteria 4231
3 Ga0065165_1054079 3300005262 Bacteria 1126
4 Ga0070658_10080662 3300005327 Bacteria 2672
5 Ga0070675_101104082 3300005354 Unclassified 729
6 Ga0070673_100782293 3300005364 Bacteria 880
7 Ga0070667_100079034 3300005367 Bacteria 2811
8 Ga0070714_100068156 3300005435 Bacteria 3070
9 Ga0070663_100086657 3300005455 Bacteria 2313
10 Ga0070698_101134826 3300005471 Unclassified 730
11 Ga0070699_100948202 3300005518 Bacteria 788
12 Ga0068853_100100485 3300005539 Bacteria 2557
13 Ga0081540_1000537 3300005983 Bacteria 36699
14 Ga0070716_100837295 3300006173 Bacteria 715
15 Ga0070712_100348200 3300006175 Bacteria 1212
16 Ga0075427_10022394 3300006194 Bacteria 1009
17 Ga0075430_100128226 3300006846 Bacteria 2115
18 Ga0075433_10249087 3300006852 Bacteria 1576
19 Ga0075429_100471070 3300006880 Bacteria 1100
20 Ga0079104_1000400 3300006946 Bacteria 50257
21 Ga0079104_1009116 3300006946 Bacteria 3389
22 Ga0075435_100415402 3300007076 Bacteria 1158
23 Ga0105251_10004839 3300009011 Bacteria 8993
24 Ga0105251_10511332 3300009011 Bacteria 562
25 Ga0105244_10000019 3300009036 Bacteria 242333
26 Ga0105244_10000212 3300009036 Bacteria 60003
27 Ga0105244_10000397 3300009036 Bacteria 40343
28 Ga0105250_10000511 3300009092 Bacteria 27137
29 Ga0105250_10228899 3300009092 Bacteria 790
30 Ga0105240_10000333 3300009093 Bacteria 88420
31 Ga0111539_10018003 3300009094 Bacteria 8750
32 Ga0111539_10126507 3300009094 Bacteria 2994
33 Ga0111539_11499306 3300009094 Bacteria 782
34 Ga0105245_10702999 3300009098 Bacteria 1044
35 Ga0105247_11190889 3300009101 Bacteria 606
36 Ga0114129_10753399 3300009147 Bacteria 1246
37 Ga0105248_10147355 3300009177 Bacteria 2656
38 Ga0105246_10816723 3300011119 Bacteria 829
39 Ga0157373_10042913 3300013100 Bacteria 3231
40 Ga0157373_10698798 3300013100 Bacteria 743
41 Ga0157371_10096203 3300013102 Bacteria 2098
42 Ga0157371_10582570 3300013102 Bacteria 831
43 Ga0157370_10000339 3300013104 Bacteria 58956
44 Ga0157370_10007879 3300013104 Bacteria 11545
45 Ga0157374_10402543 3300013296 Bacteria 1366
46 Ga0157374_10715812 3300013296 Bacteria 1015
47 Ga0163162_10013377 3300013306 Bacteria 8015
48 Ga0163162_11541135 3300013306 Unclassified 757
49 Ga0157375_10028973 3300013308 Bacteria 5201
50 Ga0182008_10000330 3300014497 Bacteria 37364
51 Ga0182006_1000069 3300015261 Bacteria 140097
52 Ga0182006_1004527 3300015261 Bacteria 6842
53 Ga0182006_1021732 3300015261 Bacteria 2672
54 Ga0163161_10000042 3300017792 Bacteria 135368
55 Ga0163161_10576298 3300017792 Bacteria 925
56 Ga0213872_10000706 3300021361 Bacteria 25131
57 Ga0209130_1001146 3300025284 Bacteria 19353
58 Ga0209675_1001594 3300025291 Bacteria 12814
59 Ga0209676_1027424 3300025292 Bacteria 1793
60 Ga0207426_1139531 3300025302 Bacteria 577
61 Ga0207696_1000008 3300025711 Bacteria 568181
62 Ga0207696_1000012 3300025711 Bacteria 527363
63 Ga0207696_1000024 3300025711 Bacteria 420123
64 Ga0207655_1000025 3300025728 Bacteria 449261
65 Ga0207655_1000044 3300025728 Bacteria 327511
66 Ga0207655_1000088 3300025728 Bacteria 205698
67 Ga0207655_1002760 3300025728 Bacteria 13697
68 Ga0207713_1000129 3300025735 Bacteria 116027
69 Ga0207713_1000223 3300025735 Bacteria 76591
70 Ga0207680_10177410 3300025903 Bacteria 1439
71 Ga0207685_10514845 3300025905 Unclassified 631
72 Ga0207705_10868304 3300025909 Bacteria 699
73 Ga0207693_10555213 3300025915 Unclassified 895
74 Ga0207663_10172370 3300025916 Bacteria 1538
75 Ga0207659_10511988 3300025926 Bacteria 1017
76 Ga0207664_10127810 3300025929 Bacteria 2135
77 Ga0207711_10093121 3300025941 Bacteria 2654
78 Ga0207711_10127187 3300025941 Bacteria 2281
79 Ga0207668_11691524 3300025972 Unclassified 571
80 Ga0207639_10093334 3300026041 Bacteria 2413
81 Ga0207678_10057561 3300026067 Bacteria 3345
82 Ga0207648_10190085 3300026089 Bacteria 1819
83 Ga0209281_1005816 3300027111 Bacteria 3327
84 Ga0209371_1000032 3300027312 Bacteria 392355
85 Ga0207428_10008096 3300027907 Bacteria 9530
86 Ga0207428_10058611 3300027907 Bacteria 3055
87 Ga0268256_1000555 3300030500 Bacteria 30349
88 Ga0307512_10261533 3300030522 Bacteria 849
89 Ga0307513_10007102 3300031456 Bacteria 14562
90 Ga0307412_10154982 3300031911 Bacteria 1695
91 Ga0307412_10167310 3300031911 Bacteria 1640
92 Ga0307409_101919336 3300031995 Bacteria 622
93 Ga0307416_100078275 3300032002 Bacteria 2781
94 Ga0307416_100911703 3300032002 Bacteria 979
95 Ga0373931_0506910 3300035691 Bacteria 779
96 Ga0395899_0098518 3300037312 Bacteria 2112
97 Ga0395900_0074203 3300037418 Bacteria 3498
98 Ga0395901_0120331 3300038443 Bacteria 2759
99 Ga0436360_0608751 3300039438 Bacteria 1552
100 Ga0436361_0489517 3300039447 Bacteria 30552
101 Ga0451802_2151319 3300041460 Bacteria 649
102 Ga0439452_000013 3300042010 Bacteria 364058
103 Ga0439464_0004901 3300042439 Bacteria 3436
104 Ga0466969_0030491 3300044656 Bacteria 2747
105 Ga0466966_0064329 3300044684 Bacteria 2309
106 Ga0466959_0094621 3300045049 Bacteria 2143
107 Ga0495617_022569 3300046452 Bacteria 2127
108 Ga0495627_033801 3300046453 Bacteria 1601
109 Ga0495603_0155619 3300046455 Bacteria 1326
110 Ga0495590_0096734 3300046457 Bacteria 1047
111 Ga0495591_000021 3300046458 Bacteria 203554
112 Ga0495591_005570 3300046458 Bacteria 5791
113 Ga0495629_0121396 3300046459 Bacteria 1820
114 Ga0495638_0002796 3300046460 Bacteria 14002
115 Ga0495638_0015088 3300046460 Bacteria 5197
116 Ga0495651_0032932 3300046462 Bacteria 4042
117 Ga0495653_0005021 3300046463 Bacteria 10737
118 Ga0495653_0024753 3300046463 Bacteria 4832
119 Ga0495653_0185624 3300046463 Bacteria 1423
120 Ga0495650_0001142 3300046471 Bacteria 28785
121 Ga0495650_0013325 3300046471 Bacteria 4354
122 Ga0495580_0532416 3300046472 Bacteria 782
123 Ga0495582_0397445 3300046473 Bacteria 795
124 Ga0495605_0108829 3300046474 Bacteria 1266
125 Ga0495664_0000738 3300046477 Bacteria 16711
126 Ga0495585_0000322 3300046492 Bacteria 47213
127 Ga0495585_0033455 3300046492 Bacteria 2909
128 Ga0495596_0000012 3300046500 Bacteria 125996
129 Ga0495606_0001060 3300046507 Bacteria 39739
130 Ga0495606_0001580 3300046507 Bacteria 29797
131 Ga0495606_0031004 3300046507 Bacteria 3723
132 Ga0495610_0036960 3300046512 Bacteria 2490
133 Ga0495616_0043488 3300046513 Bacteria 2281
134 Ga0495620_0001348 3300046515 Bacteria 14884
135 Ga0495620_0006894 3300046515 Bacteria 6207
136 Ga0495628_0039057 3300046516 Bacteria 3797
137 Ga0495628_0290146 3300046516 Bacteria 1213
138 Ga0495630_0006654 3300046517 Bacteria 8237
139 Ga0495631_0016239 3300046518 Bacteria 3554
140 Ga0495632_0001831 3300046519 Bacteria 17126
141 Ga0495637_0000505 3300046520 Bacteria 28339
142 Ga0495643_0046042 3300046522 Bacteria 2367
143 Ga0495644_0012555 3300046523 Bacteria 3256
144 Ga0495648_0030412 3300046524 Bacteria 3570
145 Ga0495666_0147174 3300046526 Bacteria 1096
146 Ga0495652_0005050 3300046529 Bacteria 12490
147 Ga0495652_0026805 3300046529 Bacteria 5085
148 Ga0495654_0009143 3300046530 Bacteria 5433
149 Ga0495665_0000030 3300046531 Bacteria 54150
150 Ga0495609_0451173 3300046538 Bacteria 511
151 Ga0495597_0019798 3300046542 Bacteria 3142
152 Ga0495645_0112220 3300046543 Bacteria 1928
153 Ga0495645_0230493 3300046543 Bacteria 1241
154 Ga0495668_0000176 3300046616 Bacteria 95098
155 Ga0495625_0008290 3300046660 Bacteria 8881
156 Ga0495635_0002433 3300046663 Bacteria 12699
157 Ga0495635_0559274 3300046663 Bacteria 749
158 Ga0495661_0000014 3300046665 Bacteria 258915
159 Ga0495661_0024735 3300046665 Bacteria 3887
160 Ga0495588_0020052 3300046674 Bacteria 3280
161 Ga0495599_0015208 3300046678 Bacteria 4772
162 Ga0495599_0245351 3300046678 Bacteria 1091
163 Ga0495623_0000660 3300046679 Bacteria 22917
164 Ga0495646_0000611 3300046680 Bacteria 19461
165 Ga0495669_0055252 3300046684 Bacteria 1788
166 Ga0495624_0000848 3300046690 Bacteria 24238
167 Ga0495670_0076809 3300046691 Bacteria 1697
168 Ga0495671_0014969 3300046692 Bacteria 4167
169 Ga0495649_0002561 3300046694 Bacteria 12730
170 Ga0495649_0006499 3300046694 Bacteria 7274
171 Ga0495649_0017390 3300046694 Bacteria 4056
172 Ga0495649_0201877 3300046694 Bacteria 1032
173 Ga0495589_0000820 3300046794 Bacteria 19640
174 Ga0495589_0128074 3300046794 Bacteria 1220
175 Ga0495600_0018736 3300046809 Bacteria 4415
176 Ga0495600_0386682 3300046809 Bacteria 872
177 Ga0495660_0019105 3300046810 Bacteria 3934
178 Ga0495604_0004262 3300047317 Bacteria 11324
179 Ga0495604_0059757 3300047317 Bacteria 2921
180 Ga0495674_0000146 3300047319 Bacteria 54437
181 Ga0495674_0481057 3300047319 Bacteria 995
182 Ga0495676_0819529 3300047321 Bacteria 599
183 Ga0495680_0006265 3300047322 Bacteria 11086
184 Ga0495683_0008737 3300047323 Bacteria 5406
185 Ga0495683_0094534 3300047323 Bacteria 1444
186 Ga0495683_0165142 3300047323 Bacteria 1021
187 Ga0495675_0046105 3300047444 Bacteria 2776
188 Ga0495679_004382 3300047446 Bacteria 6534
189 Ga0495679_014552 3300047446 Bacteria 2909
190 Ga0495673_0014471 3300047469 Bacteria 4100
191 Ga0495681_0002715 3300047470 Bacteria 12519
192 Ga0495686_0022741 3300047472 Bacteria 4144
193 Ga0495686_0241724 3300047472 Unclassified 1018
194 Ga0495593_0000525 3300047673 Bacteria 21741
195 Ga0495602_0001755 3300048088 Bacteria 21647
196 Ga0495602_0284587 3300048088 Bacteria 1216
197 Ga0495614_0135538 3300048089 Bacteria 1092
198 Ga0495614_0214735 3300048089 Bacteria 873
199 Ga0495626_0000143 3300048091 Bacteria 90432
200 Ga0496100_0084551 3300048903 Bacteria 2151
201 Ga0496101_0089544 3300048904 Bacteria 2287
202 Ga0496102_0012134 3300048905 Bacteria 7446
203 Ga0496102_0101514 3300048905 Bacteria 2673
204 Ga0496103_0166002 3300048906 Bacteria 1416
205 Ga0496104_0012802 3300048907 Bacteria 7556
206 Ga0496104_0076828 3300048907 Bacteria 3181
207 Ga0496105_0006733 3300048908 Bacteria 8837
208 Ga0496105_0224527 3300048908 Bacteria 1528
209 Ga0496106_0000005 3300048909 Bacteria 273394
210 Ga0496106_0106668 3300048909 Bacteria 2178
211 Ga0496115_0000191 3300048918 Bacteria 56876
212 Ga0496115_0002784 3300048918 Bacteria 12569
213 Ga0496115_0465243 3300048918 Bacteria 1020
214 Ga0496116_0040506 3300048919 Bacteria 3208
215 Ga0496117_0001391 3300048920 Bacteria 35099
216 Ga0496117_0013888 3300048920 Bacteria 6982
217 Ga0496117_0137961 3300048920 Bacteria 1466
218 Ga0496118_0000167 3300048921 Bacteria 119146
219 Ga0496118_0004151 3300048921 Bacteria 17500
220 Ga0496118_0006781 3300048921 Bacteria 12446
221 Ga0496118_0610959 3300048921 Bacteria 520
222 Ga0496119_0000771 3300048922 Bacteria 43013
223 Ga0496119_0375727 3300048922 Bacteria 683
224 Ga0496120_0001042 3300048923 Bacteria 37079
225 Ga0496121_0000083 3300048924 Bacteria 226816
226 Ga0496121_0035672 3300048924 Bacteria 4451
227 Ga0496122_0041373 3300048925 Bacteria 3645
228 Ga0496122_0051745 3300048925 Bacteria 3117
229 Ga0496123_0162016 3300048926 Bacteria 1191
230 Ga0496124_0000981 3300048927 Bacteria 45334
231 Ga0496124_0008740 3300048927 Bacteria 10521
232 Ga0496124_0035709 3300048927 Bacteria 4347
233 Ga0496126_0000996 3300048929 Bacteria 48318
234 Ga0496126_0092626 3300048929 Bacteria 2655
235 Ga0496126_0302492 3300048929 Bacteria 1319
236 Ga0496126_0344798 3300048929 Bacteria 1219
237 Ga0496126_1219329 3300048929 Bacteria 552
238 Ga0495678_017039 3300049459 Bacteria 3303
239 Ga0495678_017064 3300049459 Bacteria 3300
240 Ga0501033_0348675 3300049570 Bacteria 1037
241 Ga0501034_0484276 3300049571 Bacteria 1152
242 Ga0501036_0223357 3300049572 Bacteria 1581
243 Ga0501043_0101583 3300049579 Bacteria 2260
244 Ga0501047_0033597 3300049581 Bacteria 4950
245 Ga0501047_0053150 3300049581 Bacteria 3916
246 Ga0501083_0488878 3300049744 Bacteria 801
247 Ga0501044_0021859 3300049823 Bacteria 6821
248 nmdc:mga06z11_595711_c1 3300050494 Bacteria 672
249 nmdc:mga05p37_44698_c1 3300050507 Bacteria 5450
250 nmdc:mga0qj67_27669_c1 3300050509 Bacteria 4396
251 nmdc:mga06r32_50721_c1 3300050510 Bacteria 3969
252 nmdc:mga08y16_36526_c1 3300050511 Bacteria 5160
253 nmdc:mga08y16_54168_c1 3300050511 Bacteria 4192
254 nmdc:mga08y16_58336_c1 3300050511 Bacteria 4034
255 nmdc:mga08x19_548053_c1 3300050514 Bacteria 818
256 nmdc:mga0a205_69247_c1 3300050515 Bacteria 3408
257 Ga0500644_0342360 3300053088 Bacteria 646
258 Ga0500595_026300 3300053119 Bacteria 2007
259 Ga0500661_006306 3300055283 Bacteria 2207
260 2511358950 2511231021 Bacteria 7302637
261 2555258263 2554235234 Bacteria 5762085
262 2643828785 2643221562 Bacteria 4048635
263 2793404408 2791355275 Bacteria 4429597
264 2821450606 2821443989 Bacteria 7658172
265 2843695276 2843690924 Bacteria 5169057
266 2884087506 2884086401 Bacteria 5005459
267 2919114099 2919108558 Bacteria 5897419
268 2929206468 2929199973 Bacteria 7260745
269 2939577272 2939573065 Bacteria 4926053
270 2945913507 2945909444 Bacteria 7065066
271 2945991101 2945984333 Bacteria 7358892
272 2971822179 2971820967 Bacteria 5823634
273 3007255465 3007252601 Bacteria 4559114
274 3007315738 3007315729 Bacteria 5076637
275 8054851248 8054849141 Bacteria 5232694
276 8055696969 8055693939 Bacteria 4772047
277 8056178805 8056177738 Bacteria 6748268
278 8057305194 8057304971 Bacteria 4649742
279 Ga0307510_10052430
280 Ga0058692_1004318
281 Ga0065165_1054079
282 Ga0070658_10080662
283 Ga0070675_101104082
284 Ga0070673_100782293
285 Ga0070667_100079034
286 Ga0070714_100068156
287 Ga0070663_100086657
288 Ga0070698_101134826
289 Ga0070699_100948202
290 Ga0068853_100100485
291 Ga0081540_1000537
292 Ga0070716_100837295
293 Ga0070712_100348200
294 Ga0075427_10022394
295 Ga0075430_100128226
296 Ga0075433_10249087
297 Ga0075429_100471070
298 Ga0079104_1000400
299 Ga0079104_1009116
300 Ga0075435_100415402
301 Ga0105251_10004839
302 Ga0105251_10511332
303 Ga0105244_10000019
304 Ga0105244_10000212
305 Ga0105244_10000397
306 Ga0105250_10000511
307 Ga0105250_10228899
308 Ga0105240_10000333
309 Ga0111539_10018003
310 Ga0111539_10126507
311 Ga0111539_11499306
312 Ga0105245_10702999
313 Ga0105247_11190889
314 Ga0114129_10753399
315 Ga0105248_10147355
316 Ga0105246_10816723
317 Ga0157373_10042913
318 Ga0157373_10698798
319 Ga0157371_10096203
320 Ga0157371_10582570
321 Ga0157370_10000339
322 Ga0157370_10007879
323 Ga0157374_10402543
324 Ga0157374_10715812
325 Ga0163162_10013377
326 Ga0163162_11541135
327 Ga0157375_10028973
328 Ga0182008_10000330
329 Ga0182006_1000069
330 Ga0182006_1004527
331 Ga0182006_1021732
332 Ga0163161_10000042
333 Ga0163161_10576298
334 Ga0213872_10000706
335 Ga0209130_1001146
336 Ga0209675_1001594
337 Ga0209676_1027424
338 Ga0207426_1139531
339 Ga0207696_1000008
340 Ga0207696_1000012
341 Ga0207696_1000024
342 Ga0207655_1000025
343 Ga0207655_1000044
344 Ga0207655_1000088
345 Ga0207655_1002760
346 Ga0207713_1000129
347 Ga0207713_1000223
348 Ga0207680_10177410
349 Ga0207685_10514845
350 Ga0207705_10868304
351 Ga0207693_10555213
352 Ga0207663_10172370
353 Ga0207659_10511988
354 Ga0207664_10127810
355 Ga0207711_10093121
356 Ga0207711_10127187
357 Ga0207668_11691524
358 Ga0207639_10093334
359 Ga0207678_10057561
360 Ga0207648_10190085
361 Ga0209281_1005816
362 Ga0209371_1000032
363 Ga0207428_10008096
364 Ga0207428_10058611
365 Ga0268256_1000555
366 Ga0307512_10261533
367 Ga0307513_10007102
368 Ga0307412_10154982
369 Ga0307412_10167310
370 Ga0307409_101919336
371 Ga0307416_100078275
372 Ga0307416_100911703
373 Ga0373931_0506910
374 Ga0395899_0098518
375 Ga0395900_0074203
376 Ga0395901_0120331
377 Ga0436360_0608751
378 Ga0436361_0489517
379 Ga0451802_2151319
380 Ga0439452_000013
381 Ga0439464_0004901
382 Ga0466969_0030491
383 Ga0466966_0064329
384 Ga0466959_0094621
385 Ga0495617_022569
386 Ga0495627_033801
387 Ga0495603_0155619
388 Ga0495590_0096734
389 Ga0495591_000021
390 Ga0495591_005570
391 Ga0495629_0121396
392 Ga0495638_0002796
393 Ga0495638_0015088
394 Ga0495651_0032932
395 Ga0495653_0005021
396 Ga0495653_0024753
397 Ga0495653_0185624
398 Ga0495650_0001142
399 Ga0495650_0013325
400 Ga0495580_0532416
401 Ga0495582_0397445
402 Ga0495605_0108829
403 Ga0495664_0000738
404 Ga0495585_0000322
405 Ga0495585_0033455
406 Ga0495596_0000012
407 Ga0495606_0001060
408 Ga0495606_0001580
409 Ga0495606_0031004
410 Ga0495610_0036960
411 Ga0495616_0043488
412 Ga0495620_0001348
413 Ga0495620_0006894
414 Ga0495628_0039057
415 Ga0495628_0290146
416 Ga0495630_0006654
417 Ga0495631_0016239
418 Ga0495632_0001831
419 Ga0495637_0000505
420 Ga0495643_0046042
421 Ga0495644_0012555
422 Ga0495648_0030412
423 Ga0495666_0147174
424 Ga0495652_0005050
425 Ga0495652_0026805
426 Ga0495654_0009143
427 Ga0495665_0000030
428 Ga0495609_0451173
429 Ga0495597_0019798
430 Ga0495645_0112220
431 Ga0495645_0230493
432 Ga0495668_0000176
433 Ga0495625_0008290
434 Ga0495635_0002433
435 Ga0495635_0559274
436 Ga0495661_0000014
437 Ga0495661_0024735
438 Ga0495588_0020052
439 Ga0495599_0015208
440 Ga0495599_0245351
441 Ga0495623_0000660
442 Ga0495646_0000611
443 Ga0495669_0055252
444 Ga0495624_0000848
445 Ga0495670_0076809
446 Ga0495671_0014969
447 Ga0495649_0002561
448 Ga0495649_0006499
449 Ga0495649_0017390
450 Ga0495649_0201877
451 Ga0495589_0000820
452 Ga0495589_0128074
453 Ga0495600_0018736
454 Ga0495600_0386682
455 Ga0495660_0019105
456 Ga0495604_0004262
457 Ga0495604_0059757
458 Ga0495674_0000146
459 Ga0495674_0481057
460 Ga0495676_0819529
461 Ga0495680_0006265
462 Ga0495683_0008737
463 Ga0495683_0094534
464 Ga0495683_0165142
465 Ga0495675_0046105
466 Ga0495679_004382
467 Ga0495679_014552
468 Ga0495673_0014471
469 Ga0495681_0002715
470 Ga0495686_0022741
471 Ga0495686_0241724
472 Ga0495593_0000525
473 Ga0495602_0001755
474 Ga0495602_0284587
475 Ga0495614_0135538
476 Ga0495614_0214735
477 Ga0495626_0000143
478 Ga0496100_0084551
479 Ga0496101_0089544
480 Ga0496102_0012134
481 Ga0496102_0101514
482 Ga0496103_0166002
483 Ga0496104_0012802
484 Ga0496104_0076828
485 Ga0496105_0006733
486 Ga0496105_0224527
487 Ga0496106_0000005
488 Ga0496106_0106668
489 Ga0496115_0000191
490 Ga0496115_0002784
491 Ga0496115_0465243
492 Ga0496116_0040506
493 Ga0496117_0001391
494 Ga0496117_0013888
495 Ga0496117_0137961
496 Ga0496118_0000167
497 Ga0496118_0004151
498 Ga0496118_0006781
499 Ga0496118_0610959
500 Ga0496119_0000771
501 Ga0496119_0375727
502 Ga0496120_0001042
503 Ga0496121_0000083
504 Ga0496121_0035672
505 Ga0496122_0041373
506 Ga0496122_0051745
507 Ga0496123_0162016
508 Ga0496124_0000981
509 Ga0496124_0008740
510 Ga0496124_0035709
511 Ga0496126_0000996
512 Ga0496126_0092626
513 Ga0496126_0302492
514 Ga0496126_0344798
515 Ga0496126_1219329
516 Ga0495678_017039
517 Ga0495678_017064
518 Ga0501033_0348675
519 Ga0501034_0484276
520 Ga0501036_0223357
521 Ga0501043_0101583
522 Ga0501047_0033597
523 Ga0501047_0053150
524 Ga0501083_0488878
525 Ga0501044_0021859
526 nmdc:mga06z11_595711_c1
527 nmdc:mga05p37_44698_c1
528 nmdc:mga0qj67_27669_c1
529 nmdc:mga06r32_50721_c1
530 nmdc:mga08y16_36526_c1
531 nmdc:mga08y16_54168_c1
532 nmdc:mga08y16_58336_c1
533 nmdc:mga08x19_548053_c1
534 nmdc:mga0a205_69247_c1
535 Ga0500644_0342360
536 Ga0500595_026300
537 Ga0500661_006306
538 2511358950
539 2555258263
540 2643828785
541 2793404408
542 2821450606
543 2843695276
544 2884087506
545 2919114099
546 2929206468
547 2939577272
548 2945913507
549 2945991101
550 2971822179
551 3007255465
552 3007315738
553 8054851248
554 8055696969
555 8056178805
556 8057305194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

21

104

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9749 12 143
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9723 3 141
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9617 3 143
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9607 12 143
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9423 3 143
ID Description Score Start End Superfamily
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9727 3 140 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9667 3 140 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9646 3 143 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9526 8 143 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9454 3 140 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A731Z005-F1-model_v4 Carboxymuconolactone decarboxylase family protein 1.004 38 143 GO:0051920
AF-A0A2L2B686-F1-model_v4 deleted 1 4 143
AF-A0A1S1WZ84-F1-model_v4 Alkylhydroperoxidase 0.9982 4 143 GO:0051920
AF-G5LSK4-F1-model_v4 Alkylhydroperoxidase AhpD 0.9978 23 117 GO:0051920
AF-A0A846US39-F1-model_v4 deleted 0.9955 4 143

Map