F381649

General Info

Members Datasets Scaffolds Average Seq Length
277 185 552 309

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100146338|Ga0070699_1001463382
Length 342
Sequence MKSDYPDLSKEVLCRLFGKTRHALYDHLWRQQDDTVKEEIILQLVHKIRERLPRLGTRKLLFLLDPELRSHQIDIGRDALFELLAVHKLLIRQRKRKMVTTNSRHWMRKYANLIKNVEISKPEQVWVSDITYIRMHNQWGYLSMITDAFSRKIMGFSFRNDLLAQGCVDALQMALSNRQYKAEKLIHHSDRGSQYCCKEYIDLLGSAGVSVSMTENGDPYENALAERMNGIIKNEFNLYSSVLGFDDTYQLIIRSVDAYNSERPHGSCDYLTPVKAHNQTGTLKKRWKKYETTKYNNANFTKKGPGGGSLKSKTPGPSPKKKHDDQKNTDLSPRYSAQQNLR

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
119 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
120 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
165 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
166 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
167 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
170 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
171 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
176 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
177 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
182 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
183 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
184 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
185 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.39
Nodule 0.36
Rhizoplane 1.81
Rhizosphere 83.03
Stem 0
Stem Tuber 0
Unclassified 13.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100146338 3300005518 Bacteria 2088
2 rootH2_10032574 3300003320 Bacteria 1591
3 rootL2_10055063 3300003322 Unclassified 2114
4 rootH1_10086053 3300003323 Bacteria 3624
5 rootH1_10161476 3300003323 Bacteria 1769
6 rootH1_10169207 3300003323 Bacteria 1395
7 JGI26145J50221_1001952 3300003371 Unclassified 1619
8 Ga0055528_1026359 3300003790 Bacteria 1671
9 Ga0055530_10025453 3300003791 Bacteria 1653
10 Ga0055540_1017012 3300003792 Bacteria 2044
11 Ga0055540_1017081 3300003792 Bacteria 2037
12 Ga0055540_1018113 3300003792 Bacteria 1940
13 Ga0055543_1008337 3300004625 Unclassified 2301
14 Ga0065165_1034015 3300005262 Bacteria 1580
15 Ga0065714_10012895 3300005288 Bacteria 2199
16 Ga0065714_10070019 3300005288 Bacteria 3997
17 Ga0065704_10008882 3300005289 Bacteria 2233
18 Ga0065715_10056951 3300005293 Bacteria 1554
19 Ga0070658_10148130 3300005327 Bacteria 1964
20 Ga0070658_10210290 3300005327 Bacteria 1643
21 Ga0068869_100121438 3300005334 Bacteria 1998
22 Ga0070680_100112899 3300005336 Unclassified 2263
23 Ga0070680_100155313 3300005336 Bacteria 1922
24 Ga0070680_100340975 3300005336 Bacteria 1273
25 Ga0070682_100124900 3300005337 Unclassified 1733
26 Ga0070682_100307021 3300005337 Bacteria 1166
27 Ga0068868_100107050 3300005338 Bacteria 2269
28 Ga0070660_100320434 3300005339 Bacteria 1273
29 Ga0070691_10024521 3300005341 Bacteria 2803
30 Ga0070661_100117012 3300005344 Bacteria 1994
31 Ga0070661_100192184 3300005344 Bacteria 1557
32 Ga0070668_100127864 3300005347 Bacteria 2036
33 Ga0070681_10091962 3300005458 Unclassified 2983
34 Ga0070681_10143503 3300005458 Bacteria 2317
35 Ga0070681_10174180 3300005458 Bacteria 2073
36 Ga0070698_100259164 3300005471 Bacteria 1671
37 Ga0070699_100169442 3300005518 Bacteria 1934
38 Ga0070679_100066032 3300005530 Bacteria 3606
39 Ga0070679_100154928 3300005530 Bacteria 2266
40 Ga0070684_100214202 3300005535 Bacteria 1756
41 Ga0068853_100141814 3300005539 Bacteria 2157
42 Ga0068853_100180065 3300005539 Bacteria 1916
43 Ga0070693_100001588 3300005547 Bacteria 10236
44 Ga0070665_100208649 3300005548 Bacteria 1954
45 Ga0068855_100234545 3300005563 Bacteria 2052
46 Ga0068855_100268264 3300005563 Bacteria 1899
47 Ga0068855_100593306 3300005563 Bacteria 1195
48 Ga0068857_100053700 3300005577 Bacteria 3574
49 Ga0068857_100160570 3300005577 Bacteria 2039
50 Ga0068854_100145409 3300005578 Bacteria 1823
51 Ga0068854_100173506 3300005578 Bacteria 1679
52 Ga0068856_100155310 3300005614 Bacteria 2298
53 Ga0068856_100346954 3300005614 Bacteria 1503
54 Ga0068852_100149135 3300005616 Bacteria 2173
55 Ga0068852_100390747 3300005616 Bacteria 1366
56 Ga0068861_100151032 3300005719 Bacteria 1906
57 Ga0068851_10020865 3300005834 Unclassified 3176
58 Ga0068863_100251361 3300005841 Unclassified 1708
59 Ga0068862_100137073 3300005844 Bacteria 2170
60 Ga0068862_100194950 3300005844 Bacteria 1824
61 Ga0070717_10208200 3300006028 Bacteria 1715
62 Ga0075366_10019963 3300006195 Bacteria 3884
63 Ga0075366_10037469 3300006195 Unclassified 2863
64 Ga0097621_100171707 3300006237 Bacteria 1869
65 Ga0075370_10072876 3300006353 Bacteria 1966
66 Ga0079104_1012821 3300006946 Bacteria 2611
67 Ga0105240_10144923 3300009093 Bacteria 2835
68 Ga0105240_10356734 3300009093 Bacteria 1657
69 Ga0105241_10123672 3300009174 Bacteria 2086
70 Ga0105241_10345037 3300009174 Bacteria 1291
71 Ga0105242_10309212 3300009176 Bacteria 1445
72 Ga0105237_10174034 3300009545 Bacteria 2153
73 Ga0105238_10149668 3300009551 Bacteria 2310
74 Ga0105238_10166844 3300009551 Bacteria 2178
75 Ga0105249_10169393 3300009553 Bacteria 2117
76 Ga0105239_10186509 3300010375 Bacteria 2321
77 Ga0105239_10230691 3300010375 Bacteria 2077
78 Ga0105239_10277992 3300010375 Bacteria 1884
79 Ga0105239_10278396 3300010375 Bacteria 1883
80 Ga0157373_10062784 3300013100 Bacteria 2631
81 Ga0157373_10099137 3300013100 Bacteria 2050
82 Ga0157371_10066355 3300013102 Bacteria 2555
83 Ga0157371_10081806 3300013102 Bacteria 2286
84 Ga0157371_10113500 3300013102 Bacteria 1924
85 Ga0157371_10118214 3300013102 Bacteria 1885
86 Ga0157370_10172804 3300013104 Bacteria 2008
87 Ga0157370_10177007 3300013104 Bacteria 1982
88 Ga0157370_10212844 3300013104 Bacteria 1791
89 Ga0157369_10228379 3300013105 Bacteria 1946
90 Ga0157369_10238592 3300013105 Bacteria 1899
91 Ga0157369_10663096 3300013105 Bacteria 1075
92 Ga0157374_10132133 3300013296 Unclassified 2416
93 Ga0157374_10227434 3300013296 Bacteria 1832
94 Ga0163162_10337067 3300013306 Bacteria 1640
95 Ga0163162_10406398 3300013306 Bacteria 1494
96 Ga0157372_10098142 3300013307 Bacteria 3342
97 Ga0157372_10188116 3300013307 Bacteria 2391
98 Ga0157375_10217658 3300013308 Bacteria 2068
99 Ga0157375_10368728 3300013308 Bacteria 1602
100 Ga0182008_10019894 3300014497 Bacteria 3460
101 Ga0182008_10032797 3300014497 Bacteria 2607
102 Ga0182008_10061242 3300014497 Bacteria 1855
103 Ga0182008_10097009 3300014497 Bacteria 1455
104 Ga0157379_10175341 3300014968 Bacteria 1936
105 Ga0157379_10211485 3300014968 Bacteria 1756
106 Ga0157376_10094585 3300014969 Bacteria 2597
107 Ga0157376_10215050 3300014969 Unclassified 1777
108 Ga0182006_1063590 3300015261 Bacteria 1386
109 Ga0182007_10010443 3300015262 Bacteria 3665
110 Ga0182007_10060354 3300015262 Bacteria 1243
111 Ga0182007_10067441 3300015262 Unclassified 1172
112 Ga0182005_1040686 3300015265 Bacteria 1264
113 Ga0163161_10026925 3300017792 Bacteria 4076
114 Ga0163161_10039112 3300017792 Bacteria 3404
115 Ga0209026_1010145 3300025250 Bacteria 1780
116 Ga0209148_1004946 3300025254 Bacteria 3147
117 Ga0209565_1009642 3300025263 Unclassified 2434
118 Ga0209673_1031020 3300025273 Bacteria 1671
119 Ga0209675_1012703 3300025291 Unclassified 2691
120 Ga0209564_1030446 3300025295 Bacteria 1671
121 Ga0209050_1031458 3300025298 Bacteria 1653
122 Ga0209256_1034517 3300025299 Bacteria 1345
123 Ga0207426_1035868 3300025302 Bacteria 1580
124 Ga0209051_1009121 3300025303 Bacteria 5149
125 Ga0209257_1028539 3300025304 Bacteria 1834
126 Ga0207656_10057736 3300025321 Bacteria 1693
127 Ga0207647_10058984 3300025904 Unclassified 2349
128 Ga0207705_10169511 3300025909 Bacteria 1643
129 Ga0207705_10177239 3300025909 Bacteria 1607
130 Ga0207654_10000798 3300025911 Bacteria 17342
131 Ga0207654_10036532 3300025911 Bacteria 2745
132 Ga0207654_10101078 3300025911 Bacteria 1777
133 Ga0207707_10118221 3300025912 Bacteria 2317
134 Ga0207707_10197909 3300025912 Bacteria 1752
135 Ga0207707_10208697 3300025912 Unclassified 1702
136 Ga0207695_10023770 3300025913 Bacteria 6916
137 Ga0207695_10278157 3300025913 Bacteria 1568
138 Ga0207671_10066972 3300025914 Bacteria 2674
139 Ga0207671_10071183 3300025914 Bacteria 2594
140 Ga0207660_10000111 3300025917 Bacteria 46780
141 Ga0207660_10112196 3300025917 Bacteria 2053
142 Ga0207660_10118036 3300025917 Bacteria 2006
143 Ga0207657_10059053 3300025919 Bacteria 3298
144 Ga0207649_10094787 3300025920 Bacteria 1962
145 Ga0207649_10138223 3300025920 Bacteria 1663
146 Ga0207652_10089971 3300025921 Bacteria 2696
147 Ga0207652_10122508 3300025921 Bacteria 2314
148 Ga0207652_10126911 3300025921 Bacteria 2273
149 Ga0207694_10161627 3300025924 Bacteria 1809
150 Ga0207690_10106933 3300025932 Bacteria 2008
151 Ga0207686_10121500 3300025934 Bacteria 1779
152 Ga0207689_10006265 3300025942 Bacteria 10543
153 Ga0207689_10254307 3300025942 Bacteria 1453
154 Ga0207661_10222815 3300025944 Bacteria 1667
155 Ga0207667_10074598 3300025949 Bacteria 3523
156 Ga0207667_10094098 3300025949 Unclassified 3094
157 Ga0207667_10249177 3300025949 Bacteria 1817
158 Ga0207667_10279148 3300025949 Bacteria 1707
159 Ga0207712_10103784 3300025961 Unclassified 2119
160 Ga0207668_10168647 3300025972 Bacteria 1714
161 Ga0207640_10043137 3300025981 Bacteria 2881
162 Ga0207640_10342663 3300025981 Bacteria 1198
163 Ga0207658_10198171 3300025986 Unclassified 1674
164 Ga0207677_10120506 3300026023 Bacteria 1973
165 Ga0207639_10003723 3300026041 Bacteria 10261
166 Ga0207639_10066802 3300026041 Unclassified 2796
167 Ga0207639_10100195 3300026041 Bacteria 2339
168 Ga0207702_10093327 3300026078 Bacteria 2639
169 Ga0207702_10254930 3300026078 Bacteria 1649
170 Ga0207702_10351562 3300026078 Bacteria 1410
171 Ga0207641_10317074 3300026088 Unclassified 1477
172 Ga0207674_10104756 3300026116 Bacteria 2807
173 Ga0207674_10127173 3300026116 Bacteria 2514
174 Ga0207675_100139707 3300026118 Bacteria 2300
175 Ga0209969_1003024 3300027360 Bacteria 2327
176 Ga0209984_1003244 3300027424 Unclassified 1854
177 Ga0209995_1004153 3300027471 Unclassified 2312
178 Ga0209968_1003641 3300027526 Unclassified 2311
179 Ga0209968_1004318 3300027526 Bacteria 2133
180 Ga0209999_1002955 3300027543 Bacteria 3015
181 Ga0209999_1017669 3300027543 Bacteria 1301
182 Ga0210002_1005439 3300027617 Unclassified 1911
183 Ga0209983_1007865 3300027665 Unclassified 2182
184 Ga0209971_1018180 3300027682 Unclassified 1667
185 Ga0209966_1004409 3300027695 Bacteria 2384
186 Ga0209998_10022966 3300027717 Unclassified 1347
187 Ga0209974_10008467 3300027876 Bacteria 3517
188 Ga0209974_10014887 3300027876 Unclassified 2583
189 Ga0268265_10108714 3300028380 Bacteria 2258
190 Ga0268265_10175854 3300028380 Bacteria 1834
191 Ga0268264_10000052 3300028381 Bacteria 321218
192 Ga0265338_10193147 3300028800 Bacteria 1541
193 Ga0307512_10108317 3300030522 Bacteria 1844
194 Ga0316177_1220734 3300030731 Bacteria 2035
195 Ga0316181_1218858 3300030744 Bacteria 1573
196 Ga0316182_1153027 3300030745 Bacteria 2000
197 Ga0316182_1170505 3300030745 Bacteria 3603
198 Ga0265332_10039239 3300031238 Unclassified 2051
199 Ga0265340_10063130 3300031247 Bacteria 1768
200 Ga0265339_10093741 3300031249 Bacteria 1570
201 Ga0265327_10044755 3300031251 Bacteria 2357
202 Ga0265327_10062556 3300031251 Bacteria 1893
203 Ga0307513_10197357 3300031456 Unclassified 1857
204 Ga0307513_10235902 3300031456 Bacteria 1638
205 Ga0307513_10323315 3300031456 Bacteria 1300
206 Ga0265314_10104061 3300031711 Bacteria 1818
207 Ga0307516_10147465 3300031730 Bacteria 2117
208 Ga0307412_10131359 3300031911 Bacteria 1819
209 Ga0307412_10138759 3300031911 Bacteria 1777
210 Ga0307414_10047291 3300032004 Bacteria 2960
211 Ga0307414_10134823 3300032004 Bacteria 1923
212 Ga0307414_10300098 3300032004 Bacteria 1358
213 Ga0307414_10425028 3300032004 Bacteria 1159
214 Ga0307411_10172066 3300032005 Bacteria 1634
215 Ga0307510_10085629 3300033180 Bacteria 3027
216 Ga0307510_10164970 3300033180 Bacteria 1805
217 Ga0373935_0043898 3300035692 Bacteria 2815
218 Ga0373935_0101827 3300035692 Unclassified 1894
219 Ga0373937_0362599 3300036401 Bacteria 1373
220 Ga0395900_0211666 3300037418 Bacteria 1957
221 Ga0436361_0894524 3300039447 Bacteria 1482
222 Ga0451787_421427 3300041441 Bacteria 780
223 Ga0451802_1654914 3300041460 Bacteria 1165
224 Ga0451807_0311402 3300041486 Bacteria 2137
225 Ga0451853_1471999 3300041512 Bacteria 1861
226 Ga0495629_0152295 3300046459 Bacteria 1607
227 Ga0495650_0032594 3300046471 Bacteria 2328
228 Ga0495607_0038533 3300046501 Bacteria 2862
229 Ga0495606_0085576 3300046507 Bacteria 1950
230 Ga0495610_0041392 3300046512 Bacteria 2313
231 Ga0495610_0097081 3300046512 Bacteria 1326
232 Ga0495631_0039916 3300046518 Bacteria 2080
233 Ga0495642_0026626 3300046528 Bacteria 2297
234 Ga0495642_0120644 3300046528 Unclassified 1125
235 Ga0495654_0094918 3300046530 Bacteria 1379
236 Ga0495621_0076290 3300046539 Unclassified 1243
237 Ga0495645_0092907 3300046543 Bacteria 2154
238 Ga0495633_0095949 3300046558 Unclassified 1377
239 Ga0495668_0012573 3300046616 Bacteria 5019
240 Ga0495668_0162752 3300046616 Bacteria 1222
241 Ga0495670_0008379 3300046691 Bacteria 5084
242 Ga0495670_0140878 3300046691 Unclassified 1261
243 Ga0495671_0056096 3300046692 Bacteria 1950
244 Ga0495589_0126521 3300046794 Bacteria 1229
245 Ga0495683_0052275 3300047323 Bacteria 2040
246 Ga0495687_024467 3300047443 Bacteria 2869
247 Ga0495687_049204 3300047443 Bacteria 1802
248 Ga0495686_0042471 3300047472 Bacteria 2891
249 Ga0496110_0258200 3300048913 Bacteria 1586
250 Ga0496115_0110565 3300048918 Bacteria 2257
251 Ga0496126_0158231 3300048929 Bacteria 1937
252 Ga0501298_016640 3300049521 Bacteria 1334
253 Ga0501073_0125707 3300049589 Unclassified 1777
254 Ga0501201_003250 3300049651 Bacteria 1489
255 Ga0501209_022119 3300049656 Bacteria 1521
256 Ga0501224_014012 3300049664 Bacteria 1185
257 Ga0501233_012801 3300049668 Bacteria 1690
258 Ga0501235_007236 3300049669 Bacteria 2421
259 Ga0501243_006972 3300049675 Bacteria 1722
260 Ga0501249_012956 3300049679 Bacteria 1768
261 Ga0501257_016487 3300049686 Bacteria 1714
262 Ga0501225_0023829 3300049705 Bacteria 1686
263 Ga0501234_005471 3300049707 Bacteria 1987
264 Ga0501080_0219310 3300049742 Unclassified 1741
265 Ga0501241_005541 3300049758 Bacteria 2351
266 Ga0501270_008577 3300049767 Bacteria 1297
267 Ga0501280_004551 3300049776 Bacteria 2028
268 Ga0501044_0428747 3300049823 Bacteria 1232
269 nmdc:mga0k408_28809_c1 3300050493 Bacteria 3158
270 nmdc:mga0k408_55811_c1 3300050493 Bacteria 2291
271 nmdc:mga07m45_82170_c1 3300050496 Bacteria 1840
272 Ga0500608_056200 3300053122 Bacteria 1886
273 Ga0500627_0071027 3300053158 Bacteria 1542
274 Ga0500645_022000 3300053730 Bacteria 1964
275 2852632338 2852627209 Bacteria 5896285
276 2904424329 2904419702 Bacteria 5166287
277 Ga0070699_100146338
278 rootH2_10032574
279 rootL2_10055063
280 rootH1_10086053
281 rootH1_10161476
282 rootH1_10169207
283 JGI26145J50221_1001952
284 Ga0055528_1026359
285 Ga0055530_10025453
286 Ga0055540_1017012
287 Ga0055540_1017081
288 Ga0055540_1018113
289 Ga0055543_1008337
290 Ga0065165_1034015
291 Ga0065714_10012895
292 Ga0065714_10070019
293 Ga0065704_10008882
294 Ga0065715_10056951
295 Ga0070658_10148130
296 Ga0070658_10210290
297 Ga0068869_100121438
298 Ga0070680_100112899
299 Ga0070680_100155313
300 Ga0070680_100340975
301 Ga0070682_100124900
302 Ga0070682_100307021
303 Ga0068868_100107050
304 Ga0070660_100320434
305 Ga0070691_10024521
306 Ga0070661_100117012
307 Ga0070661_100192184
308 Ga0070668_100127864
309 Ga0070681_10091962
310 Ga0070681_10143503
311 Ga0070681_10174180
312 Ga0070698_100259164
313 Ga0070699_100169442
314 Ga0070679_100066032
315 Ga0070679_100154928
316 Ga0070684_100214202
317 Ga0068853_100141814
318 Ga0068853_100180065
319 Ga0070693_100001588
320 Ga0070665_100208649
321 Ga0068855_100234545
322 Ga0068855_100268264
323 Ga0068855_100593306
324 Ga0068857_100053700
325 Ga0068857_100160570
326 Ga0068854_100145409
327 Ga0068854_100173506
328 Ga0068856_100155310
329 Ga0068856_100346954
330 Ga0068852_100149135
331 Ga0068852_100390747
332 Ga0068861_100151032
333 Ga0068851_10020865
334 Ga0068863_100251361
335 Ga0068862_100137073
336 Ga0068862_100194950
337 Ga0070717_10208200
338 Ga0075366_10019963
339 Ga0075366_10037469
340 Ga0097621_100171707
341 Ga0075370_10072876
342 Ga0079104_1012821
343 Ga0105240_10144923
344 Ga0105240_10356734
345 Ga0105241_10123672
346 Ga0105241_10345037
347 Ga0105242_10309212
348 Ga0105237_10174034
349 Ga0105238_10149668
350 Ga0105238_10166844
351 Ga0105249_10169393
352 Ga0105239_10186509
353 Ga0105239_10230691
354 Ga0105239_10277992
355 Ga0105239_10278396
356 Ga0157373_10062784
357 Ga0157373_10099137
358 Ga0157371_10066355
359 Ga0157371_10081806
360 Ga0157371_10113500
361 Ga0157371_10118214
362 Ga0157370_10172804
363 Ga0157370_10177007
364 Ga0157370_10212844
365 Ga0157369_10228379
366 Ga0157369_10238592
367 Ga0157369_10663096
368 Ga0157374_10132133
369 Ga0157374_10227434
370 Ga0163162_10337067
371 Ga0163162_10406398
372 Ga0157372_10098142
373 Ga0157372_10188116
374 Ga0157375_10217658
375 Ga0157375_10368728
376 Ga0182008_10019894
377 Ga0182008_10032797
378 Ga0182008_10061242
379 Ga0182008_10097009
380 Ga0157379_10175341
381 Ga0157379_10211485
382 Ga0157376_10094585
383 Ga0157376_10215050
384 Ga0182006_1063590
385 Ga0182007_10010443
386 Ga0182007_10060354
387 Ga0182007_10067441
388 Ga0182005_1040686
389 Ga0163161_10026925
390 Ga0163161_10039112
391 Ga0209026_1010145
392 Ga0209148_1004946
393 Ga0209565_1009642
394 Ga0209673_1031020
395 Ga0209675_1012703
396 Ga0209564_1030446
397 Ga0209050_1031458
398 Ga0209256_1034517
399 Ga0207426_1035868
400 Ga0209051_1009121
401 Ga0209257_1028539
402 Ga0207656_10057736
403 Ga0207647_10058984
404 Ga0207705_10169511
405 Ga0207705_10177239
406 Ga0207654_10000798
407 Ga0207654_10036532
408 Ga0207654_10101078
409 Ga0207707_10118221
410 Ga0207707_10197909
411 Ga0207707_10208697
412 Ga0207695_10023770
413 Ga0207695_10278157
414 Ga0207671_10066972
415 Ga0207671_10071183
416 Ga0207660_10000111
417 Ga0207660_10112196
418 Ga0207660_10118036
419 Ga0207657_10059053
420 Ga0207649_10094787
421 Ga0207649_10138223
422 Ga0207652_10089971
423 Ga0207652_10122508
424 Ga0207652_10126911
425 Ga0207694_10161627
426 Ga0207690_10106933
427 Ga0207686_10121500
428 Ga0207689_10006265
429 Ga0207689_10254307
430 Ga0207661_10222815
431 Ga0207667_10074598
432 Ga0207667_10094098
433 Ga0207667_10249177
434 Ga0207667_10279148
435 Ga0207712_10103784
436 Ga0207668_10168647
437 Ga0207640_10043137
438 Ga0207640_10342663
439 Ga0207658_10198171
440 Ga0207677_10120506
441 Ga0207639_10003723
442 Ga0207639_10066802
443 Ga0207639_10100195
444 Ga0207702_10093327
445 Ga0207702_10254930
446 Ga0207702_10351562
447 Ga0207641_10317074
448 Ga0207674_10104756
449 Ga0207674_10127173
450 Ga0207675_100139707
451 Ga0209969_1003024
452 Ga0209984_1003244
453 Ga0209995_1004153
454 Ga0209968_1003641
455 Ga0209968_1004318
456 Ga0209999_1002955
457 Ga0209999_1017669
458 Ga0210002_1005439
459 Ga0209983_1007865
460 Ga0209971_1018180
461 Ga0209966_1004409
462 Ga0209998_10022966
463 Ga0209974_10008467
464 Ga0209974_10014887
465 Ga0268265_10108714
466 Ga0268265_10175854
467 Ga0268264_10000052
468 Ga0265338_10193147
469 Ga0307512_10108317
470 Ga0316177_1220734
471 Ga0316181_1218858
472 Ga0316182_1153027
473 Ga0316182_1170505
474 Ga0265332_10039239
475 Ga0265340_10063130
476 Ga0265339_10093741
477 Ga0265327_10044755
478 Ga0265327_10062556
479 Ga0307513_10197357
480 Ga0307513_10235902
481 Ga0307513_10323315
482 Ga0265314_10104061
483 Ga0307516_10147465
484 Ga0307412_10131359
485 Ga0307412_10138759
486 Ga0307414_10047291
487 Ga0307414_10134823
488 Ga0307414_10300098
489 Ga0307414_10425028
490 Ga0307411_10172066
491 Ga0307510_10085629
492 Ga0307510_10164970
493 Ga0373935_0043898
494 Ga0373935_0101827
495 Ga0373937_0362599
496 Ga0395900_0211666
497 Ga0436361_0894524
498 Ga0451787_421427
499 Ga0451802_1654914
500 Ga0451807_0311402
501 Ga0451853_1471999
502 Ga0495629_0152295
503 Ga0495650_0032594
504 Ga0495607_0038533
505 Ga0495606_0085576
506 Ga0495610_0041392
507 Ga0495610_0097081
508 Ga0495631_0039916
509 Ga0495642_0026626
510 Ga0495642_0120644
511 Ga0495654_0094918
512 Ga0495621_0076290
513 Ga0495645_0092907
514 Ga0495633_0095949
515 Ga0495668_0012573
516 Ga0495668_0162752
517 Ga0495670_0008379
518 Ga0495670_0140878
519 Ga0495671_0056096
520 Ga0495589_0126521
521 Ga0495683_0052275
522 Ga0495687_024467
523 Ga0495687_049204
524 Ga0495686_0042471
525 Ga0496110_0258200
526 Ga0496115_0110565
527 Ga0496126_0158231
528 Ga0501298_016640
529 Ga0501073_0125707
530 Ga0501201_003250
531 Ga0501209_022119
532 Ga0501224_014012
533 Ga0501233_012801
534 Ga0501235_007236
535 Ga0501243_006972
536 Ga0501249_012956
537 Ga0501257_016487
538 Ga0501225_0023829
539 Ga0501234_005471
540 Ga0501080_0219310
541 Ga0501241_005541
542 Ga0501270_008577
543 Ga0501280_004551
544 Ga0501044_0428747
545 nmdc:mga0k408_28809_c1
546 nmdc:mga0k408_55811_c1
547 nmdc:mga07m45_82170_c1
548 Ga0500608_056200
549 Ga0500627_0071027
550 Ga0500645_022000
551 2852632338
552 2904424329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

207

273

0.97

PF00665

rve

Integrase core domain

119

219

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qbt-assembly1.cif.gz_A structure of the htlv-2 integrase catalytic core domain in complex with magnesium (trimeric form) 0.845 121 277
7ouf-assembly1.cif.gz_D structure of the stlv intasome:b56 complex bound to the strand-transfer inhibitor xz450 0.8393 121 282
5cz2-assembly1.cif.gz_B crystal structure of a two-domain fragment of mmtv integrase 0.8383 121 277
6qbv-assembly2.cif.gz_D structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8361 121 279
6qbv-assembly1.cif.gz_B structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8318 121 277
ID Description Score Start End Superfamily
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9626 119 178 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9331 118 276 3.30.420.10
af_P9WKH9_102_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9278 122 273 3.30.420.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9235 118 280 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.922 118 276 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2V8N903-F1-model_v4 Integrase catalytic domain-containing protein 0.9776 115 178 GO:0003676
GO:0015074
AF-A0A2T5E2R3-F1-model_v4 IS3 family transposase 0.9641 122 277 GO:0003676
GO:0015074
AF-A0A0Q4LNQ0-F1-model_v4 Integrase catalytic domain-containing protein 0.962 115 279 GO:0003676
GO:0015074
AF-A0A2Z3GM65-F1-model_v4 IS3 family transposase 0.96 43 293 GO:0003676
GO:0015074
AF-A0A0A3W760-F1-model_v4 Integrase catalytic domain-containing protein 0.9582 107 279 GO:0003676
GO:0015074

Map