F381187

General Info

Members Datasets Scaffolds Average Seq Length
276 177 552 139

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1000579|Ga0265337_100057925
Length 165
Sequence VKICEIRVKQSKSIHVIEFSGAYCKTTGVMRILALDHGTKRIGVAVSDETKTIAQPLEFIPPEPFAGFLDRLKQLIREKEVELILIGLPRNMDGSYGPAAEKVQTFVSVLANAITIPIKTWDERLTSAQANRVLIQGGARRDKRKQKVDQMAAAILLQSYLDGKT

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
177 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 1.45
Rhizosphere 97.46
Stem 0
Stem Tuber 0
Unclassified 27.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1000579 3300028556 Bacteria 19233
2 MRS1b_contig_8340328 2162886011 Unclassified 1421
3 Ga0065712_10136114 3300005290 Bacteria 1496
4 Ga0065707_10439380 3300005295 Bacteria 812
5 Ga0070690_100596060 3300005330 Bacteria 838
6 Ga0070666_10031007 3300005335 Bacteria 3527
7 Ga0070680_100163748 3300005336 Unclassified 1869
8 Ga0070689_100008588 3300005340 Bacteria 7201
9 Ga0070689_100546858 3300005340 Bacteria 997
10 Ga0070687_100170375 3300005343 Bacteria 1295
11 Ga0070687_100207440 3300005343 Bacteria 1191
12 Ga0070668_101663231 3300005347 Unclassified 586
13 Ga0070671_100760697 3300005355 Bacteria 842
14 Ga0070688_100004644 3300005365 Bacteria 7166
15 Ga0070688_101260769 3300005365 Bacteria 595
16 Ga0070713_100048667 3300005436 Bacteria 3492
17 Ga0070713_100133165 3300005436 Unclassified 2194
18 Ga0070700_100020196 3300005441 Bacteria 3855
19 Ga0070700_100223634 3300005441 Unclassified 1335
20 Ga0070700_100284418 3300005441 Unclassified 1200
21 Ga0070694_100025754 3300005444 Bacteria 3807
22 Ga0070681_10452269 3300005458 Bacteria 1196
23 Ga0068867_101382039 3300005459 Unclassified 652
24 Ga0070685_10037333 3300005466 Unclassified 2751
25 Ga0070685_10760733 3300005466 Unclassified 711
26 Ga0070707_100511920 3300005468 Bacteria 1162
27 Ga0070699_100406137 3300005518 Bacteria 1232
28 Ga0070679_100033318 3300005530 Bacteria 5101
29 Ga0070684_100996616 3300005535 Unclassified 786
30 Ga0070684_101641813 3300005535 Unclassified 606
31 Ga0070686_100005727 3300005544 Bacteria 6886
32 Ga0070686_100277580 3300005544 Bacteria 1234
33 Ga0070665_101489937 3300005548 Unclassified 685
34 Ga0070704_100018320 3300005549 Bacteria 4475
35 Ga0070704_100095148 3300005549 Bacteria 2230
36 Ga0068855_100069607 3300005563 Bacteria 4095
37 Ga0068855_100102242 3300005563 Bacteria 3298
38 Ga0068857_100165015 3300005577 Bacteria 2011
39 Ga0068859_100320159 3300005617 Unclassified 1645
40 Ga0068859_100919412 3300005617 Bacteria 959
41 Ga0068864_100070532 3300005618 Bacteria 3041
42 Ga0068870_10068767 3300005840 Bacteria 1925
43 Ga0068863_100206274 3300005841 Bacteria 1892
44 Ga0068863_100527727 3300005841 Unclassified 1164
45 Ga0068858_101920980 3300005842 Unclassified 585
46 Ga0070715_10396099 3300006163 Bacteria 766
47 Ga0070716_100061384 3300006173 Bacteria 2175
48 Ga0070712_100427919 3300006175 Bacteria 1098
49 Ga0097621_100840466 3300006237 Bacteria 852
50 Ga0075428_100128118 3300006844 Bacteria 2761
51 Ga0075428_101610337 3300006844 Unclassified 679
52 Ga0075430_100251900 3300006846 Bacteria 1463
53 Ga0075431_100286980 3300006847 Bacteria 1666
54 Ga0075433_10662238 3300006852 Bacteria 915
55 Ga0075429_100091295 3300006880 Bacteria 2657
56 Ga0097620_100320140 3300006931 Unclassified 1645
57 Ga0097620_100919318 3300006931 Bacteria 959
58 Ga0075435_100930520 3300007076 Bacteria 758
59 Ga0075435_101398232 3300007076 Bacteria 613
60 Ga0099794_10176012 3300007265 Bacteria 1091
61 Ga0105240_10016892 3300009093 Bacteria 9864
62 Ga0105240_10288598 3300009093 Bacteria 1882
63 Ga0105240_10958905 3300009093 Unclassified 917
64 Ga0111539_10041504 3300009094 Bacteria 5531
65 Ga0111539_10174221 3300009094 Bacteria 2513
66 Ga0111539_10481413 3300009094 Bacteria 1446
67 Ga0111539_10951396 3300009094 Unclassified 999
68 Ga0105245_11877720 3300009098 Unclassified 652
69 Ga0114129_10371152 3300009147 Bacteria 1891
70 Ga0105242_10465123 3300009176 Unclassified 1195
71 Ga0105248_11822439 3300009177 Unclassified 690
72 Ga0105248_12258797 3300009177 Unclassified 619
73 Ga0105237_10801313 3300009545 Bacteria 949
74 Ga0105249_10113667 3300009553 Bacteria 2562
75 Ga0105249_13586398 3300009553 Bacteria 500
76 Ga0157369_10597986 3300013105 Bacteria 1139
77 Ga0157374_10030331 3300013296 Bacteria 4908
78 Ga0157374_10282467 3300013296 Bacteria 1639
79 Ga0157378_12500815 3300013297 Unclassified 568
80 Ga0163162_12031134 3300013306 Bacteria 659
81 Ga0157372_11294557 3300013307 Unclassified 841
82 Ga0157375_10000051 3300013308 Bacteria 130143
83 Ga0163163_10000038 3300014325 Bacteria 154457
84 Ga0163163_10118066 3300014325 Bacteria 2685
85 Ga0163163_10138467 3300014325 Bacteria 2476
86 Ga0157380_10037502 3300014326 Bacteria 3756
87 Ga0157376_10084268 3300014969 Bacteria 2737
88 Ga0207642_10404137 3300025899 Bacteria 818
89 Ga0207680_10044468 3300025903 Bacteria 2612
90 Ga0207643_10089520 3300025908 Bacteria 1792
91 Ga0207707_10446238 3300025912 Bacteria 1107
92 Ga0207695_11053168 3300025913 Unclassified 693
93 Ga0207671_10641977 3300025914 Bacteria 845
94 Ga0207693_10571202 3300025915 Bacteria 881
95 Ga0207663_11375445 3300025916 Bacteria 568
96 Ga0207652_10039644 3300025921 Unclassified 3998
97 Ga0207700_10830695 3300025928 Unclassified 827
98 Ga0207664_10028504 3300025929 Bacteria 4244
99 Ga0207644_10639457 3300025931 Bacteria 885
100 Ga0207670_10008894 3300025936 Bacteria 5694
101 Ga0207670_10415955 3300025936 Unclassified 1078
102 Ga0207665_10089934 3300025939 Bacteria 2127
103 Ga0207665_11503923 3300025939 Unclassified 535
104 Ga0207711_11054326 3300025941 Bacteria 753
105 Ga0207667_10062134 3300025949 Bacteria 3906
106 Ga0207708_10010662 3300026075 Bacteria 6826
107 Ga0207708_10414996 3300026075 Bacteria 1115
108 Ga0207708_10432066 3300026075 Bacteria 1094
109 Ga0207702_10127586 3300026078 Bacteria 2286
110 Ga0207641_10245012 3300026088 Bacteria 1672
111 Ga0207641_10540525 3300026088 Unclassified 1135
112 Ga0207648_10223173 3300026089 Bacteria 1675
113 Ga0207674_10114750 3300026116 Bacteria 2665
114 Ga0207674_10861527 3300026116 Unclassified 874
115 Ga0209966_1011859 3300027695 Bacteria 1593
116 Ga0207428_10083635 3300027907 Bacteria 2489
117 Ga0265337_1010480 3300028556 Bacteria 3245
118 Ga0265337_1015436 3300028556 Bacteria 2498
119 Ga0265337_1029449 3300028556 Bacteria 1641
120 Ga0265326_10023960 3300028558 Bacteria 1743
121 Ga0265326_10025600 3300028558 Bacteria 1683
122 Ga0265319_1000007 3300028563 Bacteria 217194
123 Ga0265318_10107620 3300028577 Bacteria 1025
124 Ga0265323_10000225 3300028653 Bacteria 33236
125 Ga0265323_10027351 3300028653 Bacteria 2143
126 Ga0265323_10109459 3300028653 Bacteria 907
127 Ga0265322_10072880 3300028654 Bacteria 974
128 Ga0265322_10085668 3300028654 Bacteria 895
129 Ga0265336_10008754 3300028666 Bacteria 3531
130 Ga0265336_10195937 3300028666 Unclassified 600
131 Ga0265338_10000040 3300028800 Bacteria 232041
132 Ga0265338_10000914 3300028800 Bacteria 49757
133 Ga0265338_10001028 3300028800 Bacteria 46692
134 Ga0265338_10001283 3300028800 Bacteria 41225
135 Ga0265338_10001719 3300028800 Bacteria 34724
136 Ga0265338_10002276 3300028800 Bacteria 29246
137 Ga0265338_10002614 3300028800 Bacteria 26592
138 Ga0265338_10004514 3300028800 Bacteria 18770
139 Ga0265338_10020384 3300028800 Bacteria 6976
140 Ga0265338_10022973 3300028800 Bacteria 6431
141 Ga0265338_10027816 3300028800 Bacteria 5660
142 Ga0265338_10046253 3300028800 Unclassified 3989
143 Ga0265338_10063570 3300028800 Unclassified 3217
144 Ga0265338_10181313 3300028800 Bacteria 1605
145 Ga0265338_10184193 3300028800 Bacteria 1589
146 Ga0265338_10248115 3300028800 Unclassified 1315
147 Ga0265338_10425290 3300028800 Bacteria 943
148 Ga0265324_10000392 3300029957 Bacteria 31749
149 Ga0265324_10027477 3300029957 Unclassified 2009
150 Ga0265324_10104374 3300029957 Unclassified 963
151 Ga0265324_10117421 3300029957 Bacteria 903
152 Ga0265770_1012108 3300030878 Unclassified 1274
153 Ga0265330_10188980 3300031235 Bacteria 872
154 Ga0265332_10114931 3300031238 Unclassified 1132
155 Ga0265320_10000363 3300031240 Bacteria 36831
156 Ga0265320_10000617 3300031240 Bacteria 27228
157 Ga0265320_10021476 3300031240 Bacteria 3470
158 Ga0265320_10026200 3300031240 Bacteria 3055
159 Ga0265320_10330311 3300031240 Unclassified 674
160 Ga0265339_10141969 3300031249 Bacteria 1221
161 Ga0265339_10333481 3300031249 Bacteria 717
162 Ga0265316_10007259 3300031344 Bacteria 10461
163 Ga0265316_10016502 3300031344 Bacteria 6401
164 Ga0265316_10034790 3300031344 Bacteria 4090
165 Ga0265316_10058108 3300031344 Bacteria 3015
166 Ga0265316_10261729 3300031344 Bacteria 1268
167 Ga0265316_10810221 3300031344 Bacteria 656
168 Ga0307408_100085867 3300031548 Bacteria 2364
169 Ga0265313_10012326 3300031595 Bacteria 5229
170 Ga0265314_10027600 3300031711 Bacteria 4250
171 Ga0265314_10197525 3300031711 Bacteria 1192
172 Ga0265342_10178902 3300031712 Bacteria 1163
173 Ga0265342_10534645 3300031712 Unclassified 596
174 Ga0307405_10018105 3300031731 Bacteria 3880
175 Ga0307413_10005213 3300031824 Bacteria 5766
176 Ga0307406_10014737 3300031901 Bacteria 4504
177 Ga0307407_10091024 3300031903 Bacteria 1869
178 Ga0307407_11035358 3300031903 Unclassified 636
179 Ga0307412_10008349 3300031911 Bacteria 5905
180 Ga0307412_10545754 3300031911 Bacteria 973
181 Ga0307409_100022065 3300031995 Bacteria 4381
182 Ga0307409_100719953 3300031995 Bacteria 999
183 Ga0307416_100480125 3300032002 Bacteria 1303
184 Ga0307416_101132361 3300032002 Unclassified 887
185 Ga0307414_10063798 3300032004 Bacteria 2620
186 Ga0307411_10134145 3300032005 Bacteria 1814
187 Ga0307415_100006364 3300032126 Bacteria 6359
188 Ga0307415_101438271 3300032126 Unclassified 658
189 Ga0373930_0003608 3300034816 Bacteria 2468
190 Ga0373950_0024775 3300034818 Bacteria 1080
191 Ga0373928_0000296 3300035084 Bacteria 9880
192 Ga0373929_0000197 3300035085 Bacteria 10783
193 Ga0373940_0172998 3300035088 Bacteria 699
194 Ga0373944_0000453 3300035089 Bacteria 9536
195 Ga0373932_0000001 3300035112 Bacteria 1459067
196 Ga0373945_0001936 3300035116 Bacteria 6431
197 Ga0373943_0055670 3300035170 Bacteria 1960
198 Ga0373946_0222979 3300035171 Bacteria 911
199 Ga0373962_0000005 3300035242 Bacteria 63923
200 Ga0316574_0187938 3300035398 Unclassified 1328
201 Ga0316574_0228644 3300035398 Bacteria 1191
202 Ga0373931_0000008 3300035691 Bacteria 362269
203 Ga0373931_0079866 3300035691 Bacteria 1803
204 Ga0373931_0442603 3300035691 Bacteria 830
205 Ga0373931_1277093 3300035691 Unclassified 504
206 Ga0373935_0464306 3300035692 Unclassified 916
207 Ga0373935_1353871 3300035692 Bacteria 532
208 Ga0373927_0144922 3300035695 Bacteria 1554
209 Ga0373947_0139455 3300035725 Unclassified 1554
210 Ga0373947_0497735 3300035725 Unclassified 828
211 Ga0373937_0074387 3300036401 Bacteria 3135
212 Ga0316584_0605200 3300036712 Bacteria 760
213 Ga0373925_0000192 3300037068 Bacteria 66343
214 Ga0373925_0404105 3300037068 Unclassified 1114
215 Ga0373925_0511966 3300037068 Bacteria 986
216 Ga0451807_1116154 3300041486 Unclassified 626
217 Ga0451577_1741003 3300042876 Unclassified 548
218 Ga0451577_1773315 3300042876 Unclassified 542
219 Ga0453684_0073031 3300044712 Bacteria 4327
220 Ga0453684_0089582 3300044712 Bacteria 3804
221 Ga0453684_1289150 3300044712 Bacteria 763
222 Ga0453684_2179761 3300044712 Unclassified 554
223 Ga0451576_0092118 3300045051 Bacteria 3153
224 Ga0451576_0319617 3300045051 Bacteria 1624
225 Ga0451576_0703435 3300045051 Unclassified 1062
226 Ga0495592_0847018 3300046454 Unclassified 540
227 Ga0495641_0028549 3300046461 Bacteria 2699
228 Ga0495653_0260104 3300046463 Bacteria 1148
229 Ga0495582_0081207 3300046473 Unclassified 1800
230 Ga0495639_0038703 3300046475 Unclassified 2143
231 Ga0495664_0135037 3300046477 Bacteria 1495
232 Ga0495618_0237808 3300046514 Bacteria 1145
233 Ga0495630_0215712 3300046517 Bacteria 1465
234 Ga0495666_0037290 3300046526 Unclassified 2365
235 Ga0495640_0430996 3300046533 Bacteria 807
236 Ga0495586_0002149 3300046535 Bacteria 10703
237 Ga0495586_0077121 3300046535 Bacteria 1827
238 Ga0495645_0363552 3300046543 Unclassified 930
239 Ga0495667_0491892 3300046559 Unclassified 769
240 Ga0495634_0049218 3300046642 Bacteria 2835
241 Ga0495634_0491306 3300046642 Unclassified 720
242 Ga0495657_0601817 3300046675 Bacteria 636
243 Ga0495657_0703290 3300046675 Bacteria 581
244 Ga0495599_0358645 3300046678 Unclassified 873
245 Ga0495599_0515870 3300046678 Unclassified 702
246 Ga0495646_0429026 3300046680 Bacteria 685
247 Ga0495647_0054021 3300046681 Unclassified 1568
248 Ga0495658_0030713 3300046683 Unclassified 2920
249 Ga0495613_0668418 3300046689 Unclassified 686
250 Ga0495674_0591711 3300047319 Bacteria 880
251 Ga0495674_0822869 3300047319 Unclassified 721
252 Ga0495674_1433071 3300047319 Unclassified 514
253 Ga0495680_1018641 3300047322 Bacteria 528
254 Ga0495684_0653940 3300047471 Unclassified 703
255 Ga0495593_0697447 3300047673 Unclassified 510
256 Ga0496106_0041125 3300048909 Bacteria 3464
257 Ga0496107_0306236 3300048910 Bacteria 1183
258 Ga0496115_0001109 3300048918 Bacteria 19444
259 Ga0496125_0000017 3300048928 Bacteria 508217
260 Ga0501034_0077825 3300049571 Bacteria 3322
261 Ga0501036_0206373 3300049572 Bacteria 1652
262 Ga0501039_1040191 3300049575 Unclassified 635
263 Ga0501043_0286747 3300049579 Bacteria 1261
264 Ga0501047_0572746 3300049581 Bacteria 952
265 Ga0501075_1201906 3300049591 Bacteria 575
266 Ga0501272_005309 3300049769 Bacteria 1354
267 nmdc:mga09592_117860_c1 3300050508 Bacteria 2279
268 nmdc:mga06r32_168006_c1 3300050510 Bacteria 2177
269 nmdc:mga06r32_439378_c1 3300050510 Unclassified 1285
270 nmdc:mga08y16_13139_c1 3300050511 Bacteria 8711
271 nmdc:mga08y16_1823199_c1 3300050511 Unclassified 561
272 nmdc:mga08y16_472505_c1 3300050511 Unclassified 1276
273 nmdc:mga0rr50_902656_c1 3300050513 Bacteria 753
274 nmdc:mga0a205_608974_c1 3300050515 Bacteria 945
275 Ga0500635_0396364 3300053080 Unclassified 547
276 Ga0500611_027392 3300053727 Bacteria 1147
277 Ga0265337_1000579
278 MRS1b_contig_8340328
279 Ga0065712_10136114
280 Ga0065707_10439380
281 Ga0070690_100596060
282 Ga0070666_10031007
283 Ga0070680_100163748
284 Ga0070689_100008588
285 Ga0070689_100546858
286 Ga0070687_100170375
287 Ga0070687_100207440
288 Ga0070668_101663231
289 Ga0070671_100760697
290 Ga0070688_100004644
291 Ga0070688_101260769
292 Ga0070713_100048667
293 Ga0070713_100133165
294 Ga0070700_100020196
295 Ga0070700_100223634
296 Ga0070700_100284418
297 Ga0070694_100025754
298 Ga0070681_10452269
299 Ga0068867_101382039
300 Ga0070685_10037333
301 Ga0070685_10760733
302 Ga0070707_100511920
303 Ga0070699_100406137
304 Ga0070679_100033318
305 Ga0070684_100996616
306 Ga0070684_101641813
307 Ga0070686_100005727
308 Ga0070686_100277580
309 Ga0070665_101489937
310 Ga0070704_100018320
311 Ga0070704_100095148
312 Ga0068855_100069607
313 Ga0068855_100102242
314 Ga0068857_100165015
315 Ga0068859_100320159
316 Ga0068859_100919412
317 Ga0068864_100070532
318 Ga0068870_10068767
319 Ga0068863_100206274
320 Ga0068863_100527727
321 Ga0068858_101920980
322 Ga0070715_10396099
323 Ga0070716_100061384
324 Ga0070712_100427919
325 Ga0097621_100840466
326 Ga0075428_100128118
327 Ga0075428_101610337
328 Ga0075430_100251900
329 Ga0075431_100286980
330 Ga0075433_10662238
331 Ga0075429_100091295
332 Ga0097620_100320140
333 Ga0097620_100919318
334 Ga0075435_100930520
335 Ga0075435_101398232
336 Ga0099794_10176012
337 Ga0105240_10016892
338 Ga0105240_10288598
339 Ga0105240_10958905
340 Ga0111539_10041504
341 Ga0111539_10174221
342 Ga0111539_10481413
343 Ga0111539_10951396
344 Ga0105245_11877720
345 Ga0114129_10371152
346 Ga0105242_10465123
347 Ga0105248_11822439
348 Ga0105248_12258797
349 Ga0105237_10801313
350 Ga0105249_10113667
351 Ga0105249_13586398
352 Ga0157369_10597986
353 Ga0157374_10030331
354 Ga0157374_10282467
355 Ga0157378_12500815
356 Ga0163162_12031134
357 Ga0157372_11294557
358 Ga0157375_10000051
359 Ga0163163_10000038
360 Ga0163163_10118066
361 Ga0163163_10138467
362 Ga0157380_10037502
363 Ga0157376_10084268
364 Ga0207642_10404137
365 Ga0207680_10044468
366 Ga0207643_10089520
367 Ga0207707_10446238
368 Ga0207695_11053168
369 Ga0207671_10641977
370 Ga0207693_10571202
371 Ga0207663_11375445
372 Ga0207652_10039644
373 Ga0207700_10830695
374 Ga0207664_10028504
375 Ga0207644_10639457
376 Ga0207670_10008894
377 Ga0207670_10415955
378 Ga0207665_10089934
379 Ga0207665_11503923
380 Ga0207711_11054326
381 Ga0207667_10062134
382 Ga0207708_10010662
383 Ga0207708_10414996
384 Ga0207708_10432066
385 Ga0207702_10127586
386 Ga0207641_10245012
387 Ga0207641_10540525
388 Ga0207648_10223173
389 Ga0207674_10114750
390 Ga0207674_10861527
391 Ga0209966_1011859
392 Ga0207428_10083635
393 Ga0265337_1010480
394 Ga0265337_1015436
395 Ga0265337_1029449
396 Ga0265326_10023960
397 Ga0265326_10025600
398 Ga0265319_1000007
399 Ga0265318_10107620
400 Ga0265323_10000225
401 Ga0265323_10027351
402 Ga0265323_10109459
403 Ga0265322_10072880
404 Ga0265322_10085668
405 Ga0265336_10008754
406 Ga0265336_10195937
407 Ga0265338_10000040
408 Ga0265338_10000914
409 Ga0265338_10001028
410 Ga0265338_10001283
411 Ga0265338_10001719
412 Ga0265338_10002276
413 Ga0265338_10002614
414 Ga0265338_10004514
415 Ga0265338_10020384
416 Ga0265338_10022973
417 Ga0265338_10027816
418 Ga0265338_10046253
419 Ga0265338_10063570
420 Ga0265338_10181313
421 Ga0265338_10184193
422 Ga0265338_10248115
423 Ga0265338_10425290
424 Ga0265324_10000392
425 Ga0265324_10027477
426 Ga0265324_10104374
427 Ga0265324_10117421
428 Ga0265770_1012108
429 Ga0265330_10188980
430 Ga0265332_10114931
431 Ga0265320_10000363
432 Ga0265320_10000617
433 Ga0265320_10021476
434 Ga0265320_10026200
435 Ga0265320_10330311
436 Ga0265339_10141969
437 Ga0265339_10333481
438 Ga0265316_10007259
439 Ga0265316_10016502
440 Ga0265316_10034790
441 Ga0265316_10058108
442 Ga0265316_10261729
443 Ga0265316_10810221
444 Ga0307408_100085867
445 Ga0265313_10012326
446 Ga0265314_10027600
447 Ga0265314_10197525
448 Ga0265342_10178902
449 Ga0265342_10534645
450 Ga0307405_10018105
451 Ga0307413_10005213
452 Ga0307406_10014737
453 Ga0307407_10091024
454 Ga0307407_11035358
455 Ga0307412_10008349
456 Ga0307412_10545754
457 Ga0307409_100022065
458 Ga0307409_100719953
459 Ga0307416_100480125
460 Ga0307416_101132361
461 Ga0307414_10063798
462 Ga0307411_10134145
463 Ga0307415_100006364
464 Ga0307415_101438271
465 Ga0373930_0003608
466 Ga0373950_0024775
467 Ga0373928_0000296
468 Ga0373929_0000197
469 Ga0373940_0172998
470 Ga0373944_0000453
471 Ga0373932_0000001
472 Ga0373945_0001936
473 Ga0373943_0055670
474 Ga0373946_0222979
475 Ga0373962_0000005
476 Ga0316574_0187938
477 Ga0316574_0228644
478 Ga0373931_0000008
479 Ga0373931_0079866
480 Ga0373931_0442603
481 Ga0373931_1277093
482 Ga0373935_0464306
483 Ga0373935_1353871
484 Ga0373927_0144922
485 Ga0373947_0139455
486 Ga0373947_0497735
487 Ga0373937_0074387
488 Ga0316584_0605200
489 Ga0373925_0000192
490 Ga0373925_0404105
491 Ga0373925_0511966
492 Ga0451807_1116154
493 Ga0451577_1741003
494 Ga0451577_1773315
495 Ga0453684_0073031
496 Ga0453684_0089582
497 Ga0453684_1289150
498 Ga0453684_2179761
499 Ga0451576_0092118
500 Ga0451576_0319617
501 Ga0451576_0703435
502 Ga0495592_0847018
503 Ga0495641_0028549
504 Ga0495653_0260104
505 Ga0495582_0081207
506 Ga0495639_0038703
507 Ga0495664_0135037
508 Ga0495618_0237808
509 Ga0495630_0215712
510 Ga0495666_0037290
511 Ga0495640_0430996
512 Ga0495586_0002149
513 Ga0495586_0077121
514 Ga0495645_0363552
515 Ga0495667_0491892
516 Ga0495634_0049218
517 Ga0495634_0491306
518 Ga0495657_0601817
519 Ga0495657_0703290
520 Ga0495599_0358645
521 Ga0495599_0515870
522 Ga0495646_0429026
523 Ga0495647_0054021
524 Ga0495658_0030713
525 Ga0495613_0668418
526 Ga0495674_0591711
527 Ga0495674_0822869
528 Ga0495674_1433071
529 Ga0495680_1018641
530 Ga0495684_0653940
531 Ga0495593_0697447
532 Ga0496106_0041125
533 Ga0496107_0306236
534 Ga0496115_0001109
535 Ga0496125_0000017
536 Ga0501034_0077825
537 Ga0501036_0206373
538 Ga0501039_1040191
539 Ga0501043_0286747
540 Ga0501047_0572746
541 Ga0501075_1201906
542 Ga0501272_005309
543 nmdc:mga09592_117860_c1
544 nmdc:mga06r32_168006_c1
545 nmdc:mga06r32_439378_c1
546 nmdc:mga08y16_13139_c1
547 nmdc:mga08y16_1823199_c1
548 nmdc:mga08y16_472505_c1
549 nmdc:mga0rr50_902656_c1
550 nmdc:mga0a205_608974_c1
551 Ga0500635_0396364
552 Ga0500611_027392

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

30

163

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8864 1 134
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8843 1 137
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8777 1 137
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8662 1 134
1nmn-assembly2.cif.gz_B structure of yqgf from escherichia coli, a hypothetical protein 0.8553 1 137
ID Description Score Start End Superfamily
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.9046 5 137 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8975 2 136 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8856 5 137 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8791 2 136 3.30.420.140
af_Q8GYR7_22_166_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8659 2 136 3.30.420.140
ID Description Score Start End GO Terms
AF-A0A432EVS5-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9846 3 137 GO:0000967
GO:0004518
GO:0005829
AF-A0A7V4MG54-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9816 3 137 GO:0000967
GO:0004518
GO:0005829
AF-A0A833LGW3-F1-model_v4 Holliday junction resolvase RuvX 0.9778 2 90 GO:0000967
GO:0004518
GO:0005829
AF-A0A1W9VMU1-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.9716 1 84 GO:0000967
GO:0004518
GO:0005829
AF-A0A432EVS5-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9704 3 137 GO:0000967
GO:0004518
GO:0005829

Map