F382036

General Info

Members Datasets Scaffolds Average Seq Length
277 187 554 154

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0346283|Ga0501040_0346283_233_757
Length 174
Sequence LRRAPNAPTIGPVAPRATVVTGKMPGQAVKDFSLPATGGGTFQLAKAAARLVVLYFYPKDNTPGCTTEGQQFAALHKEFRKAGAEVYGISRDSLRSHENFKAKMDFPFDLLADETEKVCQQFGVIKMKNMYGKQVRGIERSTFVLDAKRAIRREWRGVKVPGHAKEVLDFVKAL

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
62 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 0.36
Rhizosphere 97.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0346283 3300049576 Bacteria 1064
2 JGI24034J26672_10068459 3300002239 Bacteria 633
3 JGI26145J50221_1026802 3300003371 Bacteria 577
4 Ga0065715_10036036 3300005293 Bacteria 1304
5 Ga0070658_10295130 3300005327 Bacteria 1382
6 Ga0070658_10381918 3300005327 Bacteria 1208
7 Ga0070676_10082752 3300005328 Bacteria 1951
8 Ga0070676_10269787 3300005328 Bacteria 1142
9 Ga0070683_100003358 3300005329 Bacteria 12961
10 Ga0070683_100735890 3300005329 Bacteria 945
11 Ga0070683_101382751 3300005329 Bacteria 677
12 Ga0070670_100116617 3300005331 Bacteria 2302
13 Ga0070670_100639961 3300005331 Bacteria 953
14 Ga0068869_100320198 3300005334 Bacteria 1257
15 Ga0068869_100557573 3300005334 Bacteria 963
16 Ga0068868_100142687 3300005338 Bacteria 1967
17 Ga0070691_10402002 3300005341 Bacteria 772
18 Ga0070687_100218269 3300005343 Bacteria 1166
19 Ga0070661_100509759 3300005344 Bacteria 964
20 Ga0070668_100105961 3300005347 Bacteria 2233
21 Ga0070669_100335498 3300005353 Bacteria 1224
22 Ga0070669_100577856 3300005353 Bacteria 939
23 Ga0070675_100003765 3300005354 Bacteria 11517
24 Ga0070675_100075350 3300005354 Bacteria 2805
25 Ga0070675_100346095 3300005354 Bacteria 1317
26 Ga0070674_100201974 3300005356 Bacteria 1535
27 Ga0070674_100411859 3300005356 Bacteria 1107
28 Ga0070673_101004609 3300005364 Bacteria 777
29 Ga0070688_100463241 3300005365 Bacteria 950
30 Ga0070667_100106180 3300005367 Bacteria 2431
31 Ga0070667_100150958 3300005367 Bacteria 2041
32 Ga0070667_100196702 3300005367 Bacteria 1787
33 Ga0070667_100321611 3300005367 Bacteria 1396
34 Ga0070701_10012355 3300005438 Bacteria 3849
35 Ga0070705_100246741 3300005440 Bacteria 1251
36 Ga0070700_100097183 3300005441 Bacteria 1934
37 Ga0070694_100010373 3300005444 Bacteria 5746
38 Ga0070663_100653158 3300005455 Bacteria 890
39 Ga0070678_100001667 3300005456 Bacteria 11896
40 Ga0070678_100093065 3300005456 Bacteria 2317
41 Ga0070678_101291727 3300005456 Bacteria 679
42 Ga0070662_100155897 3300005457 Bacteria 1782
43 Ga0068867_100267367 3300005459 Bacteria 1396
44 Ga0068867_100391074 3300005459 Bacteria 1170
45 Ga0070707_100561760 3300005468 Bacteria 1103
46 Ga0070679_100649418 3300005530 Bacteria 998
47 Ga0070684_102189257 3300005535 Bacteria 522
48 Ga0070672_100427767 3300005543 Bacteria 1138
49 Ga0070686_100045738 3300005544 Bacteria 2758
50 Ga0070695_100079895 3300005545 Bacteria 2160
51 Ga0070693_100572988 3300005547 Bacteria 811
52 Ga0070665_100086087 3300005548 Bacteria 3149
53 Ga0070665_100110295 3300005548 Bacteria 2754
54 Ga0070704_100108834 3300005549 Bacteria 2105
55 Ga0070704_100493371 3300005549 Bacteria 1061
56 Ga0070664_100004893 3300005564 Bacteria 10730
57 Ga0070664_100026183 3300005564 Bacteria 4837
58 Ga0070664_100039893 3300005564 Bacteria 3958
59 Ga0068857_100369511 3300005577 Bacteria 1330
60 Ga0068852_100111325 3300005616 Bacteria 2490
61 Ga0068859_101381961 3300005617 Bacteria 776
62 Ga0068864_100288118 3300005618 Bacteria 1535
63 Ga0068864_101987169 3300005618 Bacteria 587
64 Ga0068866_10040175 3300005718 Bacteria 2314
65 Ga0068861_100381481 3300005719 Bacteria 1245
66 Ga0068851_10005335 3300005834 Bacteria 5837
67 Ga0068863_100067668 3300005841 Bacteria 3378
68 Ga0068863_100646677 3300005841 Bacteria 1048
69 Ga0068860_100184001 3300005843 Bacteria 2020
70 Ga0068860_100188300 3300005843 Bacteria 1996
71 Ga0068862_100061523 3300005844 Bacteria 3228
72 Ga0075362_10268471 3300006177 Bacteria 842
73 Ga0075366_10000193 3300006195 Bacteria 26864
74 Ga0068871_100001574 3300006358 Bacteria 15332
75 Ga0068865_100081778 3300006881 Bacteria 2320
76 Ga0097620_101381973 3300006931 Bacteria 776
77 Ga0075435_100459551 3300007076 Bacteria 1098
78 Ga0105240_10093577 3300009093 Bacteria 3668
79 Ga0111539_10229996 3300009094 Bacteria 2159
80 Ga0105242_10462639 3300009176 Bacteria 1198
81 Ga0105242_10674645 3300009176 Bacteria 1008
82 Ga0105248_11178936 3300009177 Bacteria 866
83 Ga0105249_10556618 3300009553 Bacteria 1198
84 Ga0105239_12650803 3300010375 Bacteria 585
85 Ga0157318_1004040 3300012482 Bacteria 878
86 Ga0157327_1000658 3300012512 Bacteria 1921
87 Ga0157373_10288532 3300013100 Bacteria 1164
88 Ga0157370_10070211 3300013104 Bacteria 3307
89 Ga0157374_10004186 3300013296 Bacteria 12121
90 Ga0157374_10249456 3300013296 Bacteria 1747
91 Ga0157374_10659726 3300013296 Bacteria 1058
92 Ga0163162_10320301 3300013306 Bacteria 1683
93 Ga0163162_11296115 3300013306 Bacteria 828
94 Ga0163162_11606110 3300013306 Bacteria 742
95 Ga0157372_10720446 3300013307 Bacteria 1160
96 Ga0157372_10818459 3300013307 Bacteria 1082
97 Ga0157372_11195661 3300013307 Bacteria 879
98 Ga0157375_10127714 3300013308 Bacteria 2659
99 Ga0157375_10449037 3300013308 Bacteria 1455
100 Ga0157375_10782861 3300013308 Bacteria 1103
101 Ga0157375_12883807 3300013308 Bacteria 575
102 Ga0163163_10312940 3300014325 Bacteria 1623
103 Ga0163163_10403381 3300014325 Bacteria 1425
104 Ga0163163_10575149 3300014325 Bacteria 1190
105 Ga0157379_10373995 3300014968 Bacteria 1307
106 Ga0157376_10066513 3300014969 Bacteria 3047
107 Ga0163161_10123595 3300017792 Bacteria 1947
108 Ga0207673_1005523 3300025290 Bacteria 1546
109 Ga0207697_10006701 3300025315 Bacteria 5189
110 Ga0207697_10012374 3300025315 Bacteria 3578
111 Ga0207697_10047751 3300025315 Bacteria 1765
112 Ga0207642_10093845 3300025899 Bacteria 1489
113 Ga0207688_10005480 3300025901 Bacteria 6898
114 Ga0207645_10006661 3300025907 Bacteria 8250
115 Ga0207645_10978942 3300025907 Bacteria 573
116 Ga0207705_10115953 3300025909 Bacteria 1983
117 Ga0207695_10220323 3300025913 Bacteria 1805
118 Ga0207671_10369718 3300025914 Bacteria 1138
119 Ga0207660_10697226 3300025917 Bacteria 828
120 Ga0207662_10018779 3300025918 Bacteria 3926
121 Ga0207649_11098251 3300025920 Bacteria 627
122 Ga0207681_10322192 3300025923 Bacteria 1229
123 Ga0207650_10004906 3300025925 Bacteria 9132
124 Ga0207650_10086907 3300025925 Bacteria 2381
125 Ga0207659_10039362 3300025926 Bacteria 3297
126 Ga0207690_10135070 3300025932 Bacteria 1810
127 Ga0207706_10041269 3300025933 Bacteria 4090
128 Ga0207686_10046861 3300025934 Bacteria 2669
129 Ga0207686_10423175 3300025934 Bacteria 1019
130 Ga0207709_10030730 3300025935 Bacteria 3128
131 Ga0207670_10230796 3300025936 Bacteria 1421
132 Ga0207670_10746344 3300025936 Bacteria 813
133 Ga0207669_10190052 3300025937 Bacteria 1480
134 Ga0207669_10218500 3300025937 Bacteria 1397
135 Ga0207704_10517723 3300025938 Bacteria 964
136 Ga0207689_10218789 3300025942 Bacteria 1573
137 Ga0207689_10616299 3300025942 Bacteria 913
138 Ga0207661_11774632 3300025944 Bacteria 562
139 Ga0207679_10010400 3300025945 Bacteria 5989
140 Ga0207679_10092884 3300025945 Bacteria 2339
141 Ga0207679_10115313 3300025945 Bacteria 2128
142 Ga0207667_10221978 3300025949 Bacteria 1936
143 Ga0207651_10762205 3300025960 Bacteria 856
144 Ga0207668_10150037 3300025972 Bacteria 1803
145 Ga0207658_10132864 3300025986 Bacteria 2002
146 Ga0207658_10281241 3300025986 Bacteria 1426
147 Ga0207658_10285676 3300025986 Bacteria 1416
148 Ga0207677_10265567 3300026023 Bacteria 1401
149 Ga0207677_10845400 3300026023 Bacteria 822
150 Ga0207703_11382027 3300026035 Bacteria 677
151 Ga0207639_10165925 3300026041 Bacteria 1865
152 Ga0207708_10005611 3300026075 Bacteria 9260
153 Ga0207641_10131698 3300026088 Bacteria 2246
154 Ga0207641_10232239 3300026088 Bacteria 1715
155 Ga0207648_10044162 3300026089 Bacteria 3910
156 Ga0207648_10248649 3300026089 Bacteria 1585
157 Ga0207676_10706438 3300026095 Bacteria 977
158 Ga0207674_10308162 3300026116 Bacteria 1532
159 Ga0207675_100071527 3300026118 Bacteria 3243
160 Ga0207683_10057895 3300026121 Bacteria 3402
161 Ga0207683_10380974 3300026121 Bacteria 1296
162 Ga0207698_10159893 3300026142 Bacteria 1968
163 Ga0207698_10616343 3300026142 Bacteria 1071
164 Ga0207698_10889709 3300026142 Bacteria 897
165 Ga0209971_1005384 3300027682 Bacteria 3043
166 Ga0209998_10049611 3300027717 Bacteria 969
167 Ga0209974_10047613 3300027876 Bacteria 1436
168 Ga0207428_10357690 3300027907 Bacteria 1073
169 Ga0268266_10133826 3300028379 Bacteria 2219
170 Ga0268266_10171313 3300028379 Bacteria 1970
171 Ga0268266_10368166 3300028379 Bacteria 1353
172 Ga0268265_10118512 3300028380 Bacteria 2176
173 Ga0268264_10159594 3300028381 Bacteria 2030
174 Ga0268264_10192019 3300028381 Bacteria 1862
175 Ga0268264_10330583 3300028381 Bacteria 1444
176 Ga0265338_10344639 3300028800 Bacteria 1073
177 Ga0265332_10058152 3300031238 Bacteria 1655
178 Ga0265328_10000038 3300031239 Bacteria 91571
179 Ga0265328_10020415 3300031239 Bacteria 2535
180 Ga0265328_10042167 3300031239 Bacteria 1680
181 Ga0265325_10088117 3300031241 Bacteria 1534
182 Ga0265331_10003526 3300031250 Bacteria 10053
183 Ga0265327_10000438 3300031251 Bacteria 75623
184 Ga0265327_10001651 3300031251 Bacteria 26917
185 Ga0265327_10005094 3300031251 Bacteria 11183
186 Ga0265327_10038790 3300031251 Bacteria 2595
187 Ga0265327_10051053 3300031251 Bacteria 2161
188 Ga0265327_10068822 3300031251 Bacteria 1779
189 Ga0265316_10025169 3300031344 Bacteria 4970
190 Ga0265316_10152028 3300031344 Bacteria 1734
191 Ga0307408_100004310 3300031548 Bacteria 9653
192 Ga0265314_10004570 3300031711 Bacteria 12777
193 Ga0265342_10007593 3300031712 Bacteria 7915
194 Ga0307405_10001375 3300031731 Bacteria 10202
195 Ga0307413_10013300 3300031824 Bacteria 4132
196 Ga0307410_10008880 3300031852 Bacteria 5606
197 Ga0307406_10025843 3300031901 Bacteria 3519
198 Ga0307407_10057090 3300031903 Bacteria 2263
199 Ga0307412_10030015 3300031911 Bacteria 3418
200 Ga0307412_11438758 3300031911 Bacteria 625
201 Ga0307409_100012433 3300031995 Bacteria 5424
202 Ga0307416_100010652 3300032002 Bacteria 6087
203 Ga0307416_100265606 3300032002 Bacteria 1681
204 Ga0307414_10056839 3300032004 Bacteria 2747
205 Ga0307411_10000280 3300032005 Bacteria 16974
206 Ga0307415_100030087 3300032126 Bacteria 3479
207 Ga0373939_0323437 3300035114 Bacteria 621
208 Ga0395898_0034042 3300037466 Bacteria 5081
209 Ga0395905_0000028 3300037471 Bacteria 294492
210 Ga0395905_0346125 3300037471 Bacteria 1378
211 Ga0395905_0432422 3300037471 Bacteria 1213
212 Ga0395901_0131673 3300038443 Bacteria 2628
213 Ga0451853_2086233 3300041512 Bacteria 945
214 Ga0451577_0344274 3300042876 Bacteria 1352
215 Ga0451577_1221424 3300042876 Bacteria 670
216 Ga0466963_0037905 3300044694 Bacteria 3151
217 Ga0466963_0506220 3300044694 Bacteria 853
218 Ga0453684_0256593 3300044712 Bacteria 2005
219 Ga0451576_0503130 3300045051 Bacteria 1273
220 Ga0451576_0912346 3300045051 Bacteria 922
221 Ga0466967_0060125 3300045976 Bacteria 3366
222 Ga0495621_0148728 3300046539 Bacteria 920
223 Ga0495658_0095646 3300046683 Bacteria 1766
224 Ga0496111_0014777 3300048914 Bacteria 5343
225 Ga0501300_073858 3300049523 Bacteria 555
226 Ga0501034_0025290 3300049571 Bacteria 6043
227 Ga0501036_0167510 3300049572 Bacteria 1851
228 Ga0501037_0675800 3300049573 Bacteria 689
229 Ga0501037_1079000 3300049573 Bacteria 521
230 Ga0501038_0082327 3300049574 Bacteria 2710
231 Ga0501038_0301224 3300049574 Bacteria 1258
232 Ga0501039_0034334 3300049575 Bacteria 3914
233 Ga0501039_0105229 3300049575 Bacteria 2203
234 Ga0501041_0025060 3300049577 Bacteria 3584
235 Ga0501042_0085825 3300049578 Bacteria 2257
236 Ga0501047_0037580 3300049581 Bacteria 4681
237 Ga0501048_0013248 3300049582 Bacteria 6119
238 Ga0501068_0006943 3300049584 Bacteria 6263
239 Ga0501068_0136806 3300049584 Bacteria 1534
240 Ga0501069_0000613 3300049585 Bacteria 16520
241 Ga0501069_0020484 3300049585 Bacteria 3583
242 Ga0501070_0077017 3300049586 Bacteria 2761
243 Ga0501070_0092253 3300049586 Bacteria 2506
244 Ga0501071_0274980 3300049587 Bacteria 1274
245 Ga0501071_0859236 3300049587 Bacteria 700
246 Ga0501072_0013687 3300049588 Bacteria 6211
247 Ga0501073_0050776 3300049589 Bacteria 2905
248 Ga0501073_0192303 3300049589 Bacteria 1412
249 Ga0501074_0003291 3300049590 Bacteria 11429
250 Ga0501074_0010752 3300049590 Bacteria 6649
251 Ga0501074_0223819 3300049590 Bacteria 1339
252 Ga0501075_0004447 3300049591 Bacteria 9488
253 Ga0501076_0014163 3300049592 Bacteria 5999
254 Ga0501076_0085295 3300049592 Bacteria 2538
255 Ga0501077_0027820 3300049593 Bacteria 3591
256 Ga0501079_0000832 3300049741 Bacteria 20981
257 Ga0501079_0012357 3300049741 Bacteria 6516
258 Ga0501080_0046846 3300049742 Bacteria 4024
259 Ga0501080_0123339 3300049742 Bacteria 2400
260 Ga0501080_0530708 3300049742 Bacteria 1049
261 Ga0501081_1420697 3300049743 Bacteria 527
262 Ga0501083_0013722 3300049744 Bacteria 5668
263 Ga0501083_0204888 3300049744 Bacteria 1286
264 Ga0501035_0024242 3300049822 Bacteria 5565
265 Ga0501035_0754688 3300049822 Bacteria 780
266 Ga0501044_0273031 3300049823 Bacteria 1626
267 Ga0501045_0006158 3300049824 Bacteria 8311
268 nmdc:mga0k408_730_c1 3300050493 Bacteria 18036
269 nmdc:mga05p37_80753_c1 3300050507 Bacteria 4005
270 nmdc:mga08y16_199894_c1 3300050511 Bacteria 2071
271 nmdc:mga0rr50_304057_c1 3300050513 Bacteria 1334
272 nmdc:mga0sz30_271457_c1 3300050516 Bacteria 755
273 Ga0501084_0031128 3300054114 Bacteria 4463
274 Ga0501084_0069796 3300054114 Bacteria 2942
275 Ga0501082_0027201 3300060353 Bacteria 4925
276 Ga0501082_0065815 3300060353 Bacteria 3121
277 Ga0530510_0004439 3300061734 Bacteria 9712
278 Ga0501040_0346283
279 JGI24034J26672_10068459
280 JGI26145J50221_1026802
281 Ga0065715_10036036
282 Ga0070658_10295130
283 Ga0070658_10381918
284 Ga0070676_10082752
285 Ga0070676_10269787
286 Ga0070683_100003358
287 Ga0070683_100735890
288 Ga0070683_101382751
289 Ga0070670_100116617
290 Ga0070670_100639961
291 Ga0068869_100320198
292 Ga0068869_100557573
293 Ga0068868_100142687
294 Ga0070691_10402002
295 Ga0070687_100218269
296 Ga0070661_100509759
297 Ga0070668_100105961
298 Ga0070669_100335498
299 Ga0070669_100577856
300 Ga0070675_100003765
301 Ga0070675_100075350
302 Ga0070675_100346095
303 Ga0070674_100201974
304 Ga0070674_100411859
305 Ga0070673_101004609
306 Ga0070688_100463241
307 Ga0070667_100106180
308 Ga0070667_100150958
309 Ga0070667_100196702
310 Ga0070667_100321611
311 Ga0070701_10012355
312 Ga0070705_100246741
313 Ga0070700_100097183
314 Ga0070694_100010373
315 Ga0070663_100653158
316 Ga0070678_100001667
317 Ga0070678_100093065
318 Ga0070678_101291727
319 Ga0070662_100155897
320 Ga0068867_100267367
321 Ga0068867_100391074
322 Ga0070707_100561760
323 Ga0070679_100649418
324 Ga0070684_102189257
325 Ga0070672_100427767
326 Ga0070686_100045738
327 Ga0070695_100079895
328 Ga0070693_100572988
329 Ga0070665_100086087
330 Ga0070665_100110295
331 Ga0070704_100108834
332 Ga0070704_100493371
333 Ga0070664_100004893
334 Ga0070664_100026183
335 Ga0070664_100039893
336 Ga0068857_100369511
337 Ga0068852_100111325
338 Ga0068859_101381961
339 Ga0068864_100288118
340 Ga0068864_101987169
341 Ga0068866_10040175
342 Ga0068861_100381481
343 Ga0068851_10005335
344 Ga0068863_100067668
345 Ga0068863_100646677
346 Ga0068860_100184001
347 Ga0068860_100188300
348 Ga0068862_100061523
349 Ga0075362_10268471
350 Ga0075366_10000193
351 Ga0068871_100001574
352 Ga0068865_100081778
353 Ga0097620_101381973
354 Ga0075435_100459551
355 Ga0105240_10093577
356 Ga0111539_10229996
357 Ga0105242_10462639
358 Ga0105242_10674645
359 Ga0105248_11178936
360 Ga0105249_10556618
361 Ga0105239_12650803
362 Ga0157318_1004040
363 Ga0157327_1000658
364 Ga0157373_10288532
365 Ga0157370_10070211
366 Ga0157374_10004186
367 Ga0157374_10249456
368 Ga0157374_10659726
369 Ga0163162_10320301
370 Ga0163162_11296115
371 Ga0163162_11606110
372 Ga0157372_10720446
373 Ga0157372_10818459
374 Ga0157372_11195661
375 Ga0157375_10127714
376 Ga0157375_10449037
377 Ga0157375_10782861
378 Ga0157375_12883807
379 Ga0163163_10312940
380 Ga0163163_10403381
381 Ga0163163_10575149
382 Ga0157379_10373995
383 Ga0157376_10066513
384 Ga0163161_10123595
385 Ga0207673_1005523
386 Ga0207697_10006701
387 Ga0207697_10012374
388 Ga0207697_10047751
389 Ga0207642_10093845
390 Ga0207688_10005480
391 Ga0207645_10006661
392 Ga0207645_10978942
393 Ga0207705_10115953
394 Ga0207695_10220323
395 Ga0207671_10369718
396 Ga0207660_10697226
397 Ga0207662_10018779
398 Ga0207649_11098251
399 Ga0207681_10322192
400 Ga0207650_10004906
401 Ga0207650_10086907
402 Ga0207659_10039362
403 Ga0207690_10135070
404 Ga0207706_10041269
405 Ga0207686_10046861
406 Ga0207686_10423175
407 Ga0207709_10030730
408 Ga0207670_10230796
409 Ga0207670_10746344
410 Ga0207669_10190052
411 Ga0207669_10218500
412 Ga0207704_10517723
413 Ga0207689_10218789
414 Ga0207689_10616299
415 Ga0207661_11774632
416 Ga0207679_10010400
417 Ga0207679_10092884
418 Ga0207679_10115313
419 Ga0207667_10221978
420 Ga0207651_10762205
421 Ga0207668_10150037
422 Ga0207658_10132864
423 Ga0207658_10281241
424 Ga0207658_10285676
425 Ga0207677_10265567
426 Ga0207677_10845400
427 Ga0207703_11382027
428 Ga0207639_10165925
429 Ga0207708_10005611
430 Ga0207641_10131698
431 Ga0207641_10232239
432 Ga0207648_10044162
433 Ga0207648_10248649
434 Ga0207676_10706438
435 Ga0207674_10308162
436 Ga0207675_100071527
437 Ga0207683_10057895
438 Ga0207683_10380974
439 Ga0207698_10159893
440 Ga0207698_10616343
441 Ga0207698_10889709
442 Ga0209971_1005384
443 Ga0209998_10049611
444 Ga0209974_10047613
445 Ga0207428_10357690
446 Ga0268266_10133826
447 Ga0268266_10171313
448 Ga0268266_10368166
449 Ga0268265_10118512
450 Ga0268264_10159594
451 Ga0268264_10192019
452 Ga0268264_10330583
453 Ga0265338_10344639
454 Ga0265332_10058152
455 Ga0265328_10000038
456 Ga0265328_10020415
457 Ga0265328_10042167
458 Ga0265325_10088117
459 Ga0265331_10003526
460 Ga0265327_10000438
461 Ga0265327_10001651
462 Ga0265327_10005094
463 Ga0265327_10038790
464 Ga0265327_10051053
465 Ga0265327_10068822
466 Ga0265316_10025169
467 Ga0265316_10152028
468 Ga0307408_100004310
469 Ga0265314_10004570
470 Ga0265342_10007593
471 Ga0307405_10001375
472 Ga0307413_10013300
473 Ga0307410_10008880
474 Ga0307406_10025843
475 Ga0307407_10057090
476 Ga0307412_10030015
477 Ga0307412_11438758
478 Ga0307409_100012433
479 Ga0307416_100010652
480 Ga0307416_100265606
481 Ga0307414_10056839
482 Ga0307411_10000280
483 Ga0307415_100030087
484 Ga0373939_0323437
485 Ga0395898_0034042
486 Ga0395905_0000028
487 Ga0395905_0346125
488 Ga0395905_0432422
489 Ga0395901_0131673
490 Ga0451853_2086233
491 Ga0451577_0344274
492 Ga0451577_1221424
493 Ga0466963_0037905
494 Ga0466963_0506220
495 Ga0453684_0256593
496 Ga0451576_0503130
497 Ga0451576_0912346
498 Ga0466967_0060125
499 Ga0495621_0148728
500 Ga0495658_0095646
501 Ga0496111_0014777
502 Ga0501300_073858
503 Ga0501034_0025290
504 Ga0501036_0167510
505 Ga0501037_0675800
506 Ga0501037_1079000
507 Ga0501038_0082327
508 Ga0501038_0301224
509 Ga0501039_0034334
510 Ga0501039_0105229
511 Ga0501041_0025060
512 Ga0501042_0085825
513 Ga0501047_0037580
514 Ga0501048_0013248
515 Ga0501068_0006943
516 Ga0501068_0136806
517 Ga0501069_0000613
518 Ga0501069_0020484
519 Ga0501070_0077017
520 Ga0501070_0092253
521 Ga0501071_0274980
522 Ga0501071_0859236
523 Ga0501072_0013687
524 Ga0501073_0050776
525 Ga0501073_0192303
526 Ga0501074_0003291
527 Ga0501074_0010752
528 Ga0501074_0223819
529 Ga0501075_0004447
530 Ga0501076_0014163
531 Ga0501076_0085295
532 Ga0501077_0027820
533 Ga0501079_0000832
534 Ga0501079_0012357
535 Ga0501080_0046846
536 Ga0501080_0123339
537 Ga0501080_0530708
538 Ga0501081_1420697
539 Ga0501083_0013722
540 Ga0501083_0204888
541 Ga0501035_0024242
542 Ga0501035_0754688
543 Ga0501044_0273031
544 Ga0501045_0006158
545 nmdc:mga0k408_730_c1
546 nmdc:mga05p37_80753_c1
547 nmdc:mga08y16_199894_c1
548 nmdc:mga0rr50_304057_c1
549 nmdc:mga0sz30_271457_c1
550 Ga0501084_0031128
551 Ga0501084_0069796
552 Ga0501082_0027201
553 Ga0501082_0065815
554 Ga0530510_0004439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

25

154

0.98

PF08534

Redoxin

Redoxin

24

172

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9712 5 151
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9286 1 150
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9283 1 153
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9271 1 150
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.927 1 150
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9357 1 148 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9287 1 150 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9263 3 150 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9236 1 148 3.40.30.10
af_Q5A7P9_48_194_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9179 4 150 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2D8HQ72-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9838 13 103 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A2A7UZ05-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9818 4 151 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A836TC61-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9804 4 134 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A4Q7VPN2-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9798 4 151 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1D9H133-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9788 4 151 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map