F382458

General Info

Members Datasets Scaffolds Average Seq Length
278 188 275 158

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_11165304|Ga0207698_111653041
Length 173
Sequence MTSHDEPTAAPGGHPMDAWVPHRGEMSLLDRVEHVDEHGVVAWVTVPADGLFTTEGGVPAWVGIEYMAQAVAAWSGARSRAGGGSPRIGFLLGSRRYEAREPVFAAGAALRVSAQCELVGENGLGMFECRIEHAGRELATARLSVYEPPAGADAATGGTLEPGAKQEPGTQGT

Samples

Sample ID Description Type Environment
1 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
2 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
3 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
4 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
185 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 0
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.83
Nodule 0.36
Rhizoplane 2.88
Rhizosphere 62.23
Stem 0
Stem Tuber 0
Unclassified 18.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021400 3300001979 Bacteria 2242
2 JGI25156J39149_1000038 3300002705 Bacteria 108421
3 JGI25154J39366_1001243 3300002738 Bacteria 9588
4 JGI25157J39369_1000127 3300002741 Bacteria 65070
5 rootH1_10003584 3300003316 Bacteria 9827
6 rootH1_10041159 3300003316 Bacteria 2965
7 rootH2_10009339 3300003320 Bacteria 4430
8 rootL2_10001694 3300003322 Bacteria 15107
9 rootL2_10018704 3300003322 Bacteria 6623
10 rootH1_10028124 3300003316 Bacteria 1768
11 rootH1_10028124 3300003323 Bacteria 1056
12 rootH1_10045059 3300003323 Bacteria 2375
13 Ga0055539_1000405 3300003752 Bacteria 16592
14 Ga0055539_1002307 3300003752 Bacteria 2990
15 Ga0055533_1000024 3300003756 Bacteria 338067
16 Ga0055525_1000778 3300003759 Bacteria 10266
17 Ga0055535_1012095 3300003761 Bacteria 1332
18 Ga0055526_1010493 3300003771 Bacteria 4299
19 Ga0055537_1000247 3300003773 Bacteria 39499
20 Ga0055534_1000209 3300003784 Bacteria 43174
21 Ga0055528_1000205 3300003790 Bacteria 50027
22 Ga0055530_10001699 3300003791 Bacteria 15595
23 Ga0055531_10001848 3300003794 Bacteria 14930
24 Ga0055531_10010945 3300003794 Bacteria 4442
25 Ga0070658_10017416 3300005327 Bacteria 5749
26 Ga0070658_10034567 3300005327 Bacteria 4067
27 Ga0070658_10127673 3300005327 Bacteria 2117
28 Ga0070690_100180902 3300005330 Bacteria 1457
29 Ga0068869_100014175 3300005334 Bacteria 5321
30 Ga0070660_100103489 3300005339 Bacteria 2258
31 Ga0070660_100659109 3300005339 Bacteria 877
32 Ga0070661_100435790 3300005344 Bacteria 1041
33 Ga0070673_100002270 3300005364 Bacteria 11654
34 Ga0070659_100085322 3300005366 Bacteria 2525
35 Ga0070659_100457263 3300005366 Bacteria 1084
36 Ga0070667_100333811 3300005367 Bacteria 1370
37 Ga0070678_100287662 3300005456 Bacteria 1392
38 Ga0070684_100633099 3300005535 Bacteria 995
39 Ga0068853_100112756 3300005539 Bacteria 2417
40 Ga0068853_101067342 3300005539 Bacteria 778
41 Ga0068855_100016210 3300005563 Bacteria 8961
42 Ga0068855_100046672 3300005563 Bacteria 5120
43 Ga0068855_100234515 3300005563 Bacteria 2052
44 Ga0068855_100432521 3300005563 Bacteria 1438
45 Ga0068855_100597202 3300005563 Bacteria 1191
46 Ga0068857_100001885 3300005577 Bacteria 16897
47 Ga0068854_100120920 3300005578 Bacteria 1988
48 Ga0068856_100005894 3300005614 Bacteria 12076
49 Ga0068852_100400980 3300005616 Bacteria 1349
50 Ga0068852_100537670 3300005616 Bacteria 1168
51 Ga0068852_100762989 3300005616 Bacteria 980
52 Ga0068852_101666543 3300005616 Bacteria 660
53 Ga0068864_101867355 3300005618 Bacteria 606
54 Ga0068861_100005127 3300005719 Bacteria 8834
55 Ga0068863_100903915 3300005841 Bacteria 883
56 Ga0068862_100519555 3300005844 Bacteria 1133
57 Ga0075367_10083728 3300006178 Bacteria 1933
58 Ga0105240_10004079 3300009093 Bacteria 22469
59 Ga0105240_10016123 3300009093 Bacteria 10125
60 Ga0105240_10781632 3300009093 Bacteria 1035
61 Ga0105243_10905406 3300009148 Bacteria 878
62 Ga0105242_10200641 3300009176 Bacteria 1772
63 Ga0105248_12086679 3300009177 Bacteria 644
64 Ga0105237_10230853 3300009545 Bacteria 1851
65 Ga0105237_10247970 3300009545 Bacteria 1783
66 Ga0105238_10071473 3300009551 Bacteria 3467
67 Ga0105239_11143450 3300010375 Bacteria 897
68 Ga0157371_10000158 3300013102 Bacteria 99529
69 Ga0157378_10330360 3300013297 Bacteria 1484
70 Ga0157376_10412447 3300014969 Bacteria 1309
71 Ga0182006_1021968 3300015261 Bacteria 2657
72 Ga0182007_10000019 3300015262 Bacteria 194770
73 Ga0182007_10074568 3300015262 Bacteria 1112
74 Ga0182007_10230058 3300015262 Bacteria 658
75 Ga0182005_1000088 3300015265 Bacteria 69427
76 Ga0163161_10784397 3300017792 Bacteria 800
77 Ga0209674_100007 3300025226 Bacteria 1077082
78 Ga0209563_100052 3300025230 Bacteria 334307
79 Ga0207427_100851 3300025231 Bacteria 13601
80 Ga0209258_100534 3300025242 Bacteria 36052
81 Ga0209646_1000094 3300025246 Bacteria 182874
82 Ga0209026_1000009 3300025250 Bacteria 531812
83 Ga0209677_100015 3300025253 Bacteria 532137
84 Ga0209677_100097 3300025253 Bacteria 97418
85 Ga0209677_102306 3300025253 Bacteria 7337
86 Ga0209759_1000065 3300025256 Bacteria 187612
87 Ga0209759_1000848 3300025256 Bacteria 23840
88 Ga0209759_1003887 3300025256 Bacteria 5766
89 Ga0209759_1019935 3300025256 Bacteria 1574
90 Ga0209565_1000113 3300025263 Bacteria 116343
91 Ga0209673_1000581 3300025273 Bacteria 57816
92 Ga0209130_1004270 3300025284 Bacteria 5530
93 Ga0209675_1000007 3300025291 Bacteria 683430
94 Ga0209676_1000018 3300025292 Bacteria 631385
95 Ga0209676_1000771 3300025292 Bacteria 42845
96 Ga0209676_1000986 3300025292 Bacteria 33903
97 Ga0209564_1000770 3300025295 Bacteria 44617
98 Ga0209050_1000448 3300025298 Bacteria 74673
99 Ga0209050_1047440 3300025298 Bacteria 1119
100 Ga0209256_1001885 3300025299 Bacteria 19277
101 Ga0209256_1014784 3300025299 Bacteria 2777
102 Ga0209051_1001850 3300025303 Bacteria 16666
103 Ga0209257_1000035 3300025304 Bacteria 631463
104 Ga0209257_1001880 3300025304 Bacteria 22707
105 Ga0209257_1005777 3300025304 Bacteria 8434
106 Ga0207705_10044131 3300025909 Bacteria 3204
107 Ga0207705_10100089 3300025909 Bacteria 2132
108 Ga0207705_10247009 3300025909 Bacteria 1360
109 Ga0207705_10261876 3300025909 Bacteria 1320
110 Ga0207705_10810398 3300025909 Bacteria 727
111 Ga0207695_10006850 3300025913 Bacteria 14669
112 Ga0207695_10793121 3300025913 Bacteria 827
113 Ga0207671_10141837 3300025914 Bacteria 1851
114 Ga0207657_10148873 3300025919 Bacteria 1908
115 Ga0207649_10220052 3300025920 Bacteria 1352
116 Ga0207694_10030681 3300025924 Bacteria 4105
117 Ga0207690_10004543 3300025932 Bacteria 8195
118 Ga0207690_10435187 3300025932 Bacteria 1052
119 Ga0207709_10028523 3300025935 Bacteria 3227
120 Ga0207709_10292981 3300025935 Bacteria 1207
121 Ga0207689_10016451 3300025942 Bacteria 6260
122 Ga0207667_10003402 3300025949 Bacteria 19637
123 Ga0207667_10149506 3300025949 Bacteria 2404
124 Ga0207667_10478071 3300025949 Bacteria 1265
125 Ga0207651_10001180 3300025960 Bacteria 11721
126 Ga0207640_10030508 3300025981 Bacteria 3321
127 Ga0207658_10824419 3300025986 Bacteria 843
128 Ga0207639_10055568 3300026041 Bacteria 3031
129 Ga0207702_10000610 3300026078 Bacteria 39489
130 Ga0207674_10012735 3300026116 Bacteria 9398
131 Ga0207675_100005379 3300026118 Bacteria 12284
132 Ga0207683_10156162 3300026121 Bacteria 2061
133 Ga0207683_10443896 3300026121 Bacteria 1196
134 Ga0207698_10147973 3300026142 Bacteria 2034
135 Ga0207698_10170648 3300026142 Bacteria 1915
136 Ga0207698_11165304 3300026142 Bacteria 784
137 Ga0209282_1000019 3300027666 Bacteria 184034
138 Ga0209813_10147085 3300027866 Bacteria 841
139 Ga0268265_10262708 3300028380 Bacteria 1536
140 Ga0265336_10000061 3300028666 Bacteria 102829
141 Ga0307515_10008778 3300028794 Bacteria 19640
142 Ga0265324_10001696 3300029957 Bacteria 12114
143 Ga0307509_10141183 3300031507 Bacteria 2344
144 Ga0307408_100292400 3300031548 Bacteria 1361
145 Ga0307516_10003778 3300031730 Bacteria 19239
146 Ga0307516_10003991 3300031730 Bacteria 18527
147 Ga0307412_10203928 3300031911 Bacteria 1504
148 Ga0307412_10451977 3300031911 Bacteria 1059
149 Ga0307409_101549088 3300031995 Bacteria 691
150 Ga0307414_10038301 3300032004 Bacteria 3219
151 Ga0373959_0004723 3300034820 Bacteria 2210
152 Ga0373934_0031837 3300035086 Bacteria 2066
153 Ga0395898_0043252 3300037466 Bacteria 4439
154 Ga0395905_0024179 3300037471 Bacteria 5734
155 Ga0395905_0025219 3300037471 Bacteria 5607
156 Ga0395905_0760722 3300037471 Bacteria 871
157 Ga0395905_1505488 3300037471 Bacteria 577
158 Ga0395901_0004756 3300038443 Bacteria 13701
159 Ga0395901_0273012 3300038443 Bacteria 1758
160 Ga0237819_10491 3300038705 Bacteria 1206
161 Ga0451843_0976079 3300041509 Bacteria 963
162 Ga0451853_3043171 3300041512 Bacteria 1709
163 Ga0439432_006364 3300042006 Bacteria 4224
164 Ga0439449_0016189 3300042007 Bacteria 2803
165 Ga0439457_006300 3300042014 Bacteria 2914
166 Ga0466963_0448042 3300044694 Bacteria 911
167 Ga0466968_0194607 3300044735 Bacteria 947
168 Ga0466957_0060379 3300044842 Bacteria 2325
169 Ga0466957_0207129 3300044842 Bacteria 1290
170 Ga0466960_0055259 3300044901 Bacteria 1930
171 Ga0466967_1794685 3300045976 Bacteria 611
172 Ga0495627_017599 3300046453 Bacteria 2426
173 Ga0495638_0044866 3300046460 Bacteria 2783
174 Ga0495650_0013900 3300046471 Bacteria 4226
175 Ga0495605_0006276 3300046474 Bacteria 6849
176 Ga0495585_0001195 3300046492 Bacteria 21116
177 Ga0495585_0027981 3300046492 Bacteria 3217
178 Ga0495594_0002931 3300046499 Bacteria 8862
179 Ga0495596_0000064 3300046500 Bacteria 77744
180 Ga0495596_0023095 3300046500 Bacteria 2525
181 Ga0495607_0014369 3300046501 Bacteria 5157
182 Ga0495607_0094033 3300046501 Bacteria 1618
183 Ga0495583_0000062 3300046506 Bacteria 195151
184 Ga0495606_0002268 3300046507 Bacteria 22764
185 Ga0495610_0000982 3300046512 Bacteria 26313
186 Ga0495610_0001367 3300046512 Bacteria 21670
187 Ga0495616_0000866 3300046513 Bacteria 21983
188 Ga0495631_0000794 3300046518 Bacteria 20159
189 Ga0495631_0000800 3300046518 Bacteria 20056
190 Ga0495631_0074953 3300046518 Bacteria 1460
191 Ga0495631_0089528 3300046518 Bacteria 1325
192 Ga0495637_0010589 3300046520 Bacteria 4453
193 Ga0495643_0000431 3300046522 Bacteria 54537
194 Ga0495643_0002022 3300046522 Bacteria 16910
195 Ga0495644_0005160 3300046523 Bacteria 5112
196 Ga0495648_0031641 3300046524 Bacteria 3482
197 Ga0495642_0016711 3300046528 Bacteria 2861
198 Ga0495642_0033477 3300046528 Bacteria 2066
199 Ga0495642_0108190 3300046528 Bacteria 1187
200 Ga0495609_0000244 3300046538 Bacteria 51384
201 Ga0495597_0000808 3300046542 Bacteria 24718
202 Ga0495597_0020402 3300046542 Bacteria 3088
203 Ga0495633_0191043 3300046558 Bacteria 941
204 Ga0495633_0212903 3300046558 Bacteria 885
205 Ga0495656_0186898 3300046615 Bacteria 1021
206 Ga0495668_0031002 3300046616 Bacteria 3014
207 Ga0495611_0000546 3300046648 Bacteria 22058
208 Ga0495625_0010440 3300046660 Bacteria 7684
209 Ga0495661_0008119 3300046665 Bacteria 7277
210 Ga0495661_0129948 3300046665 Bacteria 1381
211 Ga0495588_0055413 3300046674 Bacteria 2046
212 Ga0495588_0133962 3300046674 Bacteria 1308
213 Ga0495669_0004449 3300046684 Bacteria 5789
214 Ga0495669_0028090 3300046684 Bacteria 2462
215 Ga0495669_0096735 3300046684 Bacteria 1368
216 Ga0495670_0423378 3300046691 Bacteria 720
217 Ga0495671_0000453 3300046692 Bacteria 32377
218 Ga0495649_0000049 3300046694 Bacteria 113865
219 Ga0495649_0003527 3300046694 Bacteria 10516
220 Ga0495649_0010820 3300046694 Bacteria 5374
221 Ga0495589_0121952 3300046794 Bacteria 1255
222 Ga0495589_0143920 3300046794 Bacteria 1140
223 Ga0495672_0000069 3300047320 Bacteria 189627
224 Ga0495683_0011966 3300047323 Bacteria 4559
225 Ga0495679_027979 3300047446 Bacteria 1853
226 Ga0495685_009867 3300047447 Bacteria 3196
227 Ga0495681_0003728 3300047470 Bacteria 10556
228 Ga0495686_0306013 3300047472 Bacteria 875
229 Ga0495626_0001658 3300048091 Bacteria 17189
230 Ga0495626_0007997 3300048091 Bacteria 5841
231 Ga0496100_0297164 3300048903 Bacteria 1208
232 Ga0496100_0394235 3300048903 Bacteria 1053
233 Ga0496104_0047720 3300048907 Bacteria 4037
234 Ga0496104_0191550 3300048907 Bacteria 1956
235 Ga0496105_0018203 3300048908 Bacteria 5641
236 Ga0496106_0618366 3300048909 Bacteria 867
237 Ga0496114_0246812 3300048917 Bacteria 1571
238 Ga0496115_0303506 3300048918 Bacteria 1308
239 Ga0496116_0008953 3300048919 Bacteria 8608
240 Ga0496116_0056597 3300048919 Bacteria 2569
241 Ga0496116_0066276 3300048919 Bacteria 2311
242 Ga0496116_0157826 3300048919 Bacteria 1249
243 Ga0496116_0300944 3300048919 Bacteria 763
244 Ga0496117_0000176 3300048920 Bacteria 131822
245 Ga0496118_0002382 3300048921 Bacteria 25392
246 Ga0496118_0021110 3300048921 Bacteria 5745
247 Ga0496118_0065499 3300048921 Bacteria 2659
248 Ga0496118_0157802 3300048921 Bacteria 1408
249 Ga0496118_0316753 3300048921 Bacteria 848
250 Ga0496119_0000587 3300048922 Bacteria 49190
251 Ga0496119_0157052 3300048922 Bacteria 1213
252 Ga0496120_0001074 3300048923 Bacteria 36034
253 Ga0496121_0016678 3300048924 Bacteria 7560
254 Ga0496121_0017530 3300048924 Bacteria 7306
255 Ga0496121_0027122 3300048924 Bacteria 5370
256 Ga0496122_0009681 3300048925 Bacteria 10083
257 Ga0496122_0011321 3300048925 Bacteria 9055
258 Ga0496123_0001761 3300048926 Bacteria 28565
259 Ga0496123_0069920 3300048926 Bacteria 2200
260 Ga0496124_0002886 3300048927 Bacteria 21686
261 Ga0496124_0047234 3300048927 Bacteria 3684
262 Ga0496125_0002802 3300048928 Bacteria 22023
263 Ga0496125_0013048 3300048928 Bacteria 8196
264 Ga0496125_0068681 3300048928 Bacteria 2786
265 Ga0496126_0001695 3300048929 Bacteria 32750
266 Ga0495678_000104 3300049459 Bacteria 103726
267 Ga0495682_0094240 3300049460 Bacteria 1075
268 Ga0501263_007207 3300049760 Bacteria 1304
269 nmdc:mga06z11_97487_c1 3300050494 Bacteria 1607
270 nmdc:mga04h51_235698_c1 3300050495 Bacteria 729
271 Ga0500635_0000026 3300053080 Bacteria 104983
272 Ga0500608_139288 3300053122 Bacteria 1078
273 Ga0500559_0042683 3300053136 Bacteria 1979
274 Ga0500636_0060106 3300053177 Bacteria 2219
275 Ga0500661_014017 3300055283 Bacteria 1444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_12086679 Ga0105248_120866791 135
2 3300031995 Ga0307409_101549088 Ga0307409_1015490881 140
3 3300045976 Ga0466967_1794685 Ga0466967_1794685_15_446 140
4 3300049760 Ga0501263_007207 Ga0501263_007207_14_454 146
5 3300009545 Ga0105237_10247970 Ga0105237_102479702 147
6 3300009551 Ga0105238_10071473 Ga0105238_100714733 147
7 3300010375 Ga0105239_11143450 Ga0105239_111434502 147
8 3300015262 Ga0182007_10230058 Ga0182007_102300582 147
9 3300031911 Ga0307412_10203928 Ga0307412_102039283 147
10 3300037471 Ga0395905_0760722 Ga0395905_0760722_342_788 147
11 3300037471 Ga0395905_1505488 Ga0395905_1505488_22_480 147
12 3300044694 Ga0466963_0448042 Ga0466963_0448042_264_710 147
13 3300044842 Ga0466957_0060379 Ga0466957_0060379_1798_2244 147
14 3300053122 Ga0500608_139288 Ga0500608_139288_604_1056 147
15 iso_pu_bacteria 2643221581 2643916616 147
16 iso_pu_bacteria 2857442823 2857444558 147
17 iso_pu_bacteria 2941475908 2941479421 147
18 3300005456 Ga0070678_100287662 Ga0070678_1002876622 148
19 3300031507 Ga0307509_10141183 Ga0307509_101411832 148
20 3300005616 Ga0068852_101666543 Ga0068852_1016665432 149
21 iso_pu_bacteria 2852649853 2852651703 149
22 3300005339 Ga0070660_100103489 Ga0070660_1001034892 150
23 3300005366 Ga0070659_100085322 Ga0070659_1000853223 150
24 3300025909 Ga0207705_10810398 Ga0207705_108103982 150
25 3300025932 Ga0207690_10004543 Ga0207690_100045435 150
26 3300046453 Ga0495627_017599 Ga0495627_017599_1936_2394 150
27 3300046492 Ga0495585_0001195 Ga0495585_0001195_6546_7004 150
28 3300046499 Ga0495594_0002931 Ga0495594_0002931_768_1226 150
29 3300046500 Ga0495596_0023095 Ga0495596_0023095_379_837 150
30 3300046501 Ga0495607_0094033 Ga0495607_0094033_813_1271 150
31 3300046518 Ga0495631_0000794 Ga0495631_0000794_15005_15463 150
32 3300046518 Ga0495631_0074953 Ga0495631_0074953_682_1140 150
33 3300046518 Ga0495631_0089528 Ga0495631_0089528_509_967 150
34 3300046520 Ga0495637_0010589 Ga0495637_0010589_3865_4323 150
35 3300046522 Ga0495643_0002022 Ga0495643_0002022_14115_14573 150
36 3300046523 Ga0495644_0005160 Ga0495644_0005160_2957_3415 150
37 3300046528 Ga0495642_0016711 Ga0495642_0016711_29_487 150
38 3300046528 Ga0495642_0108190 Ga0495642_0108190_376_834 150
39 3300046542 Ga0495597_0000808 Ga0495597_0000808_17956_18414 150
40 3300046558 Ga0495633_0212903 Ga0495633_0212903_208_666 150
41 3300046648 Ga0495611_0000546 Ga0495611_0000546_3199_3657 150
42 3300046665 Ga0495661_0129948 Ga0495661_0129948_621_1079 150
43 3300046674 Ga0495588_0055413 Ga0495588_0055413_351_809 150
44 3300046684 Ga0495669_0004449 Ga0495669_0004449_624_1082 150
45 3300046694 Ga0495649_0000049 Ga0495649_0000049_6143_6601 150
46 3300047323 Ga0495683_0011966 Ga0495683_0011966_3638_4096 150
47 3300047446 Ga0495679_027979 Ga0495679_027979_814_1272 150
48 3300047470 Ga0495681_0003728 Ga0495681_0003728_4697_5155 150
49 3300048091 Ga0495626_0001658 Ga0495626_0001658_1942_2400 150
50 3300048091 Ga0495626_0007997 Ga0495626_0007997_3507_3965 150
51 3300049459 Ga0495678_000104 Ga0495678_000104_58222_58680 150
52 3300049460 Ga0495682_0094240 Ga0495682_0094240_374_832 150
53 3300031730 Ga0307516_10003991 Ga0307516_100039916 151
54 3300032004 Ga0307414_10038301 Ga0307414_100383013 151
55 3300046512 Ga0495610_0000982 Ga0495610_0000982_9260_9715 151
56 3300046518 Ga0495631_0000800 Ga0495631_0000800_15262_15717 151
57 3300005563 Ga0068855_100597202 Ga0068855_1005972021 152
58 3300037471 Ga0395905_0025219 Ga0395905_0025219_2791_3252 152
59 3300041509 Ga0451843_0976079 Ga0451843_0976079_24_482 152
60 3300041512 Ga0451853_3043171 Ga0451853_3043171_977_1435 152
61 3300053080 Ga0500635_0000026 Ga0500635_0000026_22488_22988 152
62 3300003322 rootL2_10001694 rootL2_100016949 153
63 3300003771 Ga0055526_1010493 Ga0055526_10104933 153
64 3300003773 Ga0055537_1000247 Ga0055537_100024722 153
65 3300003784 Ga0055534_1000209 Ga0055534_100020918 153
66 3300003790 Ga0055528_1000205 Ga0055528_100020538 153
67 3300003791 Ga0055530_10001699 Ga0055530_100016995 153
68 3300003794 Ga0055531_10001848 Ga0055531_100018486 153
69 3300003794 Ga0055531_10010945 Ga0055531_100109455 153
70 3300005327 Ga0070658_10017416 Ga0070658_100174163 153
71 3300005339 Ga0070660_100659109 Ga0070660_1006591092 153
72 3300005367 Ga0070667_100333811 Ga0070667_1003338112 153
73 3300006178 Ga0075367_10083728 Ga0075367_100837282 153
74 3300009093 Ga0105240_10781632 Ga0105240_107816322 153
75 3300013102 Ga0157371_10000158 Ga0157371_1000015839 153
76 3300015261 Ga0182006_1021968 Ga0182006_10219682 153
77 3300015262 Ga0182007_10000019 Ga0182007_1000001957 153
78 3300015265 Ga0182005_1000088 Ga0182005_100008812 153
79 3300017792 Ga0163161_10784397 Ga0163161_107843972 153
80 3300025263 Ga0209565_1000113 Ga0209565_10001138 153
81 3300025273 Ga0209673_1000581 Ga0209673_100058128 153
82 3300025284 Ga0209130_1004270 Ga0209130_10042705 153
83 3300025291 Ga0209675_1000007 Ga0209675_100000794 153
84 3300025292 Ga0209676_1000018 Ga0209676_1000018451 153
85 3300025292 Ga0209676_1000771 Ga0209676_100077119 153
86 3300025292 Ga0209676_1000986 Ga0209676_100098622 153
87 3300025295 Ga0209564_1000770 Ga0209564_100077031 153
88 3300025298 Ga0209050_1000448 Ga0209050_100044833 153
89 3300025298 Ga0209050_1047440 Ga0209050_10474402 153
90 3300025299 Ga0209256_1001885 Ga0209256_10018859 153
91 3300025299 Ga0209256_1014784 Ga0209256_10147843 153
92 3300025303 Ga0209051_1001850 Ga0209051_100185011 153
93 3300025304 Ga0209257_1000035 Ga0209257_1000035451 153
94 3300025304 Ga0209257_1001880 Ga0209257_10018808 153
95 3300025304 Ga0209257_1005777 Ga0209257_10057773 153
96 3300025909 Ga0207705_10261876 Ga0207705_102618762 153
97 3300025913 Ga0207695_10793121 Ga0207695_107931212 153
98 3300025919 Ga0207657_10148873 Ga0207657_101488732 153
99 3300025935 Ga0207709_10028523 Ga0207709_100285233 153
100 3300025986 Ga0207658_10824419 Ga0207658_108244192 153
101 3300027866 Ga0209813_10147085 Ga0209813_101470852 153
102 3300031911 Ga0307412_10451977 Ga0307412_104519772 153
103 3300037471 Ga0395905_0024179 Ga0395905_0024179_1565_2026 153
104 3300038443 Ga0395901_0273012 Ga0395901_0273012_484_945 153
105 3300038705 Ga0237819_10491 Ga0237819_10491_37_498 153
106 3300042006 Ga0439432_006364 Ga0439432_006364_2023_2484 153
107 3300044735 Ga0466968_0194607 Ga0466968_0194607_385_846 153
108 3300044901 Ga0466960_0055259 Ga0466960_0055259_996_1457 153
109 3300046460 Ga0495638_0044866 Ga0495638_0044866_264_725 153
110 3300046492 Ga0495585_0027981 Ga0495585_0027981_1896_2369 153
111 3300046522 Ga0495643_0000431 Ga0495643_0000431_19598_20059 153
112 3300046558 Ga0495633_0191043 Ga0495633_0191043_127_588 153
113 3300047320 Ga0495672_0000069 Ga0495672_0000069_147559_148020 153
114 3300047472 Ga0495686_0306013 Ga0495686_0306013_94_555 153
115 3300048907 Ga0496104_0047720 Ga0496104_0047720_1095_1556 153
116 3300048908 Ga0496105_0018203 Ga0496105_0018203_1476_1937 153
117 3300048919 Ga0496116_0008953 Ga0496116_0008953_295_756 153
118 3300048919 Ga0496116_0056597 Ga0496116_0056597_2072_2533 153
119 3300048919 Ga0496116_0066276 Ga0496116_0066276_366_827 153
120 3300048919 Ga0496116_0300944 Ga0496116_0300944_246_707 153
121 3300048920 Ga0496117_0000176 Ga0496117_0000176_106978_107439 153
122 3300048921 Ga0496118_0002382 Ga0496118_0002382_548_1009 153
123 3300048921 Ga0496118_0021110 Ga0496118_0021110_4156_4617 153
124 3300048921 Ga0496118_0065499 Ga0496118_0065499_1790_2251 153
125 3300048921 Ga0496118_0157802 Ga0496118_0157802_39_500 153
126 3300048921 Ga0496118_0316753 Ga0496118_0316753_185_646 153
127 3300048922 Ga0496119_0000587 Ga0496119_0000587_30600_31061 153
128 3300048922 Ga0496119_0157052 Ga0496119_0157052_692_1153 153
129 3300048923 Ga0496120_0001074 Ga0496120_0001074_17623_18084 153
130 3300048924 Ga0496121_0016678 Ga0496121_0016678_138_599 153
131 3300048924 Ga0496121_0017530 Ga0496121_0017530_6292_6753 153
132 3300048925 Ga0496122_0011321 Ga0496122_0011321_8310_8771 153
133 3300048926 Ga0496123_0069920 Ga0496123_0069920_405_866 153
134 3300048927 Ga0496124_0002886 Ga0496124_0002886_11934_12395 153
135 3300048927 Ga0496124_0047234 Ga0496124_0047234_1239_1700 153
136 3300048928 Ga0496125_0002802 Ga0496125_0002802_9362_9823 153
137 3300048928 Ga0496125_0013048 Ga0496125_0013048_3636_4097 153
138 3300048928 Ga0496125_0068681 Ga0496125_0068681_2179_2640 153
139 3300048929 Ga0496126_0001695 Ga0496126_0001695_30893_31354 153
140 3300050494 nmdc:mga06z11_97487_c1 nmdc:mga06z11_97487_c1_740_1201 153
141 3300050495 nmdc:mga04h51_235698_c1 nmdc:mga04h51_235698_c1_170_631 153
142 3300025253 Ga0209677_102306 Ga0209677_1023068 154
143 3300025256 Ga0209759_1000848 Ga0209759_100084824 154
144 3300025909 Ga0207705_10247009 Ga0207705_102470092 154
145 3300031548 Ga0307408_100292400 Ga0307408_1002924002 154
146 3300042007 Ga0439449_0016189 Ga0439449_0016189_545_1009 154
147 3300042014 Ga0439457_006300 Ga0439457_006300_215_679 154
148 3300044842 Ga0466957_0207129 Ga0466957_0207129_729_1193 154
149 3300046674 Ga0495588_0133962 Ga0495588_0133962_396_860 154
150 3300048903 Ga0496100_0394235 Ga0496100_0394235_156_623 154
151 3300048909 Ga0496106_0618366 Ga0496106_0618366_312_779 154
152 3300026121 Ga0207683_10156162 Ga0207683_101561623 155
153 3300005616 Ga0068852_100762989 Ga0068852_1007629892 156
154 3300048907 Ga0496104_0191550 Ga0496104_0191550_1440_1943 156
155 3300053136 Ga0500559_0042683 Ga0500559_0042683_279_791 157
156 3300028794 Ga0307515_10008778 Ga0307515_100087785 158
157 3300031730 Ga0307516_10003778 Ga0307516_1000377817 158
158 3300005364 Ga0070673_100002270 Ga0070673_1000022705 159
159 3300025960 Ga0207651_10001180 Ga0207651_1000118011 159
160 3300027666 Ga0209282_1000019 Ga0209282_1000019110 159
161 3300046474 Ga0495605_0006276 Ga0495605_0006276_5410_5895 159
162 3300046500 Ga0495596_0000064 Ga0495596_0000064_45339_45824 159
163 3300046501 Ga0495607_0014369 Ga0495607_0014369_4334_4819 159
164 3300046512 Ga0495610_0001367 Ga0495610_0001367_16067_16552 159
165 3300046513 Ga0495616_0000866 Ga0495616_0000866_13496_13981 159
166 3300046524 Ga0495648_0031641 Ga0495648_0031641_224_709 159
167 3300046528 Ga0495642_0033477 Ga0495642_0033477_1310_1801 159
168 3300046538 Ga0495609_0000244 Ga0495609_0000244_15202_15687 159
169 3300046542 Ga0495597_0020402 Ga0495597_0020402_746_1231 159
170 3300046615 Ga0495656_0186898 Ga0495656_0186898_130_615 159
171 3300046665 Ga0495661_0008119 Ga0495661_0008119_3043_3528 159
172 3300046684 Ga0495669_0096735 Ga0495669_0096735_148_633 159
173 3300046691 Ga0495670_0423378 Ga0495670_0423378_156_641 159
174 3300046692 Ga0495671_0000453 Ga0495671_0000453_12404_12889 159
175 3300046694 Ga0495649_0010820 Ga0495649_0010820_423_908 159
176 3300046794 Ga0495589_0121952 Ga0495589_0121952_429_914 159
177 3300047447 Ga0495685_009867 Ga0495685_009867_2370_2855 159
178 3300048919 Ga0496116_0157826 Ga0496116_0157826_402_887 159
179 3300048924 Ga0496121_0027122 Ga0496121_0027122_3873_4358 159
180 3300048925 Ga0496122_0009681 Ga0496122_0009681_9191_9676 159
181 3300048926 Ga0496123_0001761 Ga0496123_0001761_27678_28163 159
182 3300005327 Ga0070658_10034567 Ga0070658_100345675 160
183 3300009093 Ga0105240_10016123 Ga0105240_100161239 160
184 3300009148 Ga0105243_10905406 Ga0105243_109054062 160
185 3300014969 Ga0157376_10412447 Ga0157376_104124471 160
186 3300015262 Ga0182007_10074568 Ga0182007_100745682 160
187 3300025231 Ga0207427_100851 Ga0207427_10085111 160
188 3300025909 Ga0207705_10044131 Ga0207705_100441314 160
189 3300026142 Ga0207698_11165304 Ga0207698_111653041 160
190 3300028666 Ga0265336_10000061 Ga0265336_1000006142 161
191 3300029957 Ga0265324_10001696 Ga0265324_1000169610 161
192 3300002705 JGI25156J39149_1000038 JGI25156J39149_1000038117 162
193 3300002738 JGI25154J39366_1001243 JGI25154J39366_10012437 162
194 3300002741 JGI25157J39369_1000127 JGI25157J39369_100012718 162
195 3300003316 rootH1_10003584 rootH1_100035845 162
196 3300003316 rootH1_10041159 rootH1_100411591 162
197 3300003320 rootH2_10009339 rootH2_100093392 162
198 3300003322 rootL2_10018704 rootL2_100187042 162
199 3300003323 rootH1_10028124 rootH1_100281241 162
200 3300003323 rootH1_10045059 rootH1_100450592 162
201 3300003752 Ga0055539_1000405 Ga0055539_100040512 162
202 3300003752 Ga0055539_1002307 Ga0055539_10023073 162
203 3300003756 Ga0055533_1000024 Ga0055533_1000024230 162
204 3300003759 Ga0055525_1000778 Ga0055525_100077810 162
205 3300003761 Ga0055535_1012095 Ga0055535_10120951 162
206 3300005327 Ga0070658_10127673 Ga0070658_101276732 162
207 3300005330 Ga0070690_100180902 Ga0070690_1001809022 162
208 3300005334 Ga0068869_100014175 Ga0068869_1000141755 162
209 3300005344 Ga0070661_100435790 Ga0070661_1004357902 162
210 3300005366 Ga0070659_100457263 Ga0070659_1004572632 162
211 3300005535 Ga0070684_100633099 Ga0070684_1006330992 162
212 3300005539 Ga0068853_100112756 Ga0068853_1001127563 162
213 3300005539 Ga0068853_101067342 Ga0068853_1010673421 162
214 3300005563 Ga0068855_100016210 Ga0068855_1000162103 162
215 3300005563 Ga0068855_100234515 Ga0068855_1002345152 162
216 3300005563 Ga0068855_100432521 Ga0068855_1004325213 162
217 3300005577 Ga0068857_100001885 Ga0068857_10000188514 162
218 3300005578 Ga0068854_100120920 Ga0068854_1001209202 162
219 3300005614 Ga0068856_100005894 Ga0068856_1000058948 162
220 3300005616 Ga0068852_100537670 Ga0068852_1005376702 162
221 3300005618 Ga0068864_101867355 Ga0068864_1018673552 162
222 3300005719 Ga0068861_100005127 Ga0068861_1000051275 162
223 3300005841 Ga0068863_100903915 Ga0068863_1009039152 162
224 3300005844 Ga0068862_100519555 Ga0068862_1005195552 162
225 3300009093 Ga0105240_10004079 Ga0105240_1000407919 162
226 3300009176 Ga0105242_10200641 Ga0105242_102006412 162
227 3300009545 Ga0105237_10230853 Ga0105237_102308532 162
228 3300013297 Ga0157378_10330360 Ga0157378_103303602 162
229 3300025226 Ga0209674_100007 Ga0209674_100007271 162
230 3300025230 Ga0209563_100052 Ga0209563_100052339 162
231 3300025242 Ga0209258_100534 Ga0209258_10053440 162
232 3300025246 Ga0209646_1000094 Ga0209646_100009453 162
233 3300025250 Ga0209026_1000009 Ga0209026_1000009148 162
234 3300025253 Ga0209677_100015 Ga0209677_100015519 162
235 3300025253 Ga0209677_100097 Ga0209677_10009789 162
236 3300025256 Ga0209759_1000065 Ga0209759_1000065148 162
237 3300025256 Ga0209759_1003887 Ga0209759_10038873 162
238 3300025256 Ga0209759_1019935 Ga0209759_10199353 162
239 3300025909 Ga0207705_10100089 Ga0207705_101000892 162
240 3300025913 Ga0207695_10006850 Ga0207695_1000685010 162
241 3300025914 Ga0207671_10141837 Ga0207671_101418372 162
242 3300025920 Ga0207649_10220052 Ga0207649_102200522 162
243 3300025924 Ga0207694_10030681 Ga0207694_100306813 162
244 3300025932 Ga0207690_10435187 Ga0207690_104351872 162
245 3300025935 Ga0207709_10292981 Ga0207709_102929812 162
246 3300025942 Ga0207689_10016451 Ga0207689_100164515 162
247 3300025949 Ga0207667_10003402 Ga0207667_1000340214 162
248 3300025949 Ga0207667_10149506 Ga0207667_101495061 162
249 3300025981 Ga0207640_10030508 Ga0207640_100305083 162
250 3300026041 Ga0207639_10055568 Ga0207639_100555683 162
251 3300026078 Ga0207702_10000610 Ga0207702_1000061034 162
252 3300026116 Ga0207674_10012735 Ga0207674_100127359 162
253 3300026118 Ga0207675_100005379 Ga0207675_1000053795 162
254 3300026121 Ga0207683_10443896 Ga0207683_104438961 162
255 3300026142 Ga0207698_10147973 Ga0207698_101479733 162
256 3300028380 Ga0268265_10262708 Ga0268265_102627082 162
257 3300034820 Ga0373959_0004723 Ga0373959_0004723_73_567 162
258 3300035086 Ga0373934_0031837 Ga0373934_0031837_1100_1603 162
259 3300037466 Ga0395898_0043252 Ga0395898_0043252_52_546 162
260 3300038443 Ga0395901_0004756 Ga0395901_0004756_9981_10475 162
261 3300046471 Ga0495650_0013900 Ga0495650_0013900_100_600 162
262 3300046506 Ga0495583_0000062 Ga0495583_0000062_109392_109892 162
263 3300046507 Ga0495606_0002268 Ga0495606_0002268_14359_14859 162
264 3300046616 Ga0495668_0031002 Ga0495668_0031002_2311_2811 162
265 3300046660 Ga0495625_0010440 Ga0495625_0010440_3444_3944 162
266 3300046684 Ga0495669_0028090 Ga0495669_0028090_1543_2043 162
267 3300046694 Ga0495649_0003527 Ga0495649_0003527_3081_3581 162
268 3300046794 Ga0495589_0143920 Ga0495589_0143920_225_725 162
269 3300048903 Ga0496100_0297164 Ga0496100_0297164_690_1184 162
270 3300048917 Ga0496114_0246812 Ga0496114_0246812_522_1022 162
271 3300048918 Ga0496115_0303506 Ga0496115_0303506_432_932 162
272 3300053177 Ga0500636_0060106 Ga0500636_0060106_529_1029 162
273 3300055283 Ga0500661_014017 Ga0500661_014017_306_806 162
274 3300001979 JGI24740J21852_10021400 JGI24740J21852_100214002 163
275 3300005563 Ga0068855_100046672 Ga0068855_1000466725 163
276 3300005616 Ga0068852_100400980 Ga0068852_1004009802 163
277 3300025949 Ga0207667_10478071 Ga0207667_104780712 163
278 3300026142 Ga0207698_10170648 Ga0207698_101706482 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22817

ApeP-like

ApeP dehydratase

12

156

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qsr-assembly1.cif.gz_B the dehydratase heterocomplex apei:p from xenorhabdus doucetiae 0.9215 13 159
6qsr-assembly1.cif.gz_B the dehydratase heterocomplex apei:p from xenorhabdus doucetiae 0.8868 13 159
3az8-assembly2.cif.gz_I beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from plasmodium falciparum in complex with nas21 0.8683 17 148
3az9-assembly2.cif.gz_G beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from plasmodium falciparum in complex with nas91 0.8654 17 150
2okh-assembly1.cif.gz_B crystal structure of dimeric form of pffabz in crystal form3 0.8609 29 148
ID Description Score Start End Superfamily
af_K7L5F2_57_205_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8685 17 148 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8478 17 147 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8405 17 151 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8404 17 148 3.10.129.10
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8331 14 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7W5NS88-F1-model_v4 Putative hotdog family 3-hydroxylacyl-ACP dehydratase 0.9875 13 160
AF-A0A557RG36-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.9869 13 151
AF-A0A4Q7W179-F1-model_v4 Putative hotdog family 3-hydroxylacyl-ACP dehydratase 0.9866 17 151
AF-A0A2W6LUV9-F1-model_v4 deleted 0.9856 17 160
AF-A0A4Z0BNI8-F1-model_v4 3-hydroxylacyl-ACP dehydratase 0.9855 15 152

Feature Viewer

pLDDT pTM Quality
90.37 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map