F381429

General Info

Members Datasets Scaffolds Average Seq Length
276 179 276 126

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_1083999_c1|nmdc:mga0qj67_1083999_c1_122_577
Length 151
Sequence MGEGGRPLPLTVTLRLAWGICEGTMLHQRHWTPEQANELLPVVGATVRRLRDARRRLSERGVDSDLSLHAEASGGAWPGRERAIESVHVALGFECLERLDVVVRDLERGLVDFPAVIDGREVYLCWLLDEPSVGHWHGIETGFAGRRPLTD

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
175 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 1.81
Rhizosphere 96.74
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10035102 3300003203 Bacteria 1833
2 JGI25406J46586_10042086 3300003203 Bacteria 1602
3 Ga0070676_10316072 3300005328 Bacteria 1063
4 Ga0070683_100133625 3300005329 Bacteria 2349
5 Ga0070683_100412889 3300005329 Bacteria 1287
6 Ga0070683_101753209 3300005329 Unclassified 597
7 Ga0070683_102111622 3300005329 Bacteria 541
8 Ga0070690_100948147 3300005330 Unclassified 675
9 Ga0070670_100534785 3300005331 Bacteria 1044
10 Ga0070670_101560448 3300005331 Unclassified 607
11 Ga0070666_10084695 3300005335 Bacteria 2170
12 Ga0070660_100962150 3300005339 Unclassified 721
13 Ga0070687_101357841 3300005343 Unclassified 530
14 Ga0070692_10685383 3300005345 Unclassified 688
15 Ga0070668_100407621 3300005347 Unclassified 1162
16 Ga0070668_100423775 3300005347 Bacteria 1140
17 Ga0070669_100893750 3300005353 Unclassified 758
18 Ga0070674_100116921 3300005356 Bacteria 1968
19 Ga0070701_10138975 3300005438 Bacteria 1387
20 Ga0070705_101126233 3300005440 Unclassified 643
21 Ga0070700_100226687 3300005441 Bacteria 1327
22 Ga0070700_100454690 3300005441 Unclassified 975
23 Ga0070663_100749137 3300005455 Unclassified 834
24 Ga0070678_100604851 3300005456 Unclassified 979
25 Ga0068867_100080896 3300005459 Bacteria 2448
26 Ga0068867_100327625 3300005459 Unclassified 1271
27 Ga0068867_100802692 3300005459 Bacteria 839
28 Ga0070684_100266731 3300005535 Unclassified 1567
29 Ga0070672_100602730 3300005543 Bacteria 957
30 Ga0070686_100060037 3300005544 Bacteria 2452
31 Ga0070693_100352014 3300005547 Unclassified 1008
32 Ga0070704_102149916 3300005549 Unclassified 519
33 Ga0070664_100254274 3300005564 Bacteria 1580
34 Ga0068857_101211488 3300005577 Unclassified 731
35 Ga0068857_102057118 3300005577 Unclassified 560
36 Ga0068854_100362919 3300005578 Unclassified 1189
37 Ga0070702_100447697 3300005615 Unclassified 936
38 Ga0068852_102142732 3300005616 Unclassified 581
39 Ga0068866_10173395 3300005718 Bacteria 1268
40 Ga0068861_100054801 3300005719 Bacteria 3039
41 Ga0068863_101507953 3300005841 Unclassified 681
42 Ga0081455_10021112 3300005937 Bacteria 6115
43 Ga0081455_10384548 3300005937 Bacteria 979
44 Ga0081455_10758516 3300005937 Bacteria 613
45 Ga0081538_10000911 3300005981 Bacteria 31882
46 Ga0081538_10050248 3300005981 Bacteria 2520
47 Ga0081538_10070847 3300005981 Bacteria 1922
48 Ga0081538_10206796 3300005981 Bacteria 797
49 Ga0081539_10007063 3300005985 Bacteria 10385
50 Ga0075365_10949497 3300006038 Unclassified 606
51 Ga0097621_100906459 3300006237 Unclassified 821
52 Ga0075428_100026334 3300006844 Bacteria 6438
53 Ga0075428_100250766 3300006844 Bacteria 1908
54 Ga0075428_101005401 3300006844 Bacteria 883
55 Ga0075428_101351108 3300006844 Bacteria 749
56 Ga0075430_101090499 3300006846 Bacteria 658
57 Ga0075431_100810422 3300006847 Bacteria 909
58 Ga0075434_102514363 3300006871 Bacteria 516
59 Ga0075429_100321361 3300006880 Bacteria 1355
60 Ga0075429_101066578 3300006880 Bacteria 706
61 Ga0068865_100131057 3300006881 Bacteria 1879
62 Ga0075436_100558353 3300006914 Unclassified 841
63 Ga0075435_101559533 3300007076 Unclassified 579
64 Ga0111539_10151930 3300009094 Bacteria 2710
65 Ga0111539_10398637 3300009094 Bacteria 1603
66 Ga0111539_10601386 3300009094 Bacteria 1281
67 Ga0111539_11446013 3300009094 Bacteria 797
68 Ga0111539_12832063 3300009094 Bacteria 562
69 Ga0105245_10546457 3300009098 Unclassified 1180
70 Ga0114129_10678165 3300009147 Bacteria 1327
71 Ga0114129_11649704 3300009147 Bacteria 784
72 Ga0114129_13357656 3300009147 Bacteria 516
73 Ga0105243_10173824 3300009148 Bacteria 1868
74 Ga0105243_10235811 3300009148 Bacteria 1625
75 Ga0105241_10757290 3300009174 Unclassified 891
76 Ga0105242_10819562 3300009176 Bacteria 923
77 Ga0105242_11270564 3300009176 Unclassified 758
78 Ga0105248_10886089 3300009177 Unclassified 1007
79 Ga0105249_11394198 3300009553 Bacteria 773
80 Ga0105239_10558690 3300010375 Unclassified 1304
81 Ga0157378_10557926 3300013297 Unclassified 1152
82 Ga0157372_10926826 3300013307 Unclassified 1010
83 Ga0157372_11282463 3300013307 Unclassified 845
84 Ga0157375_10000131 3300013308 Bacteria 74862
85 Ga0163163_10000097 3300014325 Bacteria 92228
86 Ga0163163_10726259 3300014325 Bacteria 1057
87 Ga0157380_10082651 3300014326 Bacteria 2629
88 Ga0157377_10473114 3300014745 Bacteria 870
89 Ga0163161_10960594 3300017792 Bacteria 727
90 Ga0163161_11288525 3300017792 Unclassified 635
91 Ga0207642_10183911 3300025899 Unclassified 1141
92 Ga0207688_10016462 3300025901 Bacteria 4010
93 Ga0207680_10086973 3300025903 Bacteria 1978
94 Ga0207645_10178362 3300025907 Unclassified 1394
95 Ga0207654_10522744 3300025911 Bacteria 840
96 Ga0207657_10977283 3300025919 Unclassified 650
97 Ga0207650_11104035 3300025925 Unclassified 675
98 Ga0207659_10181393 3300025926 Bacteria 1668
99 Ga0207687_11054372 3300025927 Unclassified 698
100 Ga0207686_11081242 3300025934 Unclassified 653
101 Ga0207709_10617296 3300025935 Unclassified 860
102 Ga0207709_11591762 3300025935 Unclassified 543
103 Ga0207669_11477996 3300025937 Unclassified 579
104 Ga0207704_10084778 3300025938 Bacteria 2060
105 Ga0207704_10465026 3300025938 Unclassified 1012
106 Ga0207691_10361683 3300025940 Bacteria 1241
107 Ga0207691_11159418 3300025940 Unclassified 642
108 Ga0207711_11571142 3300025941 Unclassified 601
109 Ga0207661_10274185 3300025944 Bacteria 1506
110 Ga0207661_10406670 3300025944 Bacteria 1235
111 Ga0207661_11645930 3300025944 Unclassified 587
112 Ga0207679_10214445 3300025945 Bacteria 1616
113 Ga0207712_10598733 3300025961 Bacteria 953
114 Ga0207668_10238897 3300025972 Unclassified 1469
115 Ga0207640_11491549 3300025981 Unclassified 607
116 Ga0207678_10271478 3300026067 Bacteria 1454
117 Ga0207708_10042073 3300026075 Bacteria 3483
118 Ga0207708_10587914 3300026075 Unclassified 942
119 Ga0207641_10527633 3300026088 Unclassified 1149
120 Ga0207648_10036265 3300026089 Bacteria 4343
121 Ga0207648_10407882 3300026089 Unclassified 1232
122 Ga0207648_12112811 3300026089 Unclassified 524
123 Ga0207676_10506621 3300026095 Unclassified 1147
124 Ga0207674_10210618 3300026116 Bacteria 1893
125 Ga0207674_12089680 3300026116 Unclassified 530
126 Ga0207675_100013709 3300026118 Bacteria 7566
127 Ga0207683_10962727 3300026121 Bacteria 792
128 Ga0207698_11022878 3300026142 Unclassified 837
129 Ga0268265_11247233 3300028380 Unclassified 742
130 Ga0265337_1012318 3300028556 Bacteria 2911
131 Ga0265326_10026411 3300028558 Unclassified 1656
132 Ga0265319_1019490 3300028563 Bacteria 2531
133 Ga0265319_1040740 3300028563 Unclassified 1569
134 Ga0265334_10127192 3300028573 Unclassified 908
135 Ga0265318_10025294 3300028577 Unclassified 2346
136 Ga0265323_10032729 3300028653 Unclassified 1928
137 Ga0265322_10103283 3300028654 Unclassified 811
138 Ga0265338_10002037 3300028800 Bacteria 31291
139 Ga0265338_10008664 3300028800 Bacteria 12304
140 Ga0265338_10052800 3300028800 Unclassified 3643
141 Ga0265338_10190833 3300028800 Unclassified 1553
142 Ga0265324_10009478 3300029957 Unclassified 3798
143 Ga0316182_1403853 3300030745 Bacteria 971
144 Ga0265332_10058084 3300031238 Unclassified 1657
145 Ga0265320_10096993 3300031240 Unclassified 1360
146 Ga0265325_10006036 3300031241 Bacteria 7409
147 Ga0265325_10073210 3300031241 Unclassified 1715
148 Ga0265340_10079607 3300031247 Bacteria 1544
149 Ga0265340_10099236 3300031247 Unclassified 1355
150 Ga0265339_10003446 3300031249 Bacteria 11068
151 Ga0265316_10040680 3300031344 Bacteria 3725
152 Ga0265316_10256589 3300031344 Unclassified 1282
153 Ga0307408_100437083 3300031548 Bacteria 1132
154 Ga0265313_10002875 3300031595 Bacteria 14435
155 Ga0265314_10066079 3300031711 Bacteria 2440
156 Ga0265314_10104959 3300031711 Unclassified 1808
157 Ga0265342_10012830 3300031712 Bacteria 5656
158 Ga0307405_10606836 3300031731 Bacteria 894
159 Ga0307405_10680151 3300031731 Unclassified 850
160 Ga0307405_10938350 3300031731 Bacteria 734
161 Ga0307413_10797287 3300031824 Bacteria 793
162 Ga0307410_10080969 3300031852 Bacteria 2280
163 Ga0307410_10268885 3300031852 Bacteria 1333
164 Ga0307406_10069295 3300031901 Bacteria 2306
165 Ga0307406_10259440 3300031901 Bacteria 1314
166 Ga0307406_10282344 3300031901 Bacteria 1267
167 Ga0307406_10955828 3300031901 Bacteria 733
168 Ga0307407_10035138 3300031903 Bacteria 2751
169 Ga0307407_10333323 3300031903 Bacteria 1069
170 Ga0307407_11276554 3300031903 Unclassified 576
171 Ga0307409_100286493 3300031995 Bacteria 1525
172 Ga0307416_100643788 3300032002 Unclassified 1144
173 Ga0307416_100838450 3300032002 Bacteria 1017
174 Ga0307416_100876942 3300032002 Bacteria 996
175 Ga0307416_100887372 3300032002 Bacteria 991
176 Ga0307416_101113549 3300032002 Bacteria 894
177 Ga0307414_10671317 3300032004 Bacteria 936
178 Ga0307411_10697316 3300032005 Bacteria 884
179 Ga0307415_100033496 3300032126 Bacteria 3336
180 Ga0307415_100102001 3300032126 Bacteria 2107
181 Ga0373935_1208826 3300035692 Bacteria 563
182 Ga0395900_0976426 3300037418 Bacteria 768
183 Ga0395905_1691948 3300037471 Bacteria 538
184 Ga0395901_1306338 3300038443 Bacteria 687
185 Ga0436365_0156240 3300039437 Bacteria 893
186 Ga0439450_015127 3300042008 Bacteria 1576
187 Ga0439455_0022752 3300042012 Bacteria 1505
188 Ga0450914_002032 3300042118 Bacteria 1385
189 Ga0439458_0018401 3300042157 Bacteria 1602
190 Ga0439464_0032734 3300042439 Bacteria 1461
191 Ga0439440_0052601 3300042993 Bacteria 1021
192 Ga0466964_0797177 3300044706 Bacteria 534
193 Ga0466967_0084566 3300045976 Bacteria 2871
194 Ga0466967_0232758 3300045976 Bacteria 1755
195 Ga0466967_0298417 3300045976 Bacteria 1550
196 Ga0495630_0053577 3300046517 Bacteria 3021
197 Ga0495652_0627828 3300046529 Unclassified 730
198 Ga0495604_0966263 3300047317 Unclassified 529
199 Ga0495674_0196032 3300047319 Unclassified 1677
200 Ga0495675_0123488 3300047444 Unclassified 1612
201 Ga0496110_0027735 3300048913 Bacteria 4857
202 Ga0496110_0874796 3300048913 Unclassified 804
203 Ga0496111_0120812 3300048914 Unclassified 1935
204 Ga0496112_0315883 3300048915 Bacteria 1507
205 Ga0496113_0038070 3300048916 Unclassified 3534
206 Ga0501036_0036154 3300049572 Bacteria 4179
207 Ga0501036_0100742 3300049572 Unclassified 2443
208 Ga0501037_0947117 3300049573 Unclassified 563
209 Ga0501038_0223266 3300049574 Bacteria 1502
210 Ga0501038_0226375 3300049574 Bacteria 1490
211 Ga0501039_0037502 3300049575 Bacteria 3741
212 Ga0501039_0214830 3300049575 Unclassified 1512
213 Ga0501040_0026043 3300049576 Bacteria 3935
214 Ga0501040_0033612 3300049576 Bacteria 3475
215 Ga0501040_0049917 3300049576 Bacteria 2861
216 Ga0501041_0127534 3300049577 Bacteria 1584
217 Ga0501041_0208679 3300049577 Bacteria 1225
218 Ga0501041_0246279 3300049577 Unclassified 1123
219 Ga0501041_0708650 3300049577 Bacteria 644
220 Ga0501042_0049282 3300049578 Bacteria 3004
221 Ga0501042_0079223 3300049578 Bacteria 2353
222 Ga0501042_0132081 3300049578 Bacteria 1799
223 Ga0501046_0083568 3300049580 Bacteria 2464
224 Ga0501046_0439147 3300049580 Bacteria 939
225 Ga0501048_0048515 3300049582 Bacteria 3028
226 Ga0501048_0124163 3300049582 Bacteria 1825
227 Ga0501048_0750522 3300049582 Bacteria 701
228 Ga0501067_0075782 3300049583 Unclassified 1864
229 Ga0501069_0289786 3300049585 Bacteria 959
230 Ga0501070_0183992 3300049586 Bacteria 1719
231 Ga0501071_0037038 3300049587 Bacteria 3481
232 Ga0501072_0030644 3300049588 Bacteria 4208
233 Ga0501072_0035844 3300049588 Bacteria 3888
234 Ga0501072_0137341 3300049588 Bacteria 1949
235 Ga0501072_0531391 3300049588 Bacteria 929
236 Ga0501074_0056730 3300049590 Bacteria 2823
237 Ga0501074_0416701 3300049590 Bacteria 952
238 Ga0501075_0016164 3300049591 Bacteria 5371
239 Ga0501076_0040805 3300049592 Bacteria 3648
240 Ga0501076_0070479 3300049592 Bacteria 2795
241 Ga0501076_0126107 3300049592 Bacteria 2074
242 Ga0501077_0083626 3300049593 Bacteria 2023
243 Ga0501077_0298920 3300049593 Bacteria 1025
244 Ga0501079_0052337 3300049741 Bacteria 3151
245 Ga0501079_0109229 3300049741 Bacteria 2148
246 Ga0501079_0441749 3300049741 Bacteria 1021
247 Ga0501081_0015096 3300049743 Bacteria 5098
248 Ga0501081_0115555 3300049743 Bacteria 1907
249 Ga0501083_0049382 3300049744 Bacteria 2836
250 Ga0501044_1306365 3300049823 Unclassified 592
251 Ga0501045_0028886 3300049824 Bacteria 4003
252 Ga0501045_0034679 3300049824 Bacteria 3664
253 nmdc:mga00v17_326178_c1 3300050491 Unclassified 997
254 nmdc:mga05p37_2179024_c1 3300050507 Bacteria 516
255 nmdc:mga09592_334343_c1 3300050508 Bacteria 1311
256 nmdc:mga0qj67_1083999_c1 3300050509 Bacteria 626
257 nmdc:mga08y16_1040211_c1 3300050511 Bacteria 797
258 nmdc:mga08y16_416188_c1 3300050511 Unclassified 1374
259 nmdc:mga08y16_64717_c1 3300050511 Bacteria 3817
260 nmdc:mga0n895_661058_c1 3300050512 Unclassified 1043
261 nmdc:mga0rr50_1384062_c1 3300050513 Bacteria 596
262 nmdc:mga08x19_948472_c1 3300050514 Unclassified 611
263 Ga0495655_0212473 3300053083 Unclassified 637
264 Ga0500554_085618 3300053102 Bacteria 1043
265 Ga0501084_0083975 3300054114 Bacteria 2673
266 Ga0501084_0135119 3300054114 Bacteria 2076
267 Ga0501084_0406640 3300054114 Bacteria 1150
268 Ga0501084_0786092 3300054114 Unclassified 802
269 Ga0590075_066676 3300059424 Bacteria 929
270 Ga0501082_0127513 3300060353 Bacteria 2207
271 Ga0501082_0260148 3300060353 Unclassified 1509
272 Ga0501082_0426284 3300060353 Bacteria 1158
273 Ga0501082_0915131 3300060353 Bacteria 767
274 Ga0530510_0060607 3300061734 Bacteria 2738
275 Ga0530510_0155252 3300061734 Bacteria 1691
276 Ga0530510_0194462 3300061734 Bacteria 1506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028558 Ga0265326_10026411 Ga0265326_100264112 111
2 3300028563 Ga0265319_1040740 Ga0265319_10407403 111
3 3300028573 Ga0265334_10127192 Ga0265334_101271922 111
4 3300028577 Ga0265318_10025294 Ga0265318_100252943 111
5 3300028653 Ga0265323_10032729 Ga0265323_100327292 111
6 3300028654 Ga0265322_10103283 Ga0265322_101032831 111
7 3300028800 Ga0265338_10190833 Ga0265338_101908332 111
8 3300029957 Ga0265324_10009478 Ga0265324_100094782 111
9 3300031238 Ga0265332_10058084 Ga0265332_100580843 111
10 3300031240 Ga0265320_10096993 Ga0265320_100969932 111
11 3300031241 Ga0265325_10073210 Ga0265325_100732103 111
12 3300031247 Ga0265340_10099236 Ga0265340_100992362 111
13 3300031249 Ga0265339_10003446 Ga0265339_100034464 111
14 3300031711 Ga0265314_10104959 Ga0265314_101049593 111
15 3300030745 Ga0316182_1403853 Ga0316182_14038533 124
16 3300031731 Ga0307405_10938350 Ga0307405_109383502 124
17 3300031901 Ga0307406_10282344 Ga0307406_102823442 124
18 3300031903 Ga0307407_11276554 Ga0307407_112765542 124
19 3300031995 Ga0307409_100286493 Ga0307409_1002864932 124
20 3300032002 Ga0307416_100643788 Ga0307416_1006437883 124
21 3300032126 Ga0307415_100102001 Ga0307415_1001020012 124
22 3300005329 Ga0070683_100133625 Ga0070683_1001336252 125
23 3300005329 Ga0070683_100412889 Ga0070683_1004128891 125
24 3300005329 Ga0070683_101753209 Ga0070683_1017532091 125
25 3300005329 Ga0070683_102111622 Ga0070683_1021116221 125
26 3300005331 Ga0070670_101560448 Ga0070670_1015604482 125
27 3300005339 Ga0070660_100962150 Ga0070660_1009621501 125
28 3300005343 Ga0070687_101357841 Ga0070687_1013578411 125
29 3300005345 Ga0070692_10685383 Ga0070692_106853831 125
30 3300005347 Ga0070668_100407621 Ga0070668_1004076212 125
31 3300005347 Ga0070668_100423775 Ga0070668_1004237751 125
32 3300005356 Ga0070674_100116921 Ga0070674_1001169214 125
33 3300005438 Ga0070701_10138975 Ga0070701_101389752 125
34 3300005441 Ga0070700_100226687 Ga0070700_1002266873 125
35 3300005441 Ga0070700_100454690 Ga0070700_1004546902 125
36 3300005455 Ga0070663_100749137 Ga0070663_1007491371 125
37 3300005456 Ga0070678_100604851 Ga0070678_1006048511 125
38 3300005459 Ga0068867_100080896 Ga0068867_1000808965 125
39 3300005459 Ga0068867_100327625 Ga0068867_1003276252 125
40 3300005535 Ga0070684_100266731 Ga0070684_1002667314 125
41 3300005543 Ga0070672_100602730 Ga0070672_1006027302 125
42 3300005547 Ga0070693_100352014 Ga0070693_1003520141 125
43 3300005549 Ga0070704_102149916 Ga0070704_1021499161 125
44 3300005564 Ga0070664_100254274 Ga0070664_1002542743 125
45 3300005577 Ga0068857_101211488 Ga0068857_1012114882 125
46 3300005577 Ga0068857_102057118 Ga0068857_1020571182 125
47 3300005578 Ga0068854_100362919 Ga0068854_1003629191 125
48 3300005615 Ga0070702_100447697 Ga0070702_1004476971 125
49 3300005616 Ga0068852_102142732 Ga0068852_1021427321 125
50 3300005718 Ga0068866_10173395 Ga0068866_101733952 125
51 3300005719 Ga0068861_100054801 Ga0068861_1000548014 125
52 3300005841 Ga0068863_101507953 Ga0068863_1015079531 125
53 3300005937 Ga0081455_10384548 Ga0081455_103845482 125
54 3300005981 Ga0081538_10000911 Ga0081538_1000091121 125
55 3300005981 Ga0081538_10050248 Ga0081538_100502485 125
56 3300005981 Ga0081538_10070847 Ga0081538_100708474 125
57 3300005981 Ga0081538_10206796 Ga0081538_102067962 125
58 3300006844 Ga0075428_100250766 Ga0075428_1002507663 125
59 3300006844 Ga0075428_101005401 Ga0075428_1010054012 125
60 3300006844 Ga0075428_101351108 Ga0075428_1013511082 125
61 3300006846 Ga0075430_101090499 Ga0075430_1010904992 125
62 3300006871 Ga0075434_102514363 Ga0075434_1025143632 125
63 3300006880 Ga0075429_101066578 Ga0075429_1010665782 125
64 3300006881 Ga0068865_100131057 Ga0068865_1001310574 125
65 3300006914 Ga0075436_100558353 Ga0075436_1005583532 125
66 3300009094 Ga0111539_10151930 Ga0111539_101519304 125
67 3300009094 Ga0111539_10398637 Ga0111539_103986374 125
68 3300009094 Ga0111539_10601386 Ga0111539_106013861 125
69 3300009094 Ga0111539_11446013 Ga0111539_114460131 125
70 3300009094 Ga0111539_12832063 Ga0111539_128320632 125
71 3300009098 Ga0105245_10546457 Ga0105245_105464572 125
72 3300009147 Ga0114129_10678165 Ga0114129_106781654 125
73 3300009147 Ga0114129_11649704 Ga0114129_116497042 125
74 3300009147 Ga0114129_13357656 Ga0114129_133576561 125
75 3300009148 Ga0105243_10173824 Ga0105243_101738242 125
76 3300009148 Ga0105243_10235811 Ga0105243_102358113 125
77 3300009174 Ga0105241_10757290 Ga0105241_107572902 125
78 3300009176 Ga0105242_10819562 Ga0105242_108195622 125
79 3300009177 Ga0105248_10886089 Ga0105248_108860892 125
80 3300009553 Ga0105249_11394198 Ga0105249_113941982 125
81 3300010375 Ga0105239_10558690 Ga0105239_105586902 125
82 3300013297 Ga0157378_10557926 Ga0157378_105579264 125
83 3300013307 Ga0157372_11282463 Ga0157372_112824632 125
84 3300014325 Ga0163163_10726259 Ga0163163_107262594 125
85 3300014326 Ga0157380_10082651 Ga0157380_100826515 125
86 3300014745 Ga0157377_10473114 Ga0157377_104731141 125
87 3300017792 Ga0163161_10960594 Ga0163161_109605942 125
88 3300025899 Ga0207642_10183911 Ga0207642_101839112 125
89 3300025901 Ga0207688_10016462 Ga0207688_100164625 125
90 3300025907 Ga0207645_10178362 Ga0207645_101783622 125
91 3300025911 Ga0207654_10522744 Ga0207654_105227442 125
92 3300025919 Ga0207657_10977283 Ga0207657_109772831 125
93 3300025926 Ga0207659_10181393 Ga0207659_101813932 125
94 3300025927 Ga0207687_11054372 Ga0207687_110543722 125
95 3300025934 Ga0207686_11081242 Ga0207686_110812421 125
96 3300025935 Ga0207709_10617296 Ga0207709_106172962 125
97 3300025935 Ga0207709_11591762 Ga0207709_115917621 125
98 3300025937 Ga0207669_11477996 Ga0207669_114779962 125
99 3300025938 Ga0207704_10084778 Ga0207704_100847782 125
100 3300025938 Ga0207704_10465026 Ga0207704_104650263 125
101 3300025940 Ga0207691_10361683 Ga0207691_103616832 125
102 3300025940 Ga0207691_11159418 Ga0207691_111594182 125
103 3300025941 Ga0207711_11571142 Ga0207711_115711421 125
104 3300025944 Ga0207661_10274185 Ga0207661_102741852 125
105 3300025944 Ga0207661_10406670 Ga0207661_104066701 125
106 3300025944 Ga0207661_11645930 Ga0207661_116459302 125
107 3300025945 Ga0207679_10214445 Ga0207679_102144452 125
108 3300025961 Ga0207712_10598733 Ga0207712_105987332 125
109 3300025972 Ga0207668_10238897 Ga0207668_102388972 125
110 3300025981 Ga0207640_11491549 Ga0207640_114915492 125
111 3300026067 Ga0207678_10271478 Ga0207678_102714782 125
112 3300026075 Ga0207708_10042073 Ga0207708_100420732 125
113 3300026075 Ga0207708_10587914 Ga0207708_105879141 125
114 3300026089 Ga0207648_10036265 Ga0207648_100362655 125
115 3300026089 Ga0207648_10407882 Ga0207648_104078822 125
116 3300026089 Ga0207648_12112811 Ga0207648_121128112 125
117 3300026095 Ga0207676_10506621 Ga0207676_105066213 125
118 3300026116 Ga0207674_10210618 Ga0207674_102106185 125
119 3300026118 Ga0207675_100013709 Ga0207675_10001370911 125
120 3300026121 Ga0207683_10962727 Ga0207683_109627271 125
121 3300026142 Ga0207698_11022878 Ga0207698_110228782 125
122 3300028380 Ga0268265_11247233 Ga0268265_112472332 125
123 3300031731 Ga0307405_10680151 Ga0307405_106801512 125
124 3300031901 Ga0307406_10955828 Ga0307406_109558281 125
125 3300031903 Ga0307407_10333323 Ga0307407_103333233 125
126 3300032002 Ga0307416_100838450 Ga0307416_1008384503 125
127 3300032002 Ga0307416_100887372 Ga0307416_1008873721 125
128 3300035692 Ga0373935_1208826 Ga0373935_1208826_150_527 125
129 3300037418 Ga0395900_0976426 Ga0395900_0976426_252_629 125
130 3300037471 Ga0395905_1691948 Ga0395905_1691948_12_389 125
131 3300038443 Ga0395901_1306338 Ga0395901_1306338_222_605 125
132 3300039437 Ga0436365_0156240 Ga0436365_0156240_412_789 125
133 3300042008 Ga0439450_015127 Ga0439450_015127_322_699 125
134 3300042012 Ga0439455_0022752 Ga0439455_0022752_892_1269 125
135 3300042118 Ga0450914_002032 Ga0450914_002032_359_736 125
136 3300042157 Ga0439458_0018401 Ga0439458_0018401_735_1112 125
137 3300042439 Ga0439464_0032734 Ga0439464_0032734_147_524 125
138 3300042993 Ga0439440_0052601 Ga0439440_0052601_42_419 125
139 3300044706 Ga0466964_0797177 Ga0466964_0797177_109_486 125
140 3300045976 Ga0466967_0084566 Ga0466967_0084566_53_451 125
141 3300045976 Ga0466967_0232758 Ga0466967_0232758_1096_1494 125
142 3300048913 Ga0496110_0027735 Ga0496110_0027735_93_470 125
143 3300048913 Ga0496110_0874796 Ga0496110_0874796_240_617 125
144 3300048914 Ga0496111_0120812 Ga0496111_0120812_682_1059 125
145 3300048915 Ga0496112_0315883 Ga0496112_0315883_814_1191 125
146 3300048916 Ga0496113_0038070 Ga0496113_0038070_1322_1699 125
147 3300049572 Ga0501036_0100742 Ga0501036_0100742_2052_2429 125
148 3300049573 Ga0501037_0947117 Ga0501037_0947117_102_479 125
149 3300049574 Ga0501038_0223266 Ga0501038_0223266_497_874 125
150 3300049575 Ga0501039_0214830 Ga0501039_0214830_368_745 125
151 3300049576 Ga0501040_0033612 Ga0501040_0033612_714_1091 125
152 3300049576 Ga0501040_0049917 Ga0501040_0049917_985_1362 125
153 3300049577 Ga0501041_0208679 Ga0501041_0208679_289_666 125
154 3300049577 Ga0501041_0246279 Ga0501041_0246279_600_977 125
155 3300049577 Ga0501041_0708650 Ga0501041_0708650_197_574 125
156 3300049578 Ga0501042_0079223 Ga0501042_0079223_1126_1503 125
157 3300049578 Ga0501042_0132081 Ga0501042_0132081_954_1331 125
158 3300049580 Ga0501046_0439147 Ga0501046_0439147_416_793 125
159 3300049582 Ga0501048_0124163 Ga0501048_0124163_332_709 125
160 3300049582 Ga0501048_0750522 Ga0501048_0750522_281_658 125
161 3300049586 Ga0501070_0183992 Ga0501070_0183992_704_1081 125
162 3300049587 Ga0501071_0037038 Ga0501071_0037038_950_1327 125
163 3300049588 Ga0501072_0030644 Ga0501072_0030644_923_1300 125
164 3300049588 Ga0501072_0137341 Ga0501072_0137341_1280_1657 125
165 3300049588 Ga0501072_0531391 Ga0501072_0531391_188_565 125
166 3300049590 Ga0501074_0056730 Ga0501074_0056730_1725_2102 125
167 3300049592 Ga0501076_0040805 Ga0501076_0040805_2620_2997 125
168 3300049592 Ga0501076_0070479 Ga0501076_0070479_1898_2275 125
169 3300049592 Ga0501076_0126107 Ga0501076_0126107_1220_1597 125
170 3300049593 Ga0501077_0083626 Ga0501077_0083626_880_1257 125
171 3300049741 Ga0501079_0109229 Ga0501079_0109229_938_1315 125
172 3300049741 Ga0501079_0441749 Ga0501079_0441749_94_471 125
173 3300049743 Ga0501081_0115555 Ga0501081_0115555_735_1112 125
174 3300049824 Ga0501045_0034679 Ga0501045_0034679_696_1073 125
175 3300050507 nmdc:mga05p37_2179024_c1 nmdc:mga05p37_2179024_c1_39_416 125
176 3300050511 nmdc:mga08y16_1040211_c1 nmdc:mga08y16_1040211_c1_245_628 125
177 3300050511 nmdc:mga08y16_416188_c1 nmdc:mga08y16_416188_c1_358_735 125
178 3300050511 nmdc:mga08y16_64717_c1 nmdc:mga08y16_64717_c1_2213_2590 125
179 3300050512 nmdc:mga0n895_661058_c1 nmdc:mga0n895_661058_c1_129_506 125
180 3300050514 nmdc:mga08x19_948472_c1 nmdc:mga08x19_948472_c1_162_539 125
181 3300053083 Ga0495655_0212473 Ga0495655_0212473_51_428 125
182 3300054114 Ga0501084_0135119 Ga0501084_0135119_1508_1885 125
183 3300054114 Ga0501084_0406640 Ga0501084_0406640_561_938 125
184 3300054114 Ga0501084_0786092 Ga0501084_0786092_324_707 125
185 3300060353 Ga0501082_0127513 Ga0501082_0127513_602_979 125
186 3300060353 Ga0501082_0260148 Ga0501082_0260148_772_1149 125
187 3300060353 Ga0501082_0915131 Ga0501082_0915131_361_738 125
188 3300061734 Ga0530510_0155252 Ga0530510_0155252_544_921 125
189 3300059424 Ga0590075_066676 Ga0590075_066676_304_705 126
190 3300005328 Ga0070676_10316072 Ga0070676_103160721 127
191 3300005330 Ga0070690_100948147 Ga0070690_1009481472 127
192 3300005331 Ga0070670_100534785 Ga0070670_1005347851 127
193 3300005335 Ga0070666_10084695 Ga0070666_100846952 127
194 3300005353 Ga0070669_100893750 Ga0070669_1008937502 127
195 3300005440 Ga0070705_101126233 Ga0070705_1011262331 127
196 3300005459 Ga0068867_100802692 Ga0068867_1008026921 127
197 3300005544 Ga0070686_100060037 Ga0070686_1000600372 127
198 3300006237 Ga0097621_100906459 Ga0097621_1009064592 127
199 3300006844 Ga0075428_100026334 Ga0075428_1000263342 127
200 3300006847 Ga0075431_100810422 Ga0075431_1008104222 127
201 3300006880 Ga0075429_100321361 Ga0075429_1003213612 127
202 3300007076 Ga0075435_101559533 Ga0075435_1015595332 127
203 3300009176 Ga0105242_11270564 Ga0105242_112705642 127
204 3300013307 Ga0157372_10926826 Ga0157372_109268262 127
205 3300014325 Ga0163163_10000097 Ga0163163_1000009737 127
206 3300017792 Ga0163161_11288525 Ga0163161_112885251 127
207 3300025925 Ga0207650_11104035 Ga0207650_111040351 127
208 3300026116 Ga0207674_12089680 Ga0207674_120896801 127
209 3300028556 Ga0265337_1012318 Ga0265337_10123184 127
210 3300028563 Ga0265319_1019490 Ga0265319_10194901 127
211 3300028800 Ga0265338_10002037 Ga0265338_1000203729 127
212 3300028800 Ga0265338_10008664 Ga0265338_100086643 127
213 3300028800 Ga0265338_10052800 Ga0265338_100528003 127
214 3300031241 Ga0265325_10006036 Ga0265325_100060368 127
215 3300031247 Ga0265340_10079607 Ga0265340_100796073 127
216 3300031344 Ga0265316_10040680 Ga0265316_100406804 127
217 3300031344 Ga0265316_10256589 Ga0265316_102565893 127
218 3300031548 Ga0307408_100437083 Ga0307408_1004370832 127
219 3300031595 Ga0265313_10002875 Ga0265313_100028754 127
220 3300031711 Ga0265314_10066079 Ga0265314_100660792 127
221 3300031712 Ga0265342_10012830 Ga0265342_100128307 127
222 3300031731 Ga0307405_10606836 Ga0307405_106068362 127
223 3300031824 Ga0307413_10797287 Ga0307413_107972872 127
224 3300031852 Ga0307410_10080969 Ga0307410_100809692 127
225 3300031852 Ga0307410_10268885 Ga0307410_102688853 127
226 3300031901 Ga0307406_10069295 Ga0307406_100692952 127
227 3300031901 Ga0307406_10259440 Ga0307406_102594403 127
228 3300031903 Ga0307407_10035138 Ga0307407_100351383 127
229 3300032002 Ga0307416_100876942 Ga0307416_1008769422 127
230 3300032002 Ga0307416_101113549 Ga0307416_1011135492 127
231 3300032004 Ga0307414_10671317 Ga0307414_106713172 127
232 3300032005 Ga0307411_10697316 Ga0307411_106973162 127
233 3300032126 Ga0307415_100033496 Ga0307415_1000334962 127
234 3300045976 Ga0466967_0298417 Ga0466967_0298417_150_551 127
235 3300046517 Ga0495630_0053577 Ga0495630_0053577_1827_2210 127
236 3300046529 Ga0495652_0627828 Ga0495652_0627828_44_427 127
237 3300047317 Ga0495604_0966263 Ga0495604_0966263_126_509 127
238 3300047319 Ga0495674_0196032 Ga0495674_0196032_978_1361 127
239 3300047444 Ga0495675_0123488 Ga0495675_0123488_594_977 127
240 3300050508 nmdc:mga09592_334343_c1 nmdc:mga09592_334343_c1_246_635 127
241 3300050513 nmdc:mga0rr50_1384062_c1 nmdc:mga0rr50_1384062_c1_25_408 127
242 3300005937 Ga0081455_10758516 Ga0081455_107585162 128
243 3300049583 Ga0501067_0075782 Ga0501067_0075782_1108_1497 128
244 3300061734 Ga0530510_0194462 Ga0530510_0194462_98_487 128
245 3300026088 Ga0207641_10527633 Ga0207641_105276331 129
246 3300003203 JGI25406J46586_10042086 JGI25406J46586_100420862 132
247 3300005937 Ga0081455_10021112 Ga0081455_100211128 132
248 3300006038 Ga0075365_10949497 Ga0075365_109494972 132
249 3300049572 Ga0501036_0036154 Ga0501036_0036154_999_1400 132
250 3300049574 Ga0501038_0226375 Ga0501038_0226375_173_574 132
251 3300049575 Ga0501039_0037502 Ga0501039_0037502_2632_3033 132
252 3300049576 Ga0501040_0026043 Ga0501040_0026043_2431_2832 132
253 3300049577 Ga0501041_0127534 Ga0501041_0127534_380_781 132
254 3300049578 Ga0501042_0049282 Ga0501042_0049282_2085_2486 132
255 3300049580 Ga0501046_0083568 Ga0501046_0083568_216_617 132
256 3300049582 Ga0501048_0048515 Ga0501048_0048515_41_442 132
257 3300049585 Ga0501069_0289786 Ga0501069_0289786_462_863 132
258 3300049588 Ga0501072_0035844 Ga0501072_0035844_2179_2580 132
259 3300049590 Ga0501074_0416701 Ga0501074_0416701_516_917 132
260 3300049591 Ga0501075_0016164 Ga0501075_0016164_2111_2512 132
261 3300049593 Ga0501077_0298920 Ga0501077_0298920_34_435 132
262 3300049741 Ga0501079_0052337 Ga0501079_0052337_1061_1462 132
263 3300049743 Ga0501081_0015096 Ga0501081_0015096_1979_2380 132
264 3300049744 Ga0501083_0049382 Ga0501083_0049382_714_1115 132
265 3300049824 Ga0501045_0028886 Ga0501045_0028886_2664_3065 132
266 3300050491 nmdc:mga00v17_326178_c1 nmdc:mga00v17_326178_c1_445_846 132
267 3300053102 Ga0500554_085618 Ga0500554_085618_147_548 132
268 3300054114 Ga0501084_0083975 Ga0501084_0083975_650_1051 132
269 3300060353 Ga0501082_0426284 Ga0501082_0426284_703_1104 132
270 3300061734 Ga0530510_0060607 Ga0530510_0060607_1875_2276 132
271 3300003203 JGI25406J46586_10035102 JGI25406J46586_100351022 135
272 3300005985 Ga0081539_10007063 Ga0081539_1000706310 135
273 3300013308 Ga0157375_10000131 Ga0157375_100001319 135
274 3300025903 Ga0207680_10086973 Ga0207680_100869734 135
275 3300049823 Ga0501044_1306365 Ga0501044_1306365_62_514 135
276 3300050509 nmdc:mga0qj67_1083999_c1 nmdc:mga0qj67_1083999_c1_122_577 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09969

DUF2203

Uncharacterized conserved protein (DUF2203)

29

149

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wwf-assembly2.cif.gz_B-2 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.7915 24 84
3zg1-assembly2.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7711 24 84
2y3g-assembly2.cif.gz_B se-met form of cupriavidus metallidurans ch34 cnrxs 0.7085 19 84
4wwf-assembly1.cif.gz_A-3 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.6723 24 84
6dzi-assembly1.cif.gz_Z error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6004 17 85
ID Description Score Start End Superfamily
2y3gC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7579 24 84 1.20.120.1490
2y3gD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7441 24 84 1.20.120.1490
af_I1JQF2_223_528_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7368 26 85 1.25.10.10
af_O16302_1494_1725_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7098 96 122 2.130.10.10
2y3gB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7085 19 84 1.20.120.1490
ID Description Score Start End GO Terms
AF-A0A535X6M4-F1-model_v4 DUF2203 family protein 0.9691 80 135
AF-X0Y410-F1-model_v4 DUF2203 domain-containing protein 0.9685 69 135
AF-A0A2V8YA97-F1-model_v4 DUF2203 domain-containing protein 0.9671 88 135
AF-A0A3N5Q7P6-F1-model_v4 DUF2203 family protein 0.9656 95 135
AF-T0ZGZ5-F1-model_v4 DUF2203 domain-containing protein 0.9647 65 134

Feature Viewer

pLDDT pTM Quality
85.32 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map