F381262

General Info

Members Datasets Scaffolds Average Seq Length
276 185 552 148

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1268846|Ga0436360_1268846_202_684
Length 147
Sequence VTEKKGTLTREQQESDVRPHQPGQAAFRSILPEDIQWKPFSAFPPSVRLAVVVGEPTAPGPYVIRVKVPSGVKLMPHTHPEDRVYTVISGVFYIGLGAQFDPGKLQAAHYHWAKSGEYITQVTAIGPLALEYLNANDDPRNNNYGIS

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.36
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0.36
Rhizoplane 11.96
Rhizosphere 80.07
Stem 0
Stem Tuber 0
Unclassified 17.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_1268846 3300039438 Unclassified 841
2 JGI24739J22299_10122487 3300001989 Bacteria 776
3 JGI24737J22298_10111479 3300001990 Bacteria 809
4 JGI25159J45721_1032946 3300002987 Unclassified 814
5 rootL2_10238877 3300003322 Unclassified 3769
6 Ga0055536_1031795 3300003781 Bacteria 1376
7 Ga0065707_10744322 3300005295 Bacteria 621
8 Ga0070683_100430499 3300005329 Bacteria 1259
9 Ga0070683_100804545 3300005329 Unclassified 901
10 Ga0070690_100027962 3300005330 Bacteria 3490
11 Ga0070670_100562111 3300005331 Bacteria 1018
12 Ga0068869_100298267 3300005334 Bacteria 1301
13 Ga0070666_10096192 3300005335 Bacteria 2038
14 Ga0070682_101934736 3300005337 Bacteria 517
15 Ga0068868_100050188 3300005338 Bacteria 3276
16 Ga0068868_100378617 3300005338 Bacteria 1217
17 Ga0068868_100517947 3300005338 Bacteria 1047
18 Ga0068868_102001508 3300005338 Bacteria 550
19 Ga0070689_100607524 3300005340 Bacteria 948
20 Ga0070691_10396065 3300005341 Bacteria 777
21 Ga0070687_100555799 3300005343 Bacteria 782
22 Ga0070661_100562128 3300005344 Unclassified 919
23 Ga0070661_100767674 3300005344 Unclassified 789
24 Ga0070692_10040034 3300005345 Bacteria 2395
25 Ga0070668_100211504 3300005347 Bacteria 1596
26 Ga0070675_100527289 3300005354 Unclassified 1066
27 Ga0070675_101001214 3300005354 Bacteria 767
28 Ga0070671_100329112 3300005355 Bacteria 1302
29 Ga0070674_100070814 3300005356 Bacteria 2465
30 Ga0070673_100591696 3300005364 Bacteria 1011
31 Ga0070688_100088619 3300005365 Bacteria 2018
32 Ga0070688_100678865 3300005365 Unclassified 796
33 Ga0070659_100063841 3300005366 Bacteria 2914
34 Ga0070659_100375847 3300005366 Bacteria 1196
35 Ga0070667_100501136 3300005367 Bacteria 1113
36 Ga0070703_10342717 3300005406 Bacteria 635
37 Ga0070714_100600654 3300005435 Bacteria 1057
38 Ga0070714_101035882 3300005435 Bacteria 799
39 Ga0070714_101733608 3300005435 Bacteria 610
40 Ga0070713_100938278 3300005436 Bacteria 833
41 Ga0070701_10020856 3300005438 Bacteria 3118
42 Ga0070711_100323634 3300005439 Bacteria 1232
43 Ga0070705_100186879 3300005440 Unclassified 1408
44 Ga0070705_100277049 3300005440 Bacteria 1191
45 Ga0070708_100441512 3300005445 Bacteria 1227
46 Ga0070663_100156895 3300005455 Bacteria 1749
47 Ga0070663_100781122 3300005455 Bacteria 818
48 Ga0070663_101585411 3300005455 Unclassified 583
49 Ga0070678_100121691 3300005456 Bacteria 2059
50 Ga0070678_102267666 3300005456 Bacteria 515
51 Ga0070685_10005596 3300005466 Bacteria 6375
52 Ga0070698_101303242 3300005471 Unclassified 676
53 Ga0070699_100525980 3300005518 Unclassified 1075
54 Ga0070699_100945795 3300005518 Unclassified 790
55 Ga0070684_100025316 3300005535 Bacteria 4987
56 Ga0070684_100806329 3300005535 Unclassified 878
57 Ga0070684_101078832 3300005535 Bacteria 754
58 Ga0070697_100110906 3300005536 Unclassified 2286
59 Ga0070697_100518888 3300005536 Unclassified 1043
60 Ga0068853_100363836 3300005539 Bacteria 1348
61 Ga0070665_100577898 3300005548 Bacteria 1136
62 Ga0070665_100786269 3300005548 Bacteria 965
63 Ga0070704_100067014 3300005549 Bacteria 2591
64 Ga0068855_101064275 3300005563 Bacteria 847
65 Ga0070664_100283914 3300005564 Unclassified 1493
66 Ga0068857_100357642 3300005577 Bacteria 1353
67 Ga0068854_100470133 3300005578 Bacteria 1054
68 Ga0068856_100182125 3300005614 Bacteria 2114
69 Ga0068856_100230380 3300005614 Bacteria 1868
70 Ga0070702_100001390 3300005615 Bacteria 9895
71 Ga0068852_100081754 3300005616 Bacteria 2869
72 Ga0068859_100010188 3300005617 Bacteria 9461
73 Ga0068859_100051160 3300005617 Bacteria 4151
74 Ga0068864_100008606 3300005618 Bacteria 8422
75 Ga0068864_100119746 3300005618 Bacteria 2352
76 Ga0068866_10008974 3300005718 Bacteria 4234
77 Ga0068861_100033661 3300005719 Bacteria 3783
78 Ga0068861_101109700 3300005719 Bacteria 761
79 Ga0068851_10463972 3300005834 Bacteria 754
80 Ga0068863_100169133 3300005841 Bacteria 2096
81 Ga0068863_101208073 3300005841 Unclassified 762
82 Ga0068858_100112017 3300005842 Bacteria 2548
83 Ga0068858_100129996 3300005842 Bacteria 2360
84 Ga0068858_100491216 3300005842 Bacteria 1185
85 Ga0068860_100295923 3300005843 Bacteria 1585
86 Ga0068860_100956749 3300005843 Bacteria 873
87 Ga0068862_100022061 3300005844 Bacteria 5326
88 Ga0068862_100443833 3300005844 Bacteria 1222
89 Ga0070717_10188812 3300006028 Bacteria 1800
90 Ga0070717_10649963 3300006028 Bacteria 957
91 Ga0075363_100937434 3300006048 Bacteria 531
92 Ga0070715_10141032 3300006163 Bacteria 1171
93 Ga0070716_100726720 3300006173 Bacteria 761
94 Ga0097621_100028918 3300006237 Bacteria 4373
95 Ga0097621_102189161 3300006237 Bacteria 529
96 Ga0068871_100288746 3300006358 Bacteria 1437
97 Ga0068871_100410201 3300006358 Bacteria 1208
98 Ga0068871_101027556 3300006358 Unclassified 768
99 Ga0075430_100032285 3300006846 Bacteria 4445
100 Ga0075431_100152712 3300006847 Bacteria 2377
101 Ga0075434_100245456 3300006871 Bacteria 1810
102 Ga0075434_100645987 3300006871 Bacteria 1076
103 Ga0075429_100686034 3300006880 Bacteria 897
104 Ga0068865_100509675 3300006881 Bacteria 1004
105 Ga0075436_101231869 3300006914 Bacteria 565
106 Ga0097620_100010188 3300006931 Bacteria 9461
107 Ga0097620_100051156 3300006931 Bacteria 4151
108 Ga0075435_100063080 3300007076 Bacteria 3009
109 Ga0099794_10318428 3300007265 Unclassified 807
110 Ga0105240_10119127 3300009093 Bacteria 3180
111 Ga0105240_10490494 3300009093 Unclassified 1368
112 Ga0111539_11004446 3300009094 Bacteria 970
113 Ga0105245_10310191 3300009098 Bacteria 1551
114 Ga0105245_10667737 3300009098 Bacteria 1070
115 Ga0105247_10020734 3300009101 Bacteria 3952
116 Ga0114129_10733916 3300009147 Bacteria 1266
117 Ga0105243_10036279 3300009148 Bacteria 3826
118 Ga0105243_11983157 3300009148 Bacteria 616
119 Ga0105241_10197010 3300009174 Bacteria 1680
120 Ga0105241_10365129 3300009174 Bacteria 1257
121 Ga0105241_11090262 3300009174 Bacteria 751
122 Ga0105242_10114265 3300009176 Bacteria 2306
123 Ga0105242_11545991 3300009176 Unclassified 695
124 Ga0105248_11762457 3300009177 Unclassified 702
125 Ga0105237_10541530 3300009545 Bacteria 1171
126 Ga0105237_11526023 3300009545 Bacteria 675
127 Ga0105238_10044526 3300009551 Bacteria 4486
128 Ga0105238_10218045 3300009551 Bacteria 1884
129 Ga0105239_10082954 3300010375 Bacteria 3530
130 Ga0105239_10105251 3300010375 Bacteria 3125
131 Ga0105239_11023092 3300010375 Bacteria 950
132 Ga0105246_10039511 3300011119 Bacteria 3179
133 Ga0105246_11015741 3300011119 Bacteria 752
134 Ga0157371_11234946 3300013102 Bacteria 577
135 Ga0157374_10008685 3300013296 Bacteria 8689
136 Ga0157374_10198586 3300013296 Bacteria 1963
137 Ga0157374_10236365 3300013296 Bacteria 1796
138 Ga0157374_10325944 3300013296 Bacteria 1523
139 Ga0157374_11009600 3300013296 Unclassified 851
140 Ga0157378_10109106 3300013297 Bacteria 2535
141 Ga0157378_10841155 3300013297 Bacteria 945
142 Ga0163162_10001399 3300013306 Bacteria 22452
143 Ga0163162_10031998 3300013306 Bacteria 5221
144 Ga0163162_11123886 3300013306 Bacteria 890
145 Ga0163162_11304688 3300013306 Unclassified 825
146 Ga0157372_10258807 3300013307 Bacteria 2021
147 Ga0157372_10845186 3300013307 Unclassified 1063
148 Ga0157375_10024299 3300013308 Bacteria 5606
149 Ga0163163_10280178 3300014325 Bacteria 1719
150 Ga0163163_10439044 3300014325 Bacteria 1365
151 Ga0157380_10151821 3300014326 Bacteria 2003
152 Ga0157380_10470564 3300014326 Bacteria 1212
153 Ga0157377_10238415 3300014745 Bacteria 1173
154 Ga0157377_10413755 3300014745 Unclassified 921
155 Ga0157379_10028500 3300014968 Bacteria 4966
156 Ga0157379_10197543 3300014968 Bacteria 1818
157 Ga0157379_10949672 3300014968 Unclassified 818
158 Ga0157376_10558757 3300014969 Bacteria 1133
159 Ga0213872_10115081 3300021361 Unclassified 1192
160 Ga0213875_10003354 3300021388 Bacteria 9135
161 Ga0213871_10000001 3300021441 Bacteria 27505
162 Ga0224572_1004735 3300024225 Bacteria 2390
163 Ga0209233_1024240 3300025261 Unclassified 1521
164 Ga0209673_1019602 3300025273 Bacteria 2423
165 Ga0209130_1005451 3300025284 Bacteria 4403
166 Ga0209675_1015196 3300025291 Bacteria 2300
167 Ga0209676_1007216 3300025292 Bacteria 5288
168 Ga0209051_1031933 3300025303 Bacteria 2017
169 Ga0209257_1023609 3300025304 Bacteria 2156
170 Ga0207653_10012444 3300025885 Unclassified 2656
171 Ga0207647_10140664 3300025904 Bacteria 1414
172 Ga0207654_10016066 3300025911 Bacteria 3893
173 Ga0207654_10756631 3300025911 Unclassified 700
174 Ga0207663_10013895 3300025916 Bacteria 4392
175 Ga0207663_10291512 3300025916 Bacteria 1216
176 Ga0207687_10730314 3300025927 Bacteria 842
177 Ga0207700_10321102 3300025928 Bacteria 1342
178 Ga0207700_10844247 3300025928 Bacteria 819
179 Ga0207686_10534356 3300025934 Bacteria 914
180 Ga0207709_10917760 3300025935 Bacteria 712
181 Ga0207665_10622706 3300025939 Unclassified 844
182 Ga0207665_10681851 3300025939 Bacteria 807
183 Ga0207689_10062719 3300025942 Bacteria 3057
184 Ga0207679_10131013 3300025945 Bacteria 2012
185 Ga0207667_11155248 3300025949 Unclassified 755
186 Ga0207668_10153838 3300025972 Bacteria 1784
187 Ga0207703_10038335 3300026035 Bacteria 3823
188 Ga0207703_11150582 3300026035 Unclassified 746
189 Ga0207678_10176663 3300026067 Bacteria 1823
190 Ga0207702_10240928 3300026078 Bacteria 1694
191 Ga0207702_11189183 3300026078 Bacteria 757
192 Ga0207641_10280356 3300026088 Bacteria 1567
193 Ga0207676_10015833 3300026095 Bacteria 5453
194 Ga0207676_10065893 3300026095 Bacteria 2886
195 Ga0207674_10278250 3300026116 Bacteria 1621
196 Ga0207675_100083076 3300026118 Bacteria 3004
197 Ga0207683_10020934 3300026121 Bacteria 5598
198 Ga0268266_10042551 3300028379 Bacteria 3880
199 Ga0268266_10255888 3300028379 Bacteria 1621
200 Ga0268266_11253929 3300028379 Bacteria 716
201 Ga0268266_11310052 3300028379 Bacteria 700
202 Ga0268265_10550242 3300028380 Bacteria 1095
203 Ga0265765_1018921 3300030879 Bacteria 821
204 Ga0316212_1012566 3300033547 Bacteria 1205
205 Ga0373956_0174918 3300035119 Bacteria 1014
206 Ga0373925_0789660 3300037068 Bacteria 783
207 Ga0395905_0258154 3300037471 Bacteria 1627
208 Ga0395905_0285545 3300037471 Bacteria 1537
209 Ga0436364_0832780 3300037853 Bacteria 8142
210 Ga0436365_0837646 3300039437 Bacteria 24635
211 Ga0436360_0339996 3300039438 Bacteria 29371
212 Ga0436361_1034145 3300039447 Bacteria 4840
213 Ga0436363_0445653 3300039450 Bacteria 1958
214 Ga0436362_0550118 3300039453 Bacteria 916
215 Ga0436362_0635236 3300039453 Bacteria 10718
216 Ga0453684_0488273 3300044712 Bacteria 1366
217 Ga0451576_0393558 3300045051 Bacteria 1453
218 Ga0495629_0805009 3300046459 Bacteria 620
219 Ga0495580_0000033 3300046472 Bacteria 75375
220 Ga0495580_0925454 3300046472 Unclassified 559
221 Ga0495645_0204712 3300046543 Unclassified 1336
222 Ga0495667_0000597 3300046559 Bacteria 22980
223 Ga0495669_0151047 3300046684 Unclassified 1099
224 Ga0495600_0015160 3300046809 Bacteria 4870
225 Ga0495680_0002660 3300047322 Bacteria 18089
226 Ga0495675_0115930 3300047444 Bacteria 1670
227 Ga0496100_0042993 3300048903 Bacteria 2888
228 Ga0496100_0126544 3300048903 Unclassified 1794
229 Ga0496101_0078294 3300048904 Bacteria 2438
230 Ga0496101_0218565 3300048904 Bacteria 1478
231 Ga0496102_0077898 3300048905 Bacteria 3051
232 Ga0496102_0609314 3300048905 Unclassified 1015
233 Ga0496103_0098292 3300048906 Bacteria 1851
234 Ga0496103_0437509 3300048906 Unclassified 839
235 Ga0496104_0091426 3300048907 Unclassified 2909
236 Ga0496104_0498121 3300048907 Bacteria 1129
237 Ga0496104_0960367 3300048907 Unclassified 759
238 Ga0496105_0285012 3300048908 Bacteria 1331
239 Ga0496105_0909676 3300048908 Unclassified 663
240 Ga0496106_0034207 3300048909 Bacteria 3795
241 Ga0496107_0015529 3300048910 Bacteria 5339
242 Ga0496107_0025395 3300048910 Bacteria 4195
243 Ga0496108_0095245 3300048911 Bacteria 2534
244 Ga0496109_0052429 3300048912 Unclassified 3718
245 Ga0496109_0083288 3300048912 Bacteria 2949
246 Ga0496109_0141940 3300048912 Bacteria 2246
247 Ga0496109_0232168 3300048912 Bacteria 1736
248 Ga0496110_0033539 3300048913 Bacteria 4441
249 Ga0496110_0740918 3300048913 Bacteria 885
250 Ga0496111_0200483 3300048914 Bacteria 1484
251 Ga0496111_0322383 3300048914 Bacteria 1144
252 Ga0496112_0006229 3300048915 Bacteria 10450
253 Ga0496112_0025424 3300048915 Bacteria 5686
254 Ga0496112_0157171 3300048915 Bacteria 2240
255 Ga0496113_0042786 3300048916 Bacteria 3348
256 Ga0496113_0109909 3300048916 Bacteria 2144
257 Ga0496114_0058588 3300048917 Bacteria 3216
258 Ga0496115_0053253 3300048918 Bacteria 3247
259 Ga0496115_0068373 3300048918 Bacteria 2876
260 Ga0496119_0101931 3300048922 Bacteria 1610
261 Ga0496122_0013403 3300048925 Bacteria 8028
262 Ga0496123_0011515 3300048926 Bacteria 7662
263 nmdc:mga03n38_861302_c1 3300050490 Bacteria 530
264 nmdc:mga05p37_102114_c1 3300050507 Unclassified 3532
265 nmdc:mga09592_5721_c1 3300050508 Bacteria 10140
266 nmdc:mga0qj67_4430_c1 3300050509 Bacteria 10173
267 nmdc:mga06r32_13573_c1 3300050510 Bacteria 7385
268 nmdc:mga08y16_1347759_c1 3300050511 Bacteria 679
269 nmdc:mga08y16_475659_c1 3300050511 Bacteria 1272
270 nmdc:mga0n895_198472_c1 3300050512 Unclassified 2038
271 nmdc:mga0rr50_164567_c1 3300050513 Unclassified 1803
272 nmdc:mga08x19_37960_c1 3300050514 Bacteria 3059
273 nmdc:mga0a205_129547_c1 3300050515 Bacteria 2424
274 Ga0495619_0698503 3300053085 Bacteria 690
275 Ga0500641_0039460 3300053096 Bacteria 1902
276 2617378351 2617270741 Bacteria 8201522
277 Ga0436360_1268846
278 JGI24739J22299_10122487
279 JGI24737J22298_10111479
280 JGI25159J45721_1032946
281 rootL2_10238877
282 Ga0055536_1031795
283 Ga0065707_10744322
284 Ga0070683_100430499
285 Ga0070683_100804545
286 Ga0070690_100027962
287 Ga0070670_100562111
288 Ga0068869_100298267
289 Ga0070666_10096192
290 Ga0070682_101934736
291 Ga0068868_100050188
292 Ga0068868_100378617
293 Ga0068868_100517947
294 Ga0068868_102001508
295 Ga0070689_100607524
296 Ga0070691_10396065
297 Ga0070687_100555799
298 Ga0070661_100562128
299 Ga0070661_100767674
300 Ga0070692_10040034
301 Ga0070668_100211504
302 Ga0070675_100527289
303 Ga0070675_101001214
304 Ga0070671_100329112
305 Ga0070674_100070814
306 Ga0070673_100591696
307 Ga0070688_100088619
308 Ga0070688_100678865
309 Ga0070659_100063841
310 Ga0070659_100375847
311 Ga0070667_100501136
312 Ga0070703_10342717
313 Ga0070714_100600654
314 Ga0070714_101035882
315 Ga0070714_101733608
316 Ga0070713_100938278
317 Ga0070701_10020856
318 Ga0070711_100323634
319 Ga0070705_100186879
320 Ga0070705_100277049
321 Ga0070708_100441512
322 Ga0070663_100156895
323 Ga0070663_100781122
324 Ga0070663_101585411
325 Ga0070678_100121691
326 Ga0070678_102267666
327 Ga0070685_10005596
328 Ga0070698_101303242
329 Ga0070699_100525980
330 Ga0070699_100945795
331 Ga0070684_100025316
332 Ga0070684_100806329
333 Ga0070684_101078832
334 Ga0070697_100110906
335 Ga0070697_100518888
336 Ga0068853_100363836
337 Ga0070665_100577898
338 Ga0070665_100786269
339 Ga0070704_100067014
340 Ga0068855_101064275
341 Ga0070664_100283914
342 Ga0068857_100357642
343 Ga0068854_100470133
344 Ga0068856_100182125
345 Ga0068856_100230380
346 Ga0070702_100001390
347 Ga0068852_100081754
348 Ga0068859_100010188
349 Ga0068859_100051160
350 Ga0068864_100008606
351 Ga0068864_100119746
352 Ga0068866_10008974
353 Ga0068861_100033661
354 Ga0068861_101109700
355 Ga0068851_10463972
356 Ga0068863_100169133
357 Ga0068863_101208073
358 Ga0068858_100112017
359 Ga0068858_100129996
360 Ga0068858_100491216
361 Ga0068860_100295923
362 Ga0068860_100956749
363 Ga0068862_100022061
364 Ga0068862_100443833
365 Ga0070717_10188812
366 Ga0070717_10649963
367 Ga0075363_100937434
368 Ga0070715_10141032
369 Ga0070716_100726720
370 Ga0097621_100028918
371 Ga0097621_102189161
372 Ga0068871_100288746
373 Ga0068871_100410201
374 Ga0068871_101027556
375 Ga0075430_100032285
376 Ga0075431_100152712
377 Ga0075434_100245456
378 Ga0075434_100645987
379 Ga0075429_100686034
380 Ga0068865_100509675
381 Ga0075436_101231869
382 Ga0097620_100010188
383 Ga0097620_100051156
384 Ga0075435_100063080
385 Ga0099794_10318428
386 Ga0105240_10119127
387 Ga0105240_10490494
388 Ga0111539_11004446
389 Ga0105245_10310191
390 Ga0105245_10667737
391 Ga0105247_10020734
392 Ga0114129_10733916
393 Ga0105243_10036279
394 Ga0105243_11983157
395 Ga0105241_10197010
396 Ga0105241_10365129
397 Ga0105241_11090262
398 Ga0105242_10114265
399 Ga0105242_11545991
400 Ga0105248_11762457
401 Ga0105237_10541530
402 Ga0105237_11526023
403 Ga0105238_10044526
404 Ga0105238_10218045
405 Ga0105239_10082954
406 Ga0105239_10105251
407 Ga0105239_11023092
408 Ga0105246_10039511
409 Ga0105246_11015741
410 Ga0157371_11234946
411 Ga0157374_10008685
412 Ga0157374_10198586
413 Ga0157374_10236365
414 Ga0157374_10325944
415 Ga0157374_11009600
416 Ga0157378_10109106
417 Ga0157378_10841155
418 Ga0163162_10001399
419 Ga0163162_10031998
420 Ga0163162_11123886
421 Ga0163162_11304688
422 Ga0157372_10258807
423 Ga0157372_10845186
424 Ga0157375_10024299
425 Ga0163163_10280178
426 Ga0163163_10439044
427 Ga0157380_10151821
428 Ga0157380_10470564
429 Ga0157377_10238415
430 Ga0157377_10413755
431 Ga0157379_10028500
432 Ga0157379_10197543
433 Ga0157379_10949672
434 Ga0157376_10558757
435 Ga0213872_10115081
436 Ga0213875_10003354
437 Ga0213871_10000001
438 Ga0224572_1004735
439 Ga0209233_1024240
440 Ga0209673_1019602
441 Ga0209130_1005451
442 Ga0209675_1015196
443 Ga0209676_1007216
444 Ga0209051_1031933
445 Ga0209257_1023609
446 Ga0207653_10012444
447 Ga0207647_10140664
448 Ga0207654_10016066
449 Ga0207654_10756631
450 Ga0207663_10013895
451 Ga0207663_10291512
452 Ga0207687_10730314
453 Ga0207700_10321102
454 Ga0207700_10844247
455 Ga0207686_10534356
456 Ga0207709_10917760
457 Ga0207665_10622706
458 Ga0207665_10681851
459 Ga0207689_10062719
460 Ga0207679_10131013
461 Ga0207667_11155248
462 Ga0207668_10153838
463 Ga0207703_10038335
464 Ga0207703_11150582
465 Ga0207678_10176663
466 Ga0207702_10240928
467 Ga0207702_11189183
468 Ga0207641_10280356
469 Ga0207676_10015833
470 Ga0207676_10065893
471 Ga0207674_10278250
472 Ga0207675_100083076
473 Ga0207683_10020934
474 Ga0268266_10042551
475 Ga0268266_10255888
476 Ga0268266_11253929
477 Ga0268266_11310052
478 Ga0268265_10550242
479 Ga0265765_1018921
480 Ga0316212_1012566
481 Ga0373956_0174918
482 Ga0373925_0789660
483 Ga0395905_0258154
484 Ga0395905_0285545
485 Ga0436364_0832780
486 Ga0436365_0837646
487 Ga0436360_0339996
488 Ga0436361_1034145
489 Ga0436363_0445653
490 Ga0436362_0550118
491 Ga0436362_0635236
492 Ga0453684_0488273
493 Ga0451576_0393558
494 Ga0495629_0805009
495 Ga0495580_0000033
496 Ga0495580_0925454
497 Ga0495645_0204712
498 Ga0495667_0000597
499 Ga0495669_0151047
500 Ga0495600_0015160
501 Ga0495680_0002660
502 Ga0495675_0115930
503 Ga0496100_0042993
504 Ga0496100_0126544
505 Ga0496101_0078294
506 Ga0496101_0218565
507 Ga0496102_0077898
508 Ga0496102_0609314
509 Ga0496103_0098292
510 Ga0496103_0437509
511 Ga0496104_0091426
512 Ga0496104_0498121
513 Ga0496104_0960367
514 Ga0496105_0285012
515 Ga0496105_0909676
516 Ga0496106_0034207
517 Ga0496107_0015529
518 Ga0496107_0025395
519 Ga0496108_0095245
520 Ga0496109_0052429
521 Ga0496109_0083288
522 Ga0496109_0141940
523 Ga0496109_0232168
524 Ga0496110_0033539
525 Ga0496110_0740918
526 Ga0496111_0200483
527 Ga0496111_0322383
528 Ga0496112_0006229
529 Ga0496112_0025424
530 Ga0496112_0157171
531 Ga0496113_0042786
532 Ga0496113_0109909
533 Ga0496114_0058588
534 Ga0496115_0053253
535 Ga0496115_0068373
536 Ga0496119_0101931
537 Ga0496122_0013403
538 Ga0496123_0011515
539 nmdc:mga03n38_861302_c1
540 nmdc:mga05p37_102114_c1
541 nmdc:mga09592_5721_c1
542 nmdc:mga0qj67_4430_c1
543 nmdc:mga06r32_13573_c1
544 nmdc:mga08y16_1347759_c1
545 nmdc:mga08y16_475659_c1
546 nmdc:mga0n895_198472_c1
547 nmdc:mga0rr50_164567_c1
548 nmdc:mga08x19_37960_c1
549 nmdc:mga0a205_129547_c1
550 Ga0495619_0698503
551 Ga0500641_0039460
552 2617378351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.9007 47 123
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.9001 31 123
6m9r-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.8994 47 123
6m9r-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.8991 47 123
6m9s-assembly1.cif.gz_A crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8989 47 123
ID Description Score Start End Superfamily
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8905 29 129 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8861 46 124 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8798 45 122 2.60.120.10
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.861 44 123 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8415 15 123 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0N0LK12-F1-model_v4 Cupin 0.9841 13 139
AF-A0A0Q7ZZ10-F1-model_v4 Cupin 0.9827 10 138
AF-A0A2V7QJV1-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9824 34 141
AF-A0A527HI71-F1-model_v4 Cupin domain-containing protein 0.9817 10 137
AF-A0A5J6MMJ0-F1-model_v4 Cupin 0.9799 10 137

Map