F382234

General Info

Members Datasets Scaffolds Average Seq Length
278 158 556 183

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100045126|Ga0070708_1000451264
Length 207
Sequence MKSILTTVAAVLVAATALAADNFIVDKNHSEATFQVRHLVSRVSGRFDDFAGAISVDQANPAASSVEFNIKTASINTGVEGRDKDLRSANFFEVEKFPEISFKSTSIKPSSRKDVYDVTGTFTMHGVTKTITLPVEFLGFIKDPRGNQRAGFTAHTTLNRKDYGITWNRALDNGGTLLSDDVDITVNIEAAKSAAAIKEEVKKEKTE

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 1.08
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 10.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100045126 3300005445 Bacteria 3881
2 Ga0065714_10345581 3300005288 Bacteria 641
3 Ga0065704_10165825 3300005289 Bacteria 1323
4 Ga0065704_10203621 3300005289 Bacteria 1136
5 Ga0065712_10104815 3300005290 Bacteria 1952
6 Ga0065715_10098300 3300005293 Bacteria 3568
7 Ga0065715_10307588 3300005293 Bacteria 1027
8 Ga0065707_10008904 3300005295 Bacteria 3122
9 Ga0070670_100103342 3300005331 Bacteria 2454
10 Ga0070670_100272845 3300005331 Bacteria 1476
11 Ga0068869_100138930 3300005334 Unclassified 1874
12 Ga0070660_101082785 3300005339 Bacteria 678
13 Ga0070691_10703337 3300005341 Bacteria 607
14 Ga0070668_100024998 3300005347 Bacteria 4527
15 Ga0070669_100004093 3300005353 Bacteria 10565
16 Ga0070669_101152641 3300005353 Bacteria 669
17 Ga0070675_100013803 3300005354 Bacteria 6359
18 Ga0070674_100135711 3300005356 Bacteria 1840
19 Ga0070673_100348859 3300005364 Unclassified 1313
20 Ga0070688_100065575 3300005365 Bacteria 2308
21 Ga0070667_100476203 3300005367 Unclassified 1143
22 Ga0070667_100753535 3300005367 Unclassified 903
23 Ga0070705_100000547 3300005440 Bacteria 21841
24 Ga0070700_100079516 3300005441 Bacteria 2114
25 Ga0070700_100773986 3300005441 Bacteria 770
26 Ga0070694_100001919 3300005444 Bacteria 12303
27 Ga0070708_100075718 3300005445 Bacteria 3038
28 Ga0070708_100173027 3300005445 Bacteria 2017
29 Ga0070662_100136848 3300005457 Bacteria 1895
30 Ga0070706_100028636 3300005467 Bacteria 5129
31 Ga0070706_100053350 3300005467 Bacteria 3731
32 Ga0070707_100017361 3300005468 Bacteria 6765
33 Ga0070707_100102484 3300005468 Bacteria 2773
34 Ga0070707_100153565 3300005468 Bacteria 2242
35 Ga0070707_100216692 3300005468 Bacteria 1865
36 Ga0070698_100046442 3300005471 Bacteria 4440
37 Ga0070698_100077492 3300005471 Bacteria 3324
38 Ga0070698_100147585 3300005471 Bacteria 2300
39 Ga0070698_100160025 3300005471 Bacteria 2196
40 Ga0070698_100253625 3300005471 Bacteria 1692
41 Ga0070699_100100998 3300005518 Bacteria 2528
42 Ga0070699_100178937 3300005518 Bacteria 1881
43 Ga0070699_100253026 3300005518 Bacteria 1574
44 Ga0070699_100430951 3300005518 Bacteria 1194
45 Ga0070699_100551856 3300005518 Bacteria 1049
46 Ga0070697_100030994 3300005536 Bacteria 4299
47 Ga0070697_100043965 3300005536 Bacteria 3617
48 Ga0070697_100283664 3300005536 Bacteria 1421
49 Ga0070697_100393178 3300005536 Bacteria 1202
50 Ga0070672_100093977 3300005543 Bacteria 2423
51 Ga0070695_100000516 3300005545 Bacteria 20312
52 Ga0070696_100004786 3300005546 Bacteria 9049
53 Ga0070696_100046406 3300005546 Bacteria 3012
54 Ga0070704_100071907 3300005549 Bacteria 2515
55 Ga0070704_100397508 3300005549 Bacteria 1175
56 Ga0070664_100281017 3300005564 Bacteria 1501
57 Ga0068857_100102925 3300005577 Bacteria 2564
58 Ga0068857_100154663 3300005577 Unclassified 2079
59 Ga0068859_100186291 3300005617 Bacteria 2159
60 Ga0068859_100396355 3300005617 Bacteria 1476
61 Ga0068864_100090629 3300005618 Bacteria 2696
62 Ga0068864_100201164 3300005618 Bacteria 1830
63 Ga0068861_100779344 3300005719 Bacteria 896
64 Ga0068851_10365564 3300005834 Bacteria 842
65 Ga0068870_10040723 3300005840 Bacteria 2411
66 Ga0068858_100006172 3300005842 Bacteria 11688
67 Ga0068860_100148199 3300005843 Bacteria 2259
68 Ga0068860_100459378 3300005843 Unclassified 1267
69 Ga0068862_100086485 3300005844 Bacteria 2725
70 Ga0075432_10061094 3300006058 Bacteria 1342
71 Ga0075367_10130714 3300006178 Bacteria 1552
72 Ga0097621_100149889 3300006237 Bacteria 2000
73 Ga0097621_100338388 3300006237 Unclassified 1336
74 Ga0068871_100017287 3300006358 Bacteria 5454
75 Ga0075428_100026876 3300006844 Bacteria 6373
76 Ga0075428_100124740 3300006844 Bacteria 2803
77 Ga0075428_100504695 3300006844 Unclassified 1294
78 Ga0075430_100034804 3300006846 Bacteria 4276
79 Ga0075430_100414688 3300006846 Bacteria 1112
80 Ga0075431_100140454 3300006847 Bacteria 2490
81 Ga0075433_10177449 3300006852 Bacteria 1895
82 Ga0075434_100320139 3300006871 Bacteria 1571
83 Ga0075434_101023374 3300006871 Bacteria 840
84 Ga0075429_100027191 3300006880 Bacteria 4965
85 Ga0068865_100398218 3300006881 Bacteria 1127
86 Ga0075436_100017730 3300006914 Bacteria 4874
87 Ga0097620_100186293 3300006931 Bacteria 2159
88 Ga0097620_100396423 3300006931 Bacteria 1476
89 Ga0075435_100111598 3300007076 Bacteria 2274
90 Ga0075435_100980508 3300007076 Bacteria 738
91 Ga0111539_10014015 3300009094 Bacteria 10018
92 Ga0111539_10065505 3300009094 Bacteria 4292
93 Ga0111539_10408698 3300009094 Bacteria 1581
94 Ga0105245_10023929 3300009098 Bacteria 5360
95 Ga0105245_10126908 3300009098 Bacteria 2389
96 Ga0105245_10576438 3300009098 Unclassified 1149
97 Ga0105247_10204786 3300009101 Unclassified 1328
98 Ga0114129_10005207 3300009147 Bacteria 18324
99 Ga0114129_10020395 3300009147 Bacteria 9428
100 Ga0114129_10020847 3300009147 Bacteria 9311
101 Ga0114129_10350407 3300009147 Bacteria 1956
102 Ga0105243_11156360 3300009148 Bacteria 785
103 Ga0105242_10001219 3300009176 Bacteria 20289
104 Ga0105242_10225468 3300009176 Bacteria 1677
105 Ga0105242_10374960 3300009176 Bacteria 1321
106 Ga0105242_10394921 3300009176 Unclassified 1289
107 Ga0105248_10081704 3300009177 Unclassified 3633
108 Ga0105248_10393474 3300009177 Bacteria 1560
109 Ga0105248_11360145 3300009177 Unclassified 803
110 Ga0105249_10005172 3300009553 Bacteria 11256
111 Ga0105249_10381213 3300009553 Bacteria 1436
112 Ga0105239_11553060 3300010375 Bacteria 765
113 Ga0105246_10105921 3300011119 Bacteria 2056
114 Ga0105246_10329768 3300011119 Bacteria 1243
115 Ga0157374_10025227 3300013296 Bacteria 5334
116 Ga0157378_10773960 3300013297 Bacteria 984
117 Ga0163162_10025937 3300013306 Bacteria 5792
118 Ga0163162_10440588 3300013306 Bacteria 1435
119 Ga0163162_11179287 3300013306 Bacteria 869
120 Ga0163163_10037770 3300014325 Bacteria 4699
121 Ga0157380_10356304 3300014326 Bacteria 1371
122 Ga0157379_11056093 3300014968 Unclassified 776
123 Ga0157376_10336554 3300014969 Unclassified 1440
124 Ga0207697_10054505 3300025315 Bacteria 1657
125 Ga0207656_10195675 3300025321 Bacteria 975
126 Ga0207643_10159945 3300025908 Bacteria 1355
127 Ga0207684_10216035 3300025910 Bacteria 1654
128 Ga0207684_10223944 3300025910 Unclassified 1623
129 Ga0207684_11274126 3300025910 Unclassified 606
130 Ga0207695_10179792 3300025913 Bacteria 2036
131 Ga0207646_10154054 3300025922 Bacteria 2073
132 Ga0207646_10325499 3300025922 Bacteria 1389
133 Ga0207646_10804266 3300025922 Bacteria 837
134 Ga0207681_10026500 3300025923 Bacteria 3739
135 Ga0207650_10183087 3300025925 Bacteria 1670
136 Ga0207650_10215083 3300025925 Bacteria 1545
137 Ga0207659_10386187 3300025926 Bacteria 1168
138 Ga0207659_10606617 3300025926 Bacteria 933
139 Ga0207687_10001199 3300025927 Bacteria 17724
140 Ga0207687_10281604 3300025927 Bacteria 1333
141 Ga0207687_10447103 3300025927 Bacteria 1071
142 Ga0207644_10304502 3300025931 Unclassified 1285
143 Ga0207644_10607221 3300025931 Bacteria 909
144 Ga0207706_10528132 3300025933 Bacteria 1017
145 Ga0207706_11086446 3300025933 Bacteria 669
146 Ga0207686_10127409 3300025934 Bacteria 1742
147 Ga0207686_10469882 3300025934 Bacteria 971
148 Ga0207669_10109679 3300025937 Bacteria 1846
149 Ga0207704_10016972 3300025938 Bacteria 3760
150 Ga0207704_10376755 3300025938 Unclassified 1113
151 Ga0207691_10372841 3300025940 Bacteria 1219
152 Ga0207691_11121041 3300025940 Bacteria 654
153 Ga0207711_10298199 3300025941 Bacteria 1486
154 Ga0207712_10220728 3300025961 Bacteria 1515
155 Ga0207658_10408435 3300025986 Bacteria 1195
156 Ga0207677_10238186 3300026023 Bacteria 1470
157 Ga0207677_11006667 3300026023 Unclassified 756
158 Ga0207703_10015203 3300026035 Bacteria 6006
159 Ga0207703_10481488 3300026035 Unclassified 1163
160 Ga0207708_10684606 3300026075 Bacteria 875
161 Ga0207648_10663121 3300026089 Bacteria 965
162 Ga0207676_10579902 3300026095 Bacteria 1075
163 Ga0207674_10040266 3300026116 Bacteria 4842
164 Ga0207674_10110362 3300026116 Bacteria 2726
165 Ga0207675_100051922 3300026118 Bacteria 3826
166 Ga0207428_10553511 3300027907 Bacteria 832
167 Ga0268266_10078000 3300028379 Bacteria 2881
168 Ga0268265_10071752 3300028380 Bacteria 2698
169 Ga0268264_10826824 3300028381 Unclassified 926
170 Ga0307416_101174292 3300032002 Bacteria 873
171 Ga0373931_0198307 3300035691 Bacteria 1198
172 Ga0436365_1431642 3300039437 Bacteria 1055
173 Ga0453683_0155591 3300044673 Bacteria 1445
174 Ga0453684_0052016 3300044712 Bacteria 5361
175 Ga0495628_0059512 3300046516 Unclassified 2999
176 Ga0495586_0349807 3300046535 Bacteria 849
177 Ga0495658_0033546 3300046683 Unclassified 2813
178 Ga0495613_0801014 3300046689 Bacteria 615
179 Ga0495674_0405669 3300047319 Bacteria 1100
180 Ga0495685_043157 3300047447 Bacteria 1539
181 Ga0496104_0238372 3300048907 Bacteria 1731
182 Ga0496110_0795003 3300048913 Bacteria 850
183 Ga0496114_1012314 3300048917 Bacteria 714
184 Ga0496119_0446708 3300048922 Unclassified 610
185 Ga0501031_0014230 3300049568 Bacteria 5175
186 Ga0501031_0072418 3300049568 Bacteria 2243
187 Ga0501031_0102313 3300049568 Bacteria 1869
188 Ga0501032_0006926 3300049569 Bacteria 8311
189 Ga0501032_0007025 3300049569 Bacteria 8256
190 Ga0501033_0000480 3300049570 Bacteria 37720
191 Ga0501033_0000783 3300049570 Bacteria 29163
192 Ga0501034_0459214 3300049571 Bacteria 1190
193 Ga0501036_0002195 3300049572 Bacteria 15250
194 Ga0501036_0005723 3300049572 Bacteria 10078
195 Ga0501036_0013577 3300049572 Bacteria 6769
196 Ga0501037_0001958 3300049573 Bacteria 14879
197 Ga0501037_0006083 3300049573 Bacteria 8819
198 Ga0501037_0029853 3300049573 Bacteria 4028
199 Ga0501038_0000695 3300049574 Bacteria 29921
200 Ga0501039_0007231 3300049575 Bacteria 8459
201 Ga0501039_0030953 3300049575 Bacteria 4126
202 Ga0501039_0283839 3300049575 Bacteria 1301
203 Ga0501042_0098764 3300049578 Bacteria 2099
204 Ga0501042_0273077 3300049578 Bacteria 1220
205 Ga0501043_0001669 3300049579 Bacteria 19289
206 Ga0501043_0078124 3300049579 Bacteria 2600
207 Ga0501043_0141823 3300049579 Bacteria 1881
208 Ga0501046_0004593 3300049580 Bacteria 12468
209 Ga0501046_0004638 3300049580 Bacteria 12415
210 Ga0501046_0040710 3300049580 Bacteria 3711
211 Ga0501047_0001616 3300049581 Bacteria 21973
212 Ga0501047_0013672 3300049581 Bacteria 7704
213 Ga0501048_0007827 3300049582 Bacteria 8097
214 Ga0501048_0010048 3300049582 Bacteria 7080
215 Ga0501048_0012074 3300049582 Bacteria 6437
216 Ga0501067_0002152 3300049583 Bacteria 10861
217 Ga0501067_0006975 3300049583 Bacteria 6268
218 Ga0501067_0102504 3300049583 Bacteria 1590
219 Ga0501068_0002474 3300049584 Bacteria 9813
220 Ga0501068_0004388 3300049584 Bacteria 7677
221 Ga0501069_0001335 3300049585 Bacteria 12083
222 Ga0501069_0019835 3300049585 Bacteria 3637
223 Ga0501069_0059624 3300049585 Bacteria 2130
224 Ga0501070_0001606 3300049586 Bacteria 20054
225 Ga0501070_0073609 3300049586 Bacteria 2826
226 Ga0501071_0032426 3300049587 Bacteria 3710
227 Ga0501071_0176427 3300049587 Bacteria 1600
228 Ga0501072_0084409 3300049588 Bacteria 2518
229 Ga0501072_0109640 3300049588 Bacteria 2197
230 Ga0501073_0005422 3300049589 Bacteria 9552
231 Ga0501073_0045063 3300049589 Bacteria 3107
232 Ga0501074_0004918 3300049590 Bacteria 9575
233 Ga0501074_0009936 3300049590 Bacteria 6915
234 Ga0501075_1158630 3300049591 Bacteria 587
235 Ga0501076_1629795 3300049592 Bacteria 529
236 Ga0501079_0000682 3300049741 Bacteria 22753
237 Ga0501079_0031346 3300049741 Bacteria 4085
238 Ga0501079_0104053 3300049741 Bacteria 2202
239 Ga0501080_0016264 3300049742 Bacteria 6868
240 Ga0501080_0024230 3300049742 Bacteria 5626
241 Ga0501080_0092148 3300049742 Bacteria 2814
242 Ga0501081_0085960 3300049743 Bacteria 2208
243 Ga0501083_0038218 3300049744 Bacteria 3264
244 Ga0501083_0040355 3300049744 Bacteria 3168
245 Ga0501083_0080645 3300049744 Bacteria 2157
246 Ga0501035_0001044 3300049822 Bacteria 28962
247 Ga0501035_0336084 3300049822 Bacteria 1266
248 Ga0501044_0066133 3300049823 Bacteria 3686
249 Ga0501044_0092750 3300049823 Bacteria 3045
250 Ga0501044_1070063 3300049823 Bacteria 676
251 Ga0501045_0005339 3300049824 Bacteria 8901
252 Ga0501045_0481133 3300049824 Bacteria 922
253 Ga0501045_0881238 3300049824 Unclassified 658
254 nmdc:mga06z11_133841_c1 3300050494 Bacteria 1395
255 nmdc:mga05p37_128959_c1 3300050507 Bacteria 3105
256 nmdc:mga05p37_14966_c1 3300050507 Bacteria 9312
257 nmdc:mga05p37_160303_c1 3300050507 Bacteria 2748
258 nmdc:mga05p37_478651_c1 3300050507 Bacteria 1435
259 nmdc:mga05p37_813882_c1 3300050507 Bacteria 1020
260 nmdc:mga09592_1009689_c1 3300050508 Bacteria 695
261 nmdc:mga09592_693028_c1 3300050508 Bacteria 867
262 nmdc:mga0qj67_363371_c1 3300050509 Bacteria 1170
263 nmdc:mga06r32_212741_c1 3300050510 Bacteria 1921
264 nmdc:mga06r32_705214_c1 3300050510 Bacteria 975
265 nmdc:mga08y16_1221341_c1 3300050511 Bacteria 722
266 nmdc:mga08y16_148765_c1 3300050511 Unclassified 2434
267 nmdc:mga08y16_64078_c1 3300050511 Bacteria 3838
268 nmdc:mga08y16_92689_c1 3300050511 Bacteria 3148
269 nmdc:mga08y16_94256_c1 3300050511 Bacteria 3119
270 nmdc:mga0n895_196266_c1 3300050512 Bacteria 2050
271 nmdc:mga0rr50_242976_c1 3300050513 Bacteria 1493
272 nmdc:mga08x19_193643_c1 3300050514 Bacteria 1392
273 nmdc:mga0a205_80743_c1 3300050515 Bacteria 3142
274 Ga0501084_0011432 3300054114 Bacteria 7350
275 Ga0501084_0012320 3300054114 Bacteria 7081
276 Ga0501084_0966389 3300054114 Unclassified 716
277 Ga0501082_0001932 3300060353 Bacteria 18234
278 Ga0501082_0023673 3300060353 Bacteria 5295
279 Ga0070708_100045126
280 Ga0065714_10345581
281 Ga0065704_10165825
282 Ga0065704_10203621
283 Ga0065712_10104815
284 Ga0065715_10098300
285 Ga0065715_10307588
286 Ga0065707_10008904
287 Ga0070670_100103342
288 Ga0070670_100272845
289 Ga0068869_100138930
290 Ga0070660_101082785
291 Ga0070691_10703337
292 Ga0070668_100024998
293 Ga0070669_100004093
294 Ga0070669_101152641
295 Ga0070675_100013803
296 Ga0070674_100135711
297 Ga0070673_100348859
298 Ga0070688_100065575
299 Ga0070667_100476203
300 Ga0070667_100753535
301 Ga0070705_100000547
302 Ga0070700_100079516
303 Ga0070700_100773986
304 Ga0070694_100001919
305 Ga0070708_100075718
306 Ga0070708_100173027
307 Ga0070662_100136848
308 Ga0070706_100028636
309 Ga0070706_100053350
310 Ga0070707_100017361
311 Ga0070707_100102484
312 Ga0070707_100153565
313 Ga0070707_100216692
314 Ga0070698_100046442
315 Ga0070698_100077492
316 Ga0070698_100147585
317 Ga0070698_100160025
318 Ga0070698_100253625
319 Ga0070699_100100998
320 Ga0070699_100178937
321 Ga0070699_100253026
322 Ga0070699_100430951
323 Ga0070699_100551856
324 Ga0070697_100030994
325 Ga0070697_100043965
326 Ga0070697_100283664
327 Ga0070697_100393178
328 Ga0070672_100093977
329 Ga0070695_100000516
330 Ga0070696_100004786
331 Ga0070696_100046406
332 Ga0070704_100071907
333 Ga0070704_100397508
334 Ga0070664_100281017
335 Ga0068857_100102925
336 Ga0068857_100154663
337 Ga0068859_100186291
338 Ga0068859_100396355
339 Ga0068864_100090629
340 Ga0068864_100201164
341 Ga0068861_100779344
342 Ga0068851_10365564
343 Ga0068870_10040723
344 Ga0068858_100006172
345 Ga0068860_100148199
346 Ga0068860_100459378
347 Ga0068862_100086485
348 Ga0075432_10061094
349 Ga0075367_10130714
350 Ga0097621_100149889
351 Ga0097621_100338388
352 Ga0068871_100017287
353 Ga0075428_100026876
354 Ga0075428_100124740
355 Ga0075428_100504695
356 Ga0075430_100034804
357 Ga0075430_100414688
358 Ga0075431_100140454
359 Ga0075433_10177449
360 Ga0075434_100320139
361 Ga0075434_101023374
362 Ga0075429_100027191
363 Ga0068865_100398218
364 Ga0075436_100017730
365 Ga0097620_100186293
366 Ga0097620_100396423
367 Ga0075435_100111598
368 Ga0075435_100980508
369 Ga0111539_10014015
370 Ga0111539_10065505
371 Ga0111539_10408698
372 Ga0105245_10023929
373 Ga0105245_10126908
374 Ga0105245_10576438
375 Ga0105247_10204786
376 Ga0114129_10005207
377 Ga0114129_10020395
378 Ga0114129_10020847
379 Ga0114129_10350407
380 Ga0105243_11156360
381 Ga0105242_10001219
382 Ga0105242_10225468
383 Ga0105242_10374960
384 Ga0105242_10394921
385 Ga0105248_10081704
386 Ga0105248_10393474
387 Ga0105248_11360145
388 Ga0105249_10005172
389 Ga0105249_10381213
390 Ga0105239_11553060
391 Ga0105246_10105921
392 Ga0105246_10329768
393 Ga0157374_10025227
394 Ga0157378_10773960
395 Ga0163162_10025937
396 Ga0163162_10440588
397 Ga0163162_11179287
398 Ga0163163_10037770
399 Ga0157380_10356304
400 Ga0157379_11056093
401 Ga0157376_10336554
402 Ga0207697_10054505
403 Ga0207656_10195675
404 Ga0207643_10159945
405 Ga0207684_10216035
406 Ga0207684_10223944
407 Ga0207684_11274126
408 Ga0207695_10179792
409 Ga0207646_10154054
410 Ga0207646_10325499
411 Ga0207646_10804266
412 Ga0207681_10026500
413 Ga0207650_10183087
414 Ga0207650_10215083
415 Ga0207659_10386187
416 Ga0207659_10606617
417 Ga0207687_10001199
418 Ga0207687_10281604
419 Ga0207687_10447103
420 Ga0207644_10304502
421 Ga0207644_10607221
422 Ga0207706_10528132
423 Ga0207706_11086446
424 Ga0207686_10127409
425 Ga0207686_10469882
426 Ga0207669_10109679
427 Ga0207704_10016972
428 Ga0207704_10376755
429 Ga0207691_10372841
430 Ga0207691_11121041
431 Ga0207711_10298199
432 Ga0207712_10220728
433 Ga0207658_10408435
434 Ga0207677_10238186
435 Ga0207677_11006667
436 Ga0207703_10015203
437 Ga0207703_10481488
438 Ga0207708_10684606
439 Ga0207648_10663121
440 Ga0207676_10579902
441 Ga0207674_10040266
442 Ga0207674_10110362
443 Ga0207675_100051922
444 Ga0207428_10553511
445 Ga0268266_10078000
446 Ga0268265_10071752
447 Ga0268264_10826824
448 Ga0307416_101174292
449 Ga0373931_0198307
450 Ga0436365_1431642
451 Ga0453683_0155591
452 Ga0453684_0052016
453 Ga0495628_0059512
454 Ga0495586_0349807
455 Ga0495658_0033546
456 Ga0495613_0801014
457 Ga0495674_0405669
458 Ga0495685_043157
459 Ga0496104_0238372
460 Ga0496110_0795003
461 Ga0496114_1012314
462 Ga0496119_0446708
463 Ga0501031_0014230
464 Ga0501031_0072418
465 Ga0501031_0102313
466 Ga0501032_0006926
467 Ga0501032_0007025
468 Ga0501033_0000480
469 Ga0501033_0000783
470 Ga0501034_0459214
471 Ga0501036_0002195
472 Ga0501036_0005723
473 Ga0501036_0013577
474 Ga0501037_0001958
475 Ga0501037_0006083
476 Ga0501037_0029853
477 Ga0501038_0000695
478 Ga0501039_0007231
479 Ga0501039_0030953
480 Ga0501039_0283839
481 Ga0501042_0098764
482 Ga0501042_0273077
483 Ga0501043_0001669
484 Ga0501043_0078124
485 Ga0501043_0141823
486 Ga0501046_0004593
487 Ga0501046_0004638
488 Ga0501046_0040710
489 Ga0501047_0001616
490 Ga0501047_0013672
491 Ga0501048_0007827
492 Ga0501048_0010048
493 Ga0501048_0012074
494 Ga0501067_0002152
495 Ga0501067_0006975
496 Ga0501067_0102504
497 Ga0501068_0002474
498 Ga0501068_0004388
499 Ga0501069_0001335
500 Ga0501069_0019835
501 Ga0501069_0059624
502 Ga0501070_0001606
503 Ga0501070_0073609
504 Ga0501071_0032426
505 Ga0501071_0176427
506 Ga0501072_0084409
507 Ga0501072_0109640
508 Ga0501073_0005422
509 Ga0501073_0045063
510 Ga0501074_0004918
511 Ga0501074_0009936
512 Ga0501075_1158630
513 Ga0501076_1629795
514 Ga0501079_0000682
515 Ga0501079_0031346
516 Ga0501079_0104053
517 Ga0501080_0016264
518 Ga0501080_0024230
519 Ga0501080_0092148
520 Ga0501081_0085960
521 Ga0501083_0038218
522 Ga0501083_0040355
523 Ga0501083_0080645
524 Ga0501035_0001044
525 Ga0501035_0336084
526 Ga0501044_0066133
527 Ga0501044_0092750
528 Ga0501044_1070063
529 Ga0501045_0005339
530 Ga0501045_0481133
531 Ga0501045_0881238
532 nmdc:mga06z11_133841_c1
533 nmdc:mga05p37_128959_c1
534 nmdc:mga05p37_14966_c1
535 nmdc:mga05p37_160303_c1
536 nmdc:mga05p37_478651_c1
537 nmdc:mga05p37_813882_c1
538 nmdc:mga09592_1009689_c1
539 nmdc:mga09592_693028_c1
540 nmdc:mga0qj67_363371_c1
541 nmdc:mga06r32_212741_c1
542 nmdc:mga06r32_705214_c1
543 nmdc:mga08y16_1221341_c1
544 nmdc:mga08y16_148765_c1
545 nmdc:mga08y16_64078_c1
546 nmdc:mga08y16_92689_c1
547 nmdc:mga08y16_94256_c1
548 nmdc:mga0n895_196266_c1
549 nmdc:mga0rr50_242976_c1
550 nmdc:mga08x19_193643_c1
551 nmdc:mga0a205_80743_c1
552 Ga0501084_0011432
553 Ga0501084_0012320
554 Ga0501084_0966389
555 Ga0501082_0001932
556 Ga0501082_0023673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

23

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.943 14 177
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9286 11 181
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9267 11 181
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9201 14 177
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9178 11 181
ID Description Score Start End Superfamily
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9274 11 181 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9114 11 181 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9065 11 179 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9056 14 177 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9027 32 181 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A3D1SFP7-F1-model_v4 Polyisoprenoid-binding protein 0.9792 11 154
AF-A0A1G4AKB1-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9681 10 181
AF-A0A7C2Q9A1-F1-model_v4 Polyisoprenoid-binding protein 0.9653 1 179
AF-A0A1J5T5Q0-F1-model_v4 Protein YceI 0.9644 1 181
AF-A0A7X1E7M9-F1-model_v4 YceI family protein 0.9628 1 181

Map