F381638

General Info

Members Datasets Scaffolds Average Seq Length
277 230 258 139

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10735215|Ga0070681_107352152
Length 158
Sequence MLRARARRKDYRLLLARTPAMDVIIYHNPDCGTSRNTLGMIRNAGIEPHVIEYLKTPPSRPLLKQLIARMGISVRDLLREKGTPFRELGLDDPKWSDDELLDAMMAHPILINRPIVVTPNGVRLCRPSEMVLDLLPAQRGVFVKENGERVADPRTSAA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
6 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
7 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
8 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
9 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
10 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
11 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
12 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
13 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
14 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
15 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
16 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
17 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
18 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
19 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
149 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
154 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
160 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
226 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
227 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
228 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
229 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.14
Metatranscriptomes 0
Isolates 6.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13
Nodule 2.17
Rhizoplane 1.81
Rhizosphere 70.04
Stem 0
Stem Tuber 0
Unclassified 13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000731 3300002459 Bacteria 7933
2 JGI25162J39368_1003510 3300002737 Bacteria 4458
3 rootH1_10060564 3300003323 Bacteria 3379
4 rootH1_10338851 3300003323 Bacteria 2401
5 Ga0055526_1040896 3300003771 Bacteria 1162
6 Ga0055524_1008852 3300003775 Bacteria 4145
7 Ga0055528_1002182 3300003790 Bacteria 10717
8 Ga0065707_10084417 3300005295 Bacteria 7223
9 Ga0070676_11460867 3300005328 Bacteria 526
10 Ga0070670_100000005 3300005331 Bacteria 351569
11 Ga0070682_101831130 3300005337 Bacteria 530
12 Ga0070689_100682329 3300005340 Bacteria 896
13 Ga0070675_100206110 3300005354 Bacteria 1708
14 Ga0070675_101105286 3300005354 Bacteria 729
15 Ga0070667_100006995 3300005367 Bacteria 9377
16 Ga0070667_100473762 3300005367 Bacteria 1146
17 Ga0070709_10039210 3300005434 Bacteria 2906
18 Ga0070709_10113573 3300005434 Bacteria 1824
19 Ga0070714_100061780 3300005435 Bacteria 3218
20 Ga0070713_100020773 3300005436 Bacteria 5040
21 Ga0070713_100549039 3300005436 Bacteria 1094
22 Ga0070710_10166208 3300005437 Bacteria 1372
23 Ga0070711_100053755 3300005439 Bacteria 2777
24 Ga0070663_100060839 3300005455 Bacteria 2718
25 Ga0070681_10735215 3300005458 Bacteria 903
26 Ga0070679_100307635 3300005530 Bacteria 1535
27 Ga0070684_100197377 3300005535 Bacteria 1832
28 Ga0070665_100169692 3300005548 Bacteria 2183
29 Ga0068854_101081462 3300005578 Bacteria 714
30 Ga0068859_100000375 3300005617 Bacteria 44582
31 Ga0068864_100000011 3300005618 Bacteria 350056
32 Ga0068864_100352124 3300005618 Bacteria 1390
33 Ga0068861_100003145 3300005719 Bacteria 10912
34 Ga0068863_100068614 3300005841 Bacteria 3354
35 Ga0068858_100262611 3300005842 Bacteria 1641
36 Ga0068860_100229069 3300005843 Bacteria 1806
37 Ga0068860_100384552 3300005843 Bacteria 1386
38 Ga0068862_100000011 3300005844 Bacteria 270105
39 Ga0081455_10032608 3300005937 Bacteria 4692
40 Ga0081540_1074686 3300005983 Bacteria 1552
41 Ga0070717_10548134 3300006028 Bacteria 1047
42 Ga0070712_100014863 3300006175 Bacteria 5003
43 Ga0075369_10191161 3300006186 Bacteria 943
44 Ga0075369_10388700 3300006186 Bacteria 657
45 Ga0097621_100294511 3300006237 Bacteria 1432
46 Ga0075370_10118177 3300006353 Bacteria 1542
47 Ga0068871_100177574 3300006358 Bacteria 1829
48 Ga0097620_100000375 3300006931 Bacteria 44582
49 Ga0105245_11497727 3300009098 Bacteria 726
50 Ga0105243_10241799 3300009148 Bacteria 1607
51 Ga0105243_11464270 3300009148 Bacteria 705
52 Ga0105243_11694911 3300009148 Bacteria 661
53 Ga0105248_10000069 3300009177 Bacteria 120989
54 Ga0105237_11457085 3300009545 Bacteria 691
55 Ga0105238_10568086 3300009551 Bacteria 1140
56 Ga0105249_10112072 3300009553 Bacteria 2580
57 Ga0105239_10293201 3300010375 Bacteria 1832
58 Ga0105239_11074484 3300010375 Bacteria 926
59 Ga0105246_11060499 3300011119 Bacteria 737
60 Ga0157369_10922769 3300013105 Bacteria 895
61 Ga0157378_10674451 3300013297 Bacteria 1051
62 Ga0163162_10851274 3300013306 Bacteria 1027
63 Ga0163162_11374782 3300013306 Bacteria 803
64 Ga0163162_12396765 3300013306 Bacteria 607
65 Ga0157375_10222380 3300013308 Bacteria 2046
66 Ga0163163_10810925 3300014325 Bacteria 999
67 Ga0163163_11209639 3300014325 Bacteria 818
68 Ga0157380_10001128 3300014326 Bacteria 17241
69 Ga0157376_10076079 3300014969 Bacteria 2867
70 Ga0183365_10001 3300015684 Bacteria 2090444
71 Ga0163161_10130447 3300017792 Bacteria 1895
72 Ga0213876_10036876 3300021384 Bacteria 2580
73 Ga0213875_10444352 3300021388 Bacteria 620
74 Ga0209435_100026 3300025206 Bacteria 198295
75 Ga0209437_100072 3300025233 Bacteria 305152
76 Ga0209646_1000084 3300025246 Bacteria 198295
77 Ga0209646_1010994 3300025246 Bacteria 1408
78 Ga0209026_1000080 3300025250 Bacteria 198295
79 Ga0209759_1000061 3300025256 Bacteria 198295
80 Ga0209673_1000024 3300025273 Bacteria 409632
81 Ga0209676_1016149 3300025292 Bacteria 2711
82 Ga0209025_1026862 3300025294 Bacteria 2874
83 Ga0209564_1005766 3300025295 Bacteria 6914
84 Ga0209564_1023200 3300025295 Bacteria 2164
85 Ga0209758_1001808 3300025297 Bacteria 23631
86 Ga0209256_1000814 3300025299 Bacteria 39865
87 Ga0209256_1022068 3300025299 Bacteria 1937
88 Ga0209257_1020327 3300025304 Bacteria 2459
89 Ga0209257_1045126 3300025304 Bacteria 1282
90 Ga0209257_1096808 3300025304 Bacteria 727
91 Ga0207692_10239713 3300025898 Bacteria 1082
92 Ga0207699_10006782 3300025906 Bacteria 5568
93 Ga0207699_10029671 3300025906 Bacteria 3052
94 Ga0207643_10098454 3300025908 Bacteria 1712
95 Ga0207643_10424068 3300025908 Bacteria 843
96 Ga0207693_10030351 3300025915 Bacteria 4269
97 Ga0207693_10061629 3300025915 Bacteria 2938
98 Ga0207663_10099858 3300025916 Bacteria 1946
99 Ga0207663_11265892 3300025916 Bacteria 594
100 Ga0207657_11329711 3300025919 Bacteria 542
101 Ga0207652_10084110 3300025921 Bacteria 2787
102 Ga0207681_10000001 3300025923 Bacteria 1105841
103 Ga0207650_10000018 3300025925 Bacteria 352120
104 Ga0207659_10170225 3300025926 Bacteria 1718
105 Ga0207659_10797293 3300025926 Bacteria 811
106 Ga0207700_10078533 3300025928 Bacteria 2568
107 Ga0207644_10396023 3300025931 Bacteria 1128
108 Ga0207709_10655420 3300025935 Bacteria 836
109 Ga0207669_10204984 3300025937 Bacteria 1435
110 Ga0207711_10001189 3300025941 Bacteria 24690
111 Ga0207661_10002357 3300025944 Bacteria 13009
112 Ga0207668_10640575 3300025972 Bacteria 929
113 Ga0207640_10562530 3300025981 Bacteria 960
114 Ga0207658_10009398 3300025986 Bacteria 6632
115 Ga0207703_10282186 3300026035 Bacteria 1509
116 Ga0207703_10312076 3300026035 Bacteria 1438
117 Ga0207676_10000004 3300026095 Bacteria 725417
118 Ga0207675_100084276 3300026118 Bacteria 2982
119 Ga0207683_10034818 3300026121 Bacteria 4378
120 Ga0268266_10040552 3300028379 Bacteria 3968
121 Ga0268266_10237774 3300028379 Bacteria 1680
122 Ga0268266_10568504 3300028379 Bacteria 1087
123 Ga0268266_10590837 3300028379 Bacteria 1066
124 Ga0268265_10000002 3300028380 Bacteria 1035381
125 Ga0268264_10234354 3300028381 Bacteria 1697
126 Ga0307517_10002153 3300028786 Bacteria 31985
127 Ga0307516_10284803 3300031730 Bacteria 1333
128 Ga0307516_10496983 3300031730 Bacteria 874
129 Ga0307413_10522006 3300031824 Bacteria 958
130 Ga0307406_10700812 3300031901 Bacteria 845
131 Ga0307409_100029377 3300031995 Bacteria 3933
132 Ga0307415_101212711 3300032126 Bacteria 711
133 Ga0373926_0024367 3300035083 Bacteria 2107
134 Ga0373934_0009902 3300035086 Bacteria 3579
135 Ga0373949_0070924 3300035090 Bacteria 913
136 Ga0373936_0016160 3300035113 Bacteria 2869
137 Ga0373954_0006983 3300035118 Bacteria 4931
138 Ga0373956_0266258 3300035119 Bacteria 815
139 Ga0373943_0124528 3300035170 Bacteria 1373
140 Ga0373946_0005588 3300035171 Bacteria 4538
141 Ga0373955_0090574 3300035172 Bacteria 1742
142 Ga0373924_0034968 3300035410 Bacteria 2036
143 Ga0373935_0062399 3300035692 Bacteria 2387
144 Ga0373927_0066336 3300035695 Bacteria 2334
145 Ga0373933_0083128 3300035724 Bacteria 1966
146 Ga0373947_0025025 3300035725 Bacteria 3480
147 Ga0373937_0143963 3300036401 Bacteria 2230
148 Ga0373925_0178283 3300037068 Bacteria 1680
149 Ga0395900_0159000 3300037418 Bacteria 2306
150 Ga0395898_0674016 3300037466 Bacteria 976
151 Ga0395905_0026032 3300037471 Bacteria 5516
152 Ga0395905_0097371 3300037471 Bacteria 2762
153 Ga0436364_1337767 3300037853 Bacteria 1226
154 Ga0395901_0090338 3300038443 Bacteria 3206
155 Ga0436365_1812822 3300039437 Bacteria 2283
156 Ga0436361_0956991 3300039447 Bacteria 4949
157 Ga0436363_1082221 3300039450 Bacteria 732
158 Ga0439439_0015215 3300041406 Bacteria 1877
159 Ga0439447_065926 3300041407 Bacteria 847
160 Ga0439466_0007052 3300041411 Bacteria 4255
161 Ga0439465_0031412 3300041413 Bacteria 1691
162 Ga0451791_1673616 3300041451 Bacteria 1060
163 Ga0451855_1039573 3300041511 Bacteria 607
164 Ga0439433_0017435 3300041999 Bacteria 1594
165 Ga0439442_037670 3300042002 Bacteria 1013
166 Ga0439432_026592 3300042006 Bacteria 1893
167 Ga0439449_0010053 3300042007 Bacteria 3579
168 Ga0439452_020522 3300042010 Bacteria 1732
169 Ga0439457_018502 3300042014 Bacteria 1548
170 Ga0439462_0000414 3300042015 Bacteria 8268
171 Ga0439446_0004729 3300042156 Bacteria 3463
172 Ga0439434_0002293 3300042435 Bacteria 5559
173 Ga0466972_0002842 3300044658 Bacteria 8570
174 Ga0466972_0028251 3300044658 Bacteria 2768
175 Ga0466966_0374461 3300044684 Bacteria 855
176 Ga0466968_0002246 3300044735 Bacteria 7064
177 Ga0466967_0903491 3300045976 Bacteria 878
178 Ga0495592_0047069 3300046454 Bacteria 3213
179 Ga0495603_0314475 3300046455 Bacteria 899
180 Ga0495629_0090673 3300046459 Bacteria 2133
181 Ga0495629_0114115 3300046459 Bacteria 1883
182 Ga0495580_0021704 3300046472 Bacteria 4735
183 Ga0495582_0022977 3300046473 Bacteria 3411
184 Ga0495639_0007988 3300046475 Bacteria 4544
185 Ga0495662_0056954 3300046476 Bacteria 1887
186 Ga0495664_0044439 3300046477 Bacteria 2632
187 Ga0495628_0028484 3300046516 Bacteria 4537
188 Ga0495630_0015505 3300046517 Bacteria 5565
189 Ga0495648_0002262 3300046524 Bacteria 17991
190 Ga0495666_0100212 3300046526 Bacteria 1365
191 Ga0495652_0244490 3300046529 Bacteria 1333
192 Ga0495665_0051806 3300046531 Bacteria 2173
193 Ga0495640_0006879 3300046533 Bacteria 8960
194 Ga0495640_0028802 3300046533 Bacteria 3994
195 Ga0495587_0149984 3300046536 Bacteria 1329
196 Ga0495645_0230705 3300046543 Bacteria 1240
197 Ga0495645_0372071 3300046543 Bacteria 916
198 Ga0495634_0054733 3300046642 Bacteria 2669
199 Ga0495634_0516610 3300046642 Bacteria 699
200 Ga0495635_0192964 3300046663 Bacteria 1382
201 Ga0495635_0209987 3300046663 Bacteria 1319
202 Ga0495599_0454085 3300046678 Bacteria 758
203 Ga0495646_0241420 3300046680 Bacteria 970
204 Ga0495658_0021427 3300046683 Bacteria 3407
205 Ga0495624_0088803 3300046690 Bacteria 1908
206 Ga0495600_0555328 3300046809 Bacteria 701
207 Ga0495581_0021230 3300047315 Bacteria 3766
208 Ga0495604_0182537 3300047317 Bacteria 1467
209 Ga0495604_0202575 3300047317 Bacteria 1376
210 Ga0495674_0027077 3300047319 Bacteria 5243
211 Ga0495674_0159088 3300047319 Bacteria 1890
212 Ga0495685_268407 3300047447 Bacteria 539
213 Ga0495684_0009757 3300047471 Bacteria 7409
214 Ga0495686_0302296 3300047472 Bacteria 883
215 Ga0495593_0077198 3300047673 Bacteria 1725
216 Ga0496104_1391276 3300048907 Bacteria 605
217 Ga0496106_0314967 3300048909 Bacteria 1256
218 Ga0496110_0157321 3300048913 Bacteria 2059
219 Ga0496118_0185036 3300048921 Bacteria 1253
220 Ga0496118_0514426 3300048921 Bacteria 592
221 Ga0496119_0030001 3300048922 Bacteria 3673
222 Ga0496120_0088941 3300048923 Bacteria 1654
223 Ga0496122_0012473 3300048925 Bacteria 8455
224 Ga0496122_0247769 3300048925 Bacteria 999
225 Ga0496123_0215862 3300048926 Bacteria 971
226 Ga0496124_0088202 3300048927 Bacteria 2536
227 Ga0496125_0106369 3300048928 Bacteria 2048
228 Ga0496125_0186397 3300048928 Bacteria 1375
229 Ga0496126_0308291 3300048929 Bacteria 1304
230 Ga0501034_0115740 3300049571 Bacteria 2669
231 Ga0501043_0453631 3300049579 Bacteria 963
232 Ga0501046_0066192 3300049580 Bacteria 2817
233 Ga0501046_0190997 3300049580 Bacteria 1528
234 Ga0501047_0865859 3300049581 Bacteria 717
235 Ga0501241_039959 3300049758 Bacteria 907
236 Ga0501044_0650710 3300049823 Bacteria 943
237 nmdc:mga0sz30_402940_c1 3300050516 Bacteria 613
238 nmdc:mga0sz30_88584_c1 3300050516 Bacteria 1019
239 Ga0495601_0054650 3300053077 Bacteria 2527
240 Ga0495601_0378745 3300053077 Bacteria 918
241 Ga0495612_0039500 3300053078 Bacteria 1920
242 Ga0495612_0476751 3300053078 Bacteria 571
243 Ga0500646_0270129 3300053090 Bacteria 603
244 Ga0500566_0075867 3300053094 Bacteria 1880
245 Ga0500572_000766 3300053111 Bacteria 10318
246 Ga0500608_000353 3300053122 Bacteria 17755
247 Ga0500608_209405 3300053122 Bacteria 798
248 Ga0500642_0000316 3300053130 Bacteria 16897
249 Ga0500559_0000274 3300053136 Bacteria 39917
250 Ga0500559_0241026 3300053136 Bacteria 852
251 Ga0500564_000182 3300053138 Bacteria 16698
252 Ga0500573_0047098 3300053140 Bacteria 2484
253 Ga0500634_0050798 3300053161 Bacteria 2232
254 Ga0500639_103236 3300053163 Bacteria 1399
255 Ga0500576_130459 3300053725 Bacteria 974
256 Ga0500625_000007 3300053729 Bacteria 177638
257 Ga0500596_011455 3300053735 Bacteria 1356
258 Ga0466962_0294787 3300061719 Bacteria 802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053161 Ga0500634_0050798 Ga0500634_0050798_1022_1450 126
2 iso_pu_bacteria 2513237094 2513643078 126
3 iso_pu_bacteria 2667528174 2671113883 128
4 iso_pu_bacteria 2919408235 2919408573 128
5 iso_pu_bacteria 2838122688 2838125237 130
6 iso_pu_bacteria 2841983080 2841987699 130
7 3300005983 Ga0081540_1074686 Ga0081540_10746863 131
8 3300046524 Ga0495648_0002262 Ga0495648_0002262_754_1176 131
9 iso_pu_bacteria 2511231028 2511400995 131
10 iso_pu_bacteria 2824704595 2824708697 131
11 iso_pu_bacteria 2824753945 2824759035 131
12 iso_pu_bacteria 2824763712 2824763901 131
13 iso_pu_bacteria 2841949485 2841951521 131
14 iso_pu_bacteria 2904711408 2904720515 131
15 3300003323 rootH1_10060564 rootH1_100605642 132
16 3300003323 rootH1_10338851 rootH1_103388515 132
17 3300025206 Ga0209435_100026 Ga0209435_100026131 132
18 3300025246 Ga0209646_1000084 Ga0209646_1000084131 132
19 3300025246 Ga0209646_1010994 Ga0209646_10109942 132
20 3300025250 Ga0209026_1000080 Ga0209026_1000080131 132
21 3300025256 Ga0209759_1000061 Ga0209759_1000061131 132
22 3300048921 Ga0496118_0185036 Ga0496118_0185036_204_605 132
23 3300048922 Ga0496119_0030001 Ga0496119_0030001_1107_1508 132
24 3300048923 Ga0496120_0088941 Ga0496120_0088941_871_1272 132
25 3300048925 Ga0496122_0247769 Ga0496122_0247769_368_769 132
26 3300048927 Ga0496124_0088202 Ga0496124_0088202_1021_1422 132
27 3300048928 Ga0496125_0106369 Ga0496125_0106369_541_942 132
28 iso_pu_bacteria 2508501128 2509151854 132
29 iso_pu_bacteria 2643221605 2644037015 132
30 iso_pu_bacteria 2996336353 2996341785 132
31 3300005455 Ga0070663_100060839 Ga0070663_1000608394 133
32 3300013105 Ga0157369_10922769 Ga0157369_109227692 133
33 iso_pu_bacteria 2958084443 2958089497 133
34 3300009098 Ga0105245_11497727 Ga0105245_114977272 134
35 3300031730 Ga0307516_10284803 Ga0307516_102848032 134
36 3300044684 Ga0466966_0374461 Ga0466966_0374461_277_681 134
37 3300045976 Ga0466967_0903491 Ga0466967_0903491_336_740 134
38 3300053111 Ga0500572_000766 Ga0500572_000766_8047_8451 134
39 3300053122 Ga0500608_209405 Ga0500608_209405_279_683 134
40 3300053136 Ga0500559_0000274 Ga0500559_0000274_28502_28906 134
41 3300053163 Ga0500639_103236 Ga0500639_103236_932_1336 134
42 3300053725 Ga0500576_130459 Ga0500576_130459_350_754 134
43 3300053735 Ga0500596_011455 Ga0500596_011455_480_884 134
44 3300061719 Ga0466962_0294787 Ga0466962_0294787_61_465 134
45 3300005328 Ga0070676_11460867 Ga0070676_114608671 135
46 3300005337 Ga0070682_101831130 Ga0070682_1018311301 135
47 3300005340 Ga0070689_100682329 Ga0070689_1006823292 135
48 3300005354 Ga0070675_100206110 Ga0070675_1002061103 135
49 3300005354 Ga0070675_101105286 Ga0070675_1011052861 135
50 3300005367 Ga0070667_100473762 Ga0070667_1004737622 135
51 3300005436 Ga0070713_100549039 Ga0070713_1005490392 135
52 3300005548 Ga0070665_100169692 Ga0070665_1001696922 135
53 3300005578 Ga0068854_101081462 Ga0068854_1010814622 135
54 3300005618 Ga0068864_100352124 Ga0068864_1003521242 135
55 3300005842 Ga0068858_100262611 Ga0068858_1002626112 135
56 3300005937 Ga0081455_10032608 Ga0081455_100326083 135
57 3300006186 Ga0075369_10388700 Ga0075369_103887001 135
58 3300006237 Ga0097621_100294511 Ga0097621_1002945112 135
59 3300006358 Ga0068871_100177574 Ga0068871_1001775742 135
60 3300009148 Ga0105243_10241799 Ga0105243_102417992 135
61 3300009148 Ga0105243_11464270 Ga0105243_114642701 135
62 3300009148 Ga0105243_11694911 Ga0105243_116949112 135
63 3300009545 Ga0105237_11457085 Ga0105237_114570852 135
64 3300009551 Ga0105238_10568086 Ga0105238_105680862 135
65 3300010375 Ga0105239_10293201 Ga0105239_102932013 135
66 3300011119 Ga0105246_11060499 Ga0105246_110604992 135
67 3300013297 Ga0157378_10674451 Ga0157378_106744512 135
68 3300013306 Ga0163162_11374782 Ga0163162_113747822 135
69 3300013308 Ga0157375_10222380 Ga0157375_102223802 135
70 3300014325 Ga0163163_10810925 Ga0163163_108109252 135
71 3300014969 Ga0157376_10076079 Ga0157376_100760792 135
72 3300017792 Ga0163161_10130447 Ga0163161_101304472 135
73 3300021384 Ga0213876_10036876 Ga0213876_100368763 135
74 3300021388 Ga0213875_10444352 Ga0213875_104443522 135
75 3300025297 Ga0209758_1001808 Ga0209758_100180817 135
76 3300025299 Ga0209256_1022068 Ga0209256_10220683 135
77 3300025304 Ga0209257_1020327 Ga0209257_10203274 135
78 3300025908 Ga0207643_10098454 Ga0207643_100984542 135
79 3300025908 Ga0207643_10424068 Ga0207643_104240681 135
80 3300025915 Ga0207693_10061629 Ga0207693_100616292 135
81 3300025919 Ga0207657_11329711 Ga0207657_113297111 135
82 3300025926 Ga0207659_10170225 Ga0207659_101702251 135
83 3300025926 Ga0207659_10797293 Ga0207659_107972932 135
84 3300025928 Ga0207700_10078533 Ga0207700_100785333 135
85 3300025931 Ga0207644_10396023 Ga0207644_103960232 135
86 3300025935 Ga0207709_10655420 Ga0207709_106554201 135
87 3300025937 Ga0207669_10204984 Ga0207669_102049842 135
88 3300025972 Ga0207668_10640575 Ga0207668_106405752 135
89 3300025981 Ga0207640_10562530 Ga0207640_105625302 135
90 3300026035 Ga0207703_10282186 Ga0207703_102821861 135
91 3300026035 Ga0207703_10312076 Ga0207703_103120762 135
92 3300026118 Ga0207675_100084276 Ga0207675_1000842763 135
93 3300026121 Ga0207683_10034818 Ga0207683_100348182 135
94 3300028379 Ga0268266_10040552 Ga0268266_100405524 135
95 3300028379 Ga0268266_10568504 Ga0268266_105685042 135
96 3300028786 Ga0307517_10002153 Ga0307517_1000215310 135
97 3300031730 Ga0307516_10496983 Ga0307516_104969831 135
98 3300031824 Ga0307413_10522006 Ga0307413_105220062 135
99 3300031901 Ga0307406_10700812 Ga0307406_107008121 135
100 3300031995 Ga0307409_100029377 Ga0307409_1000293773 135
101 3300032126 Ga0307415_101212711 Ga0307415_1012127112 135
102 3300035090 Ga0373949_0070924 Ga0373949_0070924_162_569 135
103 3300037418 Ga0395900_0159000 Ga0395900_0159000_1609_2019 135
104 3300037466 Ga0395898_0674016 Ga0395898_0674016_466_885 135
105 3300037471 Ga0395905_0026032 Ga0395905_0026032_2604_3014 135
106 3300037471 Ga0395905_0097371 Ga0395905_0097371_469_876 135
107 3300037853 Ga0436364_1337767 Ga0436364_1337767_524_934 135
108 3300038443 Ga0395901_0090338 Ga0395901_0090338_748_1158 135
109 3300039437 Ga0436365_1812822 Ga0436365_1812822_1120_1530 135
110 3300039447 Ga0436361_0956991 Ga0436361_0956991_961_1371 135
111 3300039450 Ga0436363_1082221 Ga0436363_1082221_123_533 135
112 3300041451 Ga0451791_1673616 Ga0451791_1673616_585_992 135
113 3300041511 Ga0451855_1039573 Ga0451855_1039573_185_592 135
114 3300044658 Ga0466972_0002842 Ga0466972_0002842_5091_5501 135
115 3300044658 Ga0466972_0028251 Ga0466972_0028251_636_1046 135
116 3300044735 Ga0466968_0002246 Ga0466968_0002246_5454_5864 135
117 3300046455 Ga0495603_0314475 Ga0495603_0314475_33_440 135
118 3300046459 Ga0495629_0114115 Ga0495629_0114115_162_569 135
119 3300046473 Ga0495582_0022977 Ga0495582_0022977_2410_2817 135
120 3300046663 Ga0495635_0209987 Ga0495635_0209987_241_648 135
121 3300047317 Ga0495604_0202575 Ga0495604_0202575_137_544 135
122 3300047447 Ga0495685_268407 Ga0495685_268407_61_468 135
123 3300048907 Ga0496104_1391276 Ga0496104_1391276_144_551 135
124 3300048909 Ga0496106_0314967 Ga0496106_0314967_443_850 135
125 3300048913 Ga0496110_0157321 Ga0496110_0157321_747_1154 135
126 3300048921 Ga0496118_0514426 Ga0496118_0514426_72_482 135
127 3300050516 nmdc:mga0sz30_402940_c1 nmdc:mga0sz30_402940_c1_58_465 135
128 3300053094 Ga0500566_0075867 Ga0500566_0075867_880_1287 135
129 3300053130 Ga0500642_0000316 Ga0500642_0000316_8154_8564 135
130 3300005841 Ga0068863_100068614 Ga0068863_1000686143 136
131 3300005843 Ga0068860_100384552 Ga0068860_1003845522 136
132 3300028379 Ga0268266_10237774 Ga0268266_102377742 136
133 3300003771 Ga0055526_1040896 Ga0055526_10408962 137
134 3300003775 Ga0055524_1008852 Ga0055524_10088523 137
135 3300003790 Ga0055528_1002182 Ga0055528_10021826 137
136 3300025273 Ga0209673_1000024 Ga0209673_1000024323 137
137 3300025292 Ga0209676_1016149 Ga0209676_10161492 137
138 3300025294 Ga0209025_1026862 Ga0209025_10268622 137
139 3300025295 Ga0209564_1005766 Ga0209564_10057662 137
140 3300025295 Ga0209564_1023200 Ga0209564_10232003 137
141 3300025299 Ga0209256_1000814 Ga0209256_100081414 137
142 3300025304 Ga0209257_1045126 Ga0209257_10451262 137
143 3300025304 Ga0209257_1096808 Ga0209257_10968082 137
144 3300048925 Ga0496122_0012473 Ga0496122_0012473_1035_1448 137
145 3300048926 Ga0496123_0215862 Ga0496123_0215862_353_766 137
146 3300048928 Ga0496125_0186397 Ga0496125_0186397_658_1071 137
147 iso_pu_bacteria 2818991449 2819616386 137
148 3300005434 Ga0070709_10039210 Ga0070709_100392101 138
149 3300005434 Ga0070709_10113573 Ga0070709_101135732 138
150 3300005435 Ga0070714_100061780 Ga0070714_1000617802 138
151 3300005436 Ga0070713_100020773 Ga0070713_1000207734 138
152 3300005437 Ga0070710_10166208 Ga0070710_101662081 138
153 3300005439 Ga0070711_100053755 Ga0070711_1000537553 138
154 3300005530 Ga0070679_100307635 Ga0070679_1003076352 138
155 3300006028 Ga0070717_10548134 Ga0070717_105481342 138
156 3300006175 Ga0070712_100014863 Ga0070712_1000148634 138
157 3300014325 Ga0163163_11209639 Ga0163163_112096392 138
158 3300025898 Ga0207692_10239713 Ga0207692_102397131 138
159 3300025906 Ga0207699_10006782 Ga0207699_100067825 138
160 3300025906 Ga0207699_10029671 Ga0207699_100296711 138
161 3300025915 Ga0207693_10030351 Ga0207693_100303515 138
162 3300025916 Ga0207663_10099858 Ga0207663_100998582 138
163 3300025916 Ga0207663_11265892 Ga0207663_112658922 138
164 3300035083 Ga0373926_0024367 Ga0373926_0024367_928_1347 138
165 3300035086 Ga0373934_0009902 Ga0373934_0009902_308_727 138
166 3300035113 Ga0373936_0016160 Ga0373936_0016160_1139_1558 138
167 3300035118 Ga0373954_0006983 Ga0373954_0006983_943_1362 138
168 3300035119 Ga0373956_0266258 Ga0373956_0266258_237_656 138
169 3300035170 Ga0373943_0124528 Ga0373943_0124528_506_925 138
170 3300035171 Ga0373946_0005588 Ga0373946_0005588_2718_3137 138
171 3300035172 Ga0373955_0090574 Ga0373955_0090574_536_955 138
172 3300035410 Ga0373924_0034968 Ga0373924_0034968_159_578 138
173 3300035692 Ga0373935_0062399 Ga0373935_0062399_1547_1966 138
174 3300035695 Ga0373927_0066336 Ga0373927_0066336_368_787 138
175 3300035724 Ga0373933_0083128 Ga0373933_0083128_931_1350 138
176 3300035725 Ga0373947_0025025 Ga0373947_0025025_804_1223 138
177 3300036401 Ga0373937_0143963 Ga0373937_0143963_936_1355 138
178 3300037068 Ga0373925_0178283 Ga0373925_0178283_741_1160 138
179 3300046454 Ga0495592_0047069 Ga0495592_0047069_239_658 138
180 3300046459 Ga0495629_0090673 Ga0495629_0090673_576_995 138
181 3300046472 Ga0495580_0021704 Ga0495580_0021704_741_1160 138
182 3300046475 Ga0495639_0007988 Ga0495639_0007988_2630_3049 138
183 3300046476 Ga0495662_0056954 Ga0495662_0056954_919_1338 138
184 3300046477 Ga0495664_0044439 Ga0495664_0044439_1502_1921 138
185 3300046517 Ga0495630_0015505 Ga0495630_0015505_741_1160 138
186 3300046526 Ga0495666_0100212 Ga0495666_0100212_908_1327 138
187 3300046531 Ga0495665_0051806 Ga0495665_0051806_814_1233 138
188 3300046533 Ga0495640_0006879 Ga0495640_0006879_3498_3917 138
189 3300046543 Ga0495645_0230705 Ga0495645_0230705_292_711 138
190 3300046642 Ga0495634_0054733 Ga0495634_0054733_928_1347 138
191 3300046663 Ga0495635_0192964 Ga0495635_0192964_861_1280 138
192 3300046683 Ga0495658_0021427 Ga0495658_0021427_2283_2702 138
193 3300046690 Ga0495624_0088803 Ga0495624_0088803_1102_1521 138
194 3300046809 Ga0495600_0555328 Ga0495600_0555328_220_639 138
195 3300047315 Ga0495581_0021230 Ga0495581_0021230_2540_2959 138
196 3300047317 Ga0495604_0182537 Ga0495604_0182537_377_796 138
197 3300047319 Ga0495674_0159088 Ga0495674_0159088_1104_1523 138
198 3300047471 Ga0495684_0009757 Ga0495684_0009757_3529_3948 138
199 3300047673 Ga0495593_0077198 Ga0495593_0077198_308_727 138
200 3300048929 Ga0496126_0308291 Ga0496126_0308291_13_432 138
201 3300049579 Ga0501043_0453631 Ga0501043_0453631_430_849 138
202 3300049580 Ga0501046_0066192 Ga0501046_0066192_44_463 138
203 3300049581 Ga0501047_0865859 Ga0501047_0865859_288_707 138
204 3300053077 Ga0495601_0054650 Ga0495601_0054650_1042_1461 138
205 3300053078 Ga0495612_0039500 Ga0495612_0039500_375_794 138
206 iso_pu_bacteria 2852680915 2852681247 138
207 3300006186 Ga0075369_10191161 Ga0075369_101911612 139
208 3300006353 Ga0075370_10118177 Ga0075370_101181772 139
209 3300015684 Ga0183365_10001 Ga0183365_10001877 139
210 3300046516 Ga0495628_0028484 Ga0495628_0028484_2062_2505 139
211 3300046529 Ga0495652_0244490 Ga0495652_0244490_404_847 139
212 3300046533 Ga0495640_0028802 Ga0495640_0028802_560_1003 139
213 3300046536 Ga0495587_0149984 Ga0495587_0149984_659_1102 139
214 3300046543 Ga0495645_0372071 Ga0495645_0372071_251_694 139
215 3300046678 Ga0495599_0454085 Ga0495599_0454085_52_495 139
216 3300046680 Ga0495646_0241420 Ga0495646_0241420_446_889 139
217 3300047319 Ga0495674_0027077 Ga0495674_0027077_4614_5057 139
218 3300049571 Ga0501034_0115740 Ga0501034_0115740_474_896 139
219 3300050516 nmdc:mga0sz30_88584_c1 nmdc:mga0sz30_88584_c1_564_992 139
220 3300053077 Ga0495601_0378745 Ga0495601_0378745_306_749 139
221 3300053078 Ga0495612_0476751 Ga0495612_0476751_70_513 139
222 3300053122 Ga0500608_000353 Ga0500608_000353_7242_7670 139
223 3300053136 Ga0500559_0241026 Ga0500559_0241026_102_530 139
224 3300053138 Ga0500564_000182 Ga0500564_000182_2538_2966 139
225 3300053140 Ga0500573_0047098 Ga0500573_0047098_347_775 139
226 3300053729 Ga0500625_000007 Ga0500625_000007_86616_87044 139
227 iso_pu_bacteria 2904434214 2904436352 139
228 3300002737 JGI25162J39368_1003510 JGI25162J39368_10035103 140
229 3300010375 Ga0105239_11074484 Ga0105239_110744842 140
230 3300025233 Ga0209437_100072 Ga0209437_100072190 140
231 3300046642 Ga0495634_0516610 Ga0495634_0516610_68_499 140
232 3300053090 Ga0500646_0270129 Ga0500646_0270129_134_559 140
233 iso_pu_bacteria 2885192300 2885197205 140
234 3300005458 Ga0070681_10735215 Ga0070681_107352152 141
235 3300005535 Ga0070684_100197377 Ga0070684_1001973773 141
236 3300025921 Ga0207652_10084110 Ga0207652_100841104 141
237 3300025944 Ga0207661_10002357 Ga0207661_100023579 141
238 3300049758 Ga0501241_039959 Ga0501241_039959_99_527 141
239 3300028379 Ga0268266_10590837 Ga0268266_105908372 142
240 3300041406 Ga0439439_0015215 Ga0439439_0015215_1103_1549 142
241 3300041407 Ga0439447_065926 Ga0439447_065926_360_806 142
242 3300041411 Ga0439466_0007052 Ga0439466_0007052_2459_2905 142
243 3300041413 Ga0439465_0031412 Ga0439465_0031412_1094_1540 142
244 3300041999 Ga0439433_0017435 Ga0439433_0017435_979_1425 142
245 3300042002 Ga0439442_037670 Ga0439442_037670_363_809 142
246 3300042006 Ga0439432_026592 Ga0439432_026592_648_1094 142
247 3300042007 Ga0439449_0010053 Ga0439449_0010053_240_686 142
248 3300042010 Ga0439452_020522 Ga0439452_020522_81_527 142
249 3300042014 Ga0439457_018502 Ga0439457_018502_1012_1458 142
250 3300042015 Ga0439462_0000414 Ga0439462_0000414_4984_5430 142
251 3300042156 Ga0439446_0004729 Ga0439446_0004729_2358_2804 142
252 3300042435 Ga0439434_0002293 Ga0439434_0002293_3690_4136 142
253 3300013306 Ga0163162_12396765 Ga0163162_123967652 143
254 3300049580 Ga0501046_0190997 Ga0501046_0190997_495_929 143
255 3300049823 Ga0501044_0650710 Ga0501044_0650710_288_722 143
256 3300047472 Ga0495686_0302296 Ga0495686_0302296_195_644 144
257 3300002459 JGI24751J29686_10000731 JGI24751J29686_100007316 148
258 3300005295 Ga0065707_10084417 Ga0065707_100844176 148
259 3300005331 Ga0070670_100000005 Ga0070670_10000000578 148
260 3300005367 Ga0070667_100006995 Ga0070667_1000069954 148
261 3300005617 Ga0068859_100000375 Ga0068859_10000037513 148
262 3300005618 Ga0068864_100000011 Ga0068864_10000001177 148
263 3300005719 Ga0068861_100003145 Ga0068861_1000031456 148
264 3300005843 Ga0068860_100229069 Ga0068860_1002290694 148
265 3300005844 Ga0068862_100000011 Ga0068862_100000011156 148
266 3300006931 Ga0097620_100000375 Ga0097620_10000037513 148
267 3300009177 Ga0105248_10000069 Ga0105248_1000006940 148
268 3300009553 Ga0105249_10112072 Ga0105249_101120722 148
269 3300013306 Ga0163162_10851274 Ga0163162_108512742 148
270 3300014326 Ga0157380_10001128 Ga0157380_100011285 148
271 3300025923 Ga0207681_10000001 Ga0207681_10000001580 148
272 3300025925 Ga0207650_10000018 Ga0207650_1000001879 148
273 3300025941 Ga0207711_10001189 Ga0207711_1000118915 148
274 3300025986 Ga0207658_10009398 Ga0207658_100093988 148
275 3300026095 Ga0207676_10000004 Ga0207676_10000004472 148
276 3300028380 Ga0268265_10000002 Ga0268265_10000002597 148
277 3300028381 Ga0268264_10234354 Ga0268264_102343544 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

26

134

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.9432 3 119
3rdw-assembly2.cif.gz_B putative arsenate reductase from yersinia pestis 0.9358 7 117
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.928 3 119
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9094 7 140
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9088 7 140
ID Description Score Start End Superfamily
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9359 7 117 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9048 7 117 3.40.30.10
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9035 6 35 3.80.10.10
af_D7SFI3_9_110_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9004 6 35 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9 7 140 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A659UVR1-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9842 6 121 GO:0008794
GO:0046685
AF-A0A238KI20-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9842 6 119 GO:0008794
GO:0046685
AF-A0A2W4YC61-F1-model_v4 deleted 0.9819 8 96
AF-Q1GCT6-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9816 6 120 GO:0008794
GO:0046685
AF-A0A6M1MIH4-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9813 6 120 GO:0008794
GO:0046685

Feature Viewer

pLDDT pTM Quality
88.76 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map