F381158

General Info

Members Datasets Scaffolds Average Seq Length
276 180 552 187

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10032334|Ga0207695_100323342
Length 215
Sequence LVYRPVGTLQYRHPSNRLQQQVKNAASAEPMALEQDQRISEVVTREQSRLRNFIRRRVPDPRDAEDILQDVFYELVEANRLLMPIEHVTGWLFRVARNRITDLFRKRTPESFTDAAVVDENDELLRLEDLLPSADAGPEAIYARGVLLDALELAIDELPDEQRDVFVAHELEGRTFKEMAAESGVSLNTLLSRKRYAILHLRERLRTIHDELTRG

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 8.33
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10032334 3300025913 Bacteria 5726
2 Ga0065714_10227263 3300005288 Bacteria 825
3 Ga0065715_10105046 3300005293 Bacteria 2918
4 Ga0065707_10300262 3300005295 Bacteria 1006
5 Ga0070683_100000032 3300005329 Bacteria 148421
6 Ga0070683_100000068 3300005329 Bacteria 72997
7 Ga0070683_100403550 3300005329 Bacteria 1304
8 Ga0070670_100000307 3300005331 Bacteria 42018
9 Ga0070666_10106675 3300005335 Bacteria 1935
10 Ga0070680_100235137 3300005336 Unclassified 1548
11 Ga0070682_100061064 3300005337 Unclassified 2385
12 Ga0068868_100000163 3300005338 Bacteria 43476
13 Ga0068868_100026297 3300005338 Bacteria 4434
14 Ga0070692_10113874 3300005345 Bacteria 1500
15 Ga0070669_100608465 3300005353 Bacteria 916
16 Ga0070671_100193509 3300005355 Bacteria 1724
17 Ga0070667_100218461 3300005367 Bacteria 1696
18 Ga0070703_10000204 3300005406 Bacteria 28691
19 Ga0070713_100052761 3300005436 Unclassified 3368
20 Ga0070710_10228156 3300005437 Bacteria 1188
21 Ga0070711_100090386 3300005439 Bacteria 2205
22 Ga0070700_100409247 3300005441 Bacteria 1022
23 Ga0070708_100008418 3300005445 Bacteria 8279
24 Ga0070708_100215872 3300005445 Bacteria 1798
25 Ga0070708_100277940 3300005445 Bacteria 1576
26 Ga0070681_10101506 3300005458 Unclassified 2822
27 Ga0070685_10107389 3300005466 Bacteria 1714
28 Ga0070706_100470815 3300005467 Bacteria 1169
29 Ga0070707_100219308 3300005468 Bacteria 1853
30 Ga0070707_100225732 3300005468 Bacteria 1824
31 Ga0070707_100309684 3300005468 Bacteria 1535
32 Ga0070699_100028334 3300005518 Bacteria 4830
33 Ga0070679_100066442 3300005530 Unclassified 3594
34 Ga0070684_100000089 3300005535 Bacteria 59395
35 Ga0070684_100000096 3300005535 Bacteria 56546
36 Ga0070684_100296236 3300005535 Unclassified 1484
37 Ga0070665_100049922 3300005548 Bacteria 4198
38 Ga0070704_100013993 3300005549 Bacteria 4999
39 Ga0070704_100021526 3300005549 Bacteria 4182
40 Ga0070704_100938691 3300005549 Unclassified 780
41 Ga0068855_100608389 3300005563 Bacteria 1178
42 Ga0068854_100014791 3300005578 Bacteria 5153
43 Ga0068864_100368874 3300005618 Bacteria 1358
44 Ga0068864_101637013 3300005618 Bacteria 648
45 Ga0068866_10182809 3300005718 Bacteria 1240
46 Ga0068863_100106978 3300005841 Bacteria 2661
47 Ga0068863_100877199 3300005841 Bacteria 897
48 Ga0068858_100038837 3300005842 Bacteria 4415
49 Ga0068858_100215931 3300005842 Bacteria 1816
50 Ga0068858_100234591 3300005842 Bacteria 1740
51 Ga0068860_100264208 3300005843 Bacteria 1678
52 Ga0068862_100117678 3300005844 Bacteria 2339
53 Ga0070717_10012605 3300006028 Bacteria 6450
54 Ga0070717_10535489 3300006028 Bacteria 1060
55 Ga0070716_100222055 3300006173 Bacteria 1270
56 Ga0097621_100153673 3300006237 Bacteria 1974
57 Ga0097621_100175422 3300006237 Bacteria 1850
58 Ga0068871_100340158 3300006358 Bacteria 1325
59 Ga0075428_100044193 3300006844 Bacteria 4896
60 Ga0075431_100361982 3300006847 Bacteria 1457
61 Ga0075434_100112020 3300006871 Bacteria 2740
62 Ga0075434_100337054 3300006871 Bacteria 1529
63 Ga0075436_100878204 3300006914 Bacteria 670
64 Ga0075435_100068283 3300007076 Bacteria 2895
65 Ga0075435_101058226 3300007076 Bacteria 709
66 Ga0099795_10142486 3300007788 Bacteria 976
67 Ga0105240_10002932 3300009093 Bacteria 26921
68 Ga0105240_10099358 3300009093 Bacteria 3542
69 Ga0111539_10615533 3300009094 Bacteria 1265
70 Ga0105245_10002240 3300009098 Bacteria 17510
71 Ga0105245_10057562 3300009098 Bacteria 3497
72 Ga0105245_10113711 3300009098 Bacteria 2520
73 Ga0105245_11085353 3300009098 Bacteria 846
74 Ga0114129_10013436 3300009147 Bacteria 11669
75 Ga0114129_10017205 3300009147 Bacteria 10297
76 Ga0114129_10021444 3300009147 Bacteria 9170
77 Ga0114129_10054867 3300009147 Bacteria 5585
78 Ga0105243_10677334 3300009148 Bacteria 1003
79 Ga0105241_10116458 3300009174 Bacteria 2146
80 Ga0105242_10019713 3300009176 Bacteria 5286
81 Ga0105242_10128018 3300009176 Bacteria 2188
82 Ga0105242_11199113 3300009176 Bacteria 778
83 Ga0105248_10073086 3300009177 Bacteria 3854
84 Ga0105248_10363782 3300009177 Bacteria 1629
85 Ga0105248_10573284 3300009177 Bacteria 1273
86 Ga0105237_11323952 3300009545 Bacteria 727
87 Ga0105249_10274445 3300009553 Bacteria 1681
88 Ga0105239_10757707 3300010375 Unclassified 1111
89 Ga0105239_12689550 3300010375 Unclassified 580
90 Ga0157369_10000539 3300013105 Bacteria 50071
91 Ga0157378_10753535 3300013297 Bacteria 997
92 Ga0163162_10192665 3300013306 Bacteria 2166
93 Ga0157375_10077530 3300013308 Bacteria 3354
94 Ga0157375_10317091 3300013308 Bacteria 1723
95 Ga0163163_10000008 3300014325 Bacteria 286490
96 Ga0163163_10056734 3300014325 Bacteria 3870
97 Ga0163163_11601945 3300014325 Bacteria 712
98 Ga0157380_10011869 3300014326 Bacteria 6300
99 Ga0157379_10014436 3300014968 Bacteria 6930
100 Ga0157376_10000025 3300014969 Bacteria 214212
101 Ga0157376_10006146 3300014969 Bacteria 8457
102 Ga0157376_10453507 3300014969 Bacteria 1251
103 Ga0207653_10000014 3300025885 Bacteria 152002
104 Ga0207692_10189738 3300025898 Bacteria 1202
105 Ga0207692_10237723 3300025898 Bacteria 1087
106 Ga0207680_10090011 3300025903 Bacteria 1949
107 Ga0207680_10712792 3300025903 Bacteria 719
108 Ga0207647_10393588 3300025904 Bacteria 781
109 Ga0207699_10027355 3300025906 Bacteria 3156
110 Ga0207684_10101197 3300025910 Bacteria 2463
111 Ga0207684_10115916 3300025910 Bacteria 2295
112 Ga0207684_10144294 3300025910 Bacteria 2048
113 Ga0207654_10107334 3300025911 Bacteria 1731
114 Ga0207707_10033505 3300025912 Bacteria 4495
115 Ga0207695_10158873 3300025913 Bacteria 2193
116 Ga0207693_10250156 3300025915 Unclassified 1391
117 Ga0207663_10684496 3300025916 Bacteria 811
118 Ga0207660_10192467 3300025917 Bacteria 1589
119 Ga0207652_10036858 3300025921 Unclassified 4136
120 Ga0207646_10185446 3300025922 Unclassified 1879
121 Ga0207646_10384242 3300025922 Bacteria 1268
122 Ga0207646_10491028 3300025922 Bacteria 1107
123 Ga0207681_10491376 3300025923 Bacteria 1004
124 Ga0207681_10590587 3300025923 Bacteria 917
125 Ga0207650_10000262 3300025925 Bacteria 56131
126 Ga0207644_10298817 3300025931 Bacteria 1297
127 Ga0207686_10034879 3300025934 Bacteria 3015
128 Ga0207704_10766501 3300025938 Bacteria 803
129 Ga0207711_10042371 3300025941 Bacteria 3879
130 Ga0207711_10820193 3300025941 Bacteria 866
131 Ga0207661_10000001 3300025944 Bacteria 937688
132 Ga0207661_10000020 3300025944 Bacteria 216011
133 Ga0207661_10907841 3300025944 Bacteria 811
134 Ga0207667_10192226 3300025949 Bacteria 2094
135 Ga0207712_10456939 3300025961 Bacteria 1084
136 Ga0207640_10005046 3300025981 Bacteria 7182
137 Ga0207658_10052945 3300025986 Bacteria 2997
138 Ga0207677_10000249 3300026023 Bacteria 41568
139 Ga0207677_10203841 3300026023 Bacteria 1574
140 Ga0207703_10043985 3300026035 Bacteria 3587
141 Ga0207703_10178895 3300026035 Bacteria 1871
142 Ga0207703_10206458 3300026035 Bacteria 1749
143 Ga0207708_10479295 3300026075 Bacteria 1040
144 Ga0207702_11124140 3300026078 Bacteria 780
145 Ga0207641_10155741 3300026088 Bacteria 2073
146 Ga0207641_11025931 3300026088 Bacteria 822
147 Ga0207676_10401675 3300026095 Bacteria 1281
148 Ga0207676_10751092 3300026095 Bacteria 949
149 Ga0209971_1028104 3300027682 Bacteria 1346
150 Ga0209998_10029578 3300027717 Bacteria 1208
151 Ga0268266_10022431 3300028379 Bacteria 5381
152 Ga0268264_10282871 3300028381 Bacteria 1554
153 Ga0265338_10013986 3300028800 Bacteria 8994
154 Ga0373953_0021653 3300035117 Bacteria 2416
155 Ga0373957_0097483 3300035120 Bacteria 1174
156 Ga0373946_0296556 3300035171 Unclassified 798
157 Ga0373955_0034696 3300035172 Bacteria 2667
158 Ga0373955_0401198 3300035172 Bacteria 833
159 Ga0373924_0219059 3300035410 Bacteria 841
160 Ga0373935_0435869 3300035692 Bacteria 945
161 Ga0373935_0682624 3300035692 Unclassified 755
162 Ga0373933_0595192 3300035724 Bacteria 726
163 Ga0373937_0004427 3300036401 Bacteria 11939
164 Ga0373937_0010265 3300036401 Bacteria 8174
165 Ga0373937_0023955 3300036401 Bacteria 5503
166 Ga0373937_0130760 3300036401 Bacteria 2345
167 Ga0373937_0398720 3300036401 Bacteria 1305
168 Ga0373925_0002527 3300037068 Bacteria 14578
169 Ga0373925_0523951 3300037068 Bacteria 974
170 Ga0436360_1060552 3300039438 Bacteria 974
171 Ga0436361_0823858 3300039447 Bacteria 982
172 Ga0436363_0420633 3300039450 Bacteria 1483
173 Ga0451577_0009755 3300042876 Bacteria 9205
174 Ga0453684_0233568 3300044712 Bacteria 2121
175 Ga0451576_0059155 3300045051 Bacteria 4001
176 Ga0466967_0193168 3300045976 Unclassified 1925
177 Ga0466967_0206458 3300045976 Unclassified 1862
178 Ga0495629_0260906 3300046459 Bacteria 1191
179 Ga0495629_0401874 3300046459 Bacteria 931
180 Ga0495651_0016567 3300046462 Bacteria 5707
181 Ga0495653_0047598 3300046463 Bacteria 3316
182 Ga0495580_0017151 3300046472 Bacteria 5421
183 Ga0495580_0257472 3300046472 Bacteria 1194
184 Ga0495580_0522180 3300046472 Bacteria 791
185 Ga0495580_0522189 3300046472 Bacteria 791
186 Ga0495582_0352723 3300046473 Bacteria 847
187 Ga0495605_0058330 3300046474 Bacteria 1856
188 Ga0495662_0034991 3300046476 Bacteria 2424
189 Ga0495594_0020912 3300046499 Bacteria 3490
190 Ga0495608_0164713 3300046511 Bacteria 1408
191 Ga0495618_0100861 3300046514 Bacteria 1848
192 Ga0495618_0107308 3300046514 Bacteria 1788
193 Ga0495618_0135403 3300046514 Bacteria 1576
194 Ga0495628_0043607 3300046516 Bacteria 3571
195 Ga0495628_0068534 3300046516 Unclassified 2768
196 Ga0495628_0108886 3300046516 Bacteria 2133
197 Ga0495630_0292401 3300046517 Bacteria 1245
198 Ga0495652_0315449 3300046529 Bacteria 1131
199 Ga0495665_0242910 3300046531 Bacteria 928
200 Ga0495587_0038846 3300046536 Bacteria 2851
201 Ga0495645_0009025 3300046543 Bacteria 6963
202 Ga0495645_0112123 3300046543 Bacteria 1929
203 Ga0495667_0011610 3300046559 Bacteria 5965
204 Ga0495667_0091895 3300046559 Bacteria 1965
205 Ga0495668_0389689 3300046616 Unclassified 765
206 Ga0495634_0170695 3300046642 Bacteria 1367
207 Ga0495635_0099115 3300046663 Bacteria 1991
208 Ga0495635_0157631 3300046663 Bacteria 1545
209 Ga0495657_0007716 3300046675 Bacteria 8280
210 Ga0495623_0018913 3300046679 Bacteria 4448
211 Ga0495646_0011041 3300046680 Bacteria 5738
212 Ga0495669_0024096 3300046684 Bacteria 2652
213 Ga0495613_0009964 3300046689 Bacteria 7061
214 Ga0495613_0184628 3300046689 Bacteria 1476
215 Ga0495600_0091034 3300046809 Bacteria 1990
216 Ga0495600_0283174 3300046809 Bacteria 1049
217 Ga0495600_0566292 3300046809 Bacteria 693
218 Ga0495581_0032829 3300047315 Bacteria 3005
219 Ga0495581_0232385 3300047315 Bacteria 1079
220 Ga0495674_0011391 3300047319 Bacteria 8394
221 Ga0495674_0318476 3300047319 Bacteria 1267
222 Ga0495680_0032129 3300047322 Bacteria 4265
223 Ga0495683_0105615 3300047323 Bacteria 1350
224 Ga0495684_0217550 3300047471 Bacteria 1402
225 Ga0495602_0214656 3300048088 Bacteria 1457
226 Ga0496102_0559713 3300048905 Bacteria 1066
227 Ga0496103_0494487 3300048906 Bacteria 783
228 Ga0496104_0015667 3300048907 Bacteria 6876
229 Ga0496104_0212527 3300048907 Bacteria 1846
230 Ga0496104_0842527 3300048907 Bacteria 822
231 Ga0496105_0186952 3300048908 Bacteria 1695
232 Ga0496105_0312104 3300048908 Bacteria 1262
233 Ga0496108_0846893 3300048911 Bacteria 787
234 Ga0496108_1057314 3300048911 Bacteria 691
235 Ga0496109_1048872 3300048912 Bacteria 752
236 Ga0496109_1127091 3300048912 Bacteria 721
237 Ga0496110_0257916 3300048913 Bacteria 1587
238 Ga0496111_0001303 3300048914 Bacteria 14003
239 Ga0496112_0310945 3300048915 Bacteria 1521
240 Ga0496112_0329634 3300048915 Bacteria 1470
241 Ga0496112_0362808 3300048915 Bacteria 1390
242 Ga0496112_0833578 3300048915 Bacteria 846
243 Ga0496113_0212051 3300048916 Bacteria 1542
244 Ga0496113_0551561 3300048916 Bacteria 924
245 Ga0496114_0350864 3300048917 Bacteria 1305
246 Ga0496114_0410764 3300048917 Bacteria 1199
247 Ga0496115_0347556 3300048918 Bacteria 1210
248 Ga0496115_0419393 3300048918 Bacteria 1084
249 Ga0501036_0306758 3300049572 Bacteria 1327
250 Ga0501039_0137636 3300049575 Bacteria 1918
251 Ga0501071_0137640 3300049587 Bacteria 1817
252 Ga0501073_0002882 3300049589 Bacteria 12887
253 Ga0501075_0351521 3300049591 Bacteria 1123
254 Ga0501080_0001163 3300049742 Bacteria 21746
255 Ga0501035_0341813 3300049822 Bacteria 1254
256 nmdc:mga05p37_10950_c1 3300050507 Bacteria 10769
257 nmdc:mga05p37_38505_c1 3300050507 Bacteria 5865
258 nmdc:mga05p37_4620_c1 3300050507 Bacteria 16095
259 nmdc:mga05p37_50197_c1 3300050507 Bacteria 5130
260 nmdc:mga05p37_698735_c1 3300050507 Bacteria 1127
261 nmdc:mga09592_216993_c1 3300050508 Bacteria 1657
262 nmdc:mga06r32_854883_c1 3300050510 Bacteria 868
263 nmdc:mga06r32_987595_c1 3300050510 Bacteria 795
264 nmdc:mga08y16_322367_c1 3300050511 Bacteria 1590
265 nmdc:mga0n895_278255_c1 3300050512 Bacteria 1697
266 nmdc:mga0n895_320013_c1 3300050512 Bacteria 1572
267 nmdc:mga0n895_98583_c1 3300050512 Bacteria 2929
268 nmdc:mga0rr50_498893_c1 3300050513 Bacteria 1035
269 nmdc:mga0a205_105993_c1 3300050515 Bacteria 2709
270 nmdc:mga0a205_1167460_c1 3300050515 Bacteria 617
271 nmdc:mga0a205_727400_c1 3300050515 Bacteria 842
272 Ga0495655_0119928 3300053083 Bacteria 799
273 Ga0495595_0351151 3300053084 Bacteria 744
274 Ga0495619_0379207 3300053085 Unclassified 977
275 Ga0500555_027936 3300053103 Bacteria 1609
276 Ga0501082_0853242 3300060353 Unclassified 797
277 Ga0207695_10032334
278 Ga0065714_10227263
279 Ga0065715_10105046
280 Ga0065707_10300262
281 Ga0070683_100000032
282 Ga0070683_100000068
283 Ga0070683_100403550
284 Ga0070670_100000307
285 Ga0070666_10106675
286 Ga0070680_100235137
287 Ga0070682_100061064
288 Ga0068868_100000163
289 Ga0068868_100026297
290 Ga0070692_10113874
291 Ga0070669_100608465
292 Ga0070671_100193509
293 Ga0070667_100218461
294 Ga0070703_10000204
295 Ga0070713_100052761
296 Ga0070710_10228156
297 Ga0070711_100090386
298 Ga0070700_100409247
299 Ga0070708_100008418
300 Ga0070708_100215872
301 Ga0070708_100277940
302 Ga0070681_10101506
303 Ga0070685_10107389
304 Ga0070706_100470815
305 Ga0070707_100219308
306 Ga0070707_100225732
307 Ga0070707_100309684
308 Ga0070699_100028334
309 Ga0070679_100066442
310 Ga0070684_100000089
311 Ga0070684_100000096
312 Ga0070684_100296236
313 Ga0070665_100049922
314 Ga0070704_100013993
315 Ga0070704_100021526
316 Ga0070704_100938691
317 Ga0068855_100608389
318 Ga0068854_100014791
319 Ga0068864_100368874
320 Ga0068864_101637013
321 Ga0068866_10182809
322 Ga0068863_100106978
323 Ga0068863_100877199
324 Ga0068858_100038837
325 Ga0068858_100215931
326 Ga0068858_100234591
327 Ga0068860_100264208
328 Ga0068862_100117678
329 Ga0070717_10012605
330 Ga0070717_10535489
331 Ga0070716_100222055
332 Ga0097621_100153673
333 Ga0097621_100175422
334 Ga0068871_100340158
335 Ga0075428_100044193
336 Ga0075431_100361982
337 Ga0075434_100112020
338 Ga0075434_100337054
339 Ga0075436_100878204
340 Ga0075435_100068283
341 Ga0075435_101058226
342 Ga0099795_10142486
343 Ga0105240_10002932
344 Ga0105240_10099358
345 Ga0111539_10615533
346 Ga0105245_10002240
347 Ga0105245_10057562
348 Ga0105245_10113711
349 Ga0105245_11085353
350 Ga0114129_10013436
351 Ga0114129_10017205
352 Ga0114129_10021444
353 Ga0114129_10054867
354 Ga0105243_10677334
355 Ga0105241_10116458
356 Ga0105242_10019713
357 Ga0105242_10128018
358 Ga0105242_11199113
359 Ga0105248_10073086
360 Ga0105248_10363782
361 Ga0105248_10573284
362 Ga0105237_11323952
363 Ga0105249_10274445
364 Ga0105239_10757707
365 Ga0105239_12689550
366 Ga0157369_10000539
367 Ga0157378_10753535
368 Ga0163162_10192665
369 Ga0157375_10077530
370 Ga0157375_10317091
371 Ga0163163_10000008
372 Ga0163163_10056734
373 Ga0163163_11601945
374 Ga0157380_10011869
375 Ga0157379_10014436
376 Ga0157376_10000025
377 Ga0157376_10006146
378 Ga0157376_10453507
379 Ga0207653_10000014
380 Ga0207692_10189738
381 Ga0207692_10237723
382 Ga0207680_10090011
383 Ga0207680_10712792
384 Ga0207647_10393588
385 Ga0207699_10027355
386 Ga0207684_10101197
387 Ga0207684_10115916
388 Ga0207684_10144294
389 Ga0207654_10107334
390 Ga0207707_10033505
391 Ga0207695_10158873
392 Ga0207693_10250156
393 Ga0207663_10684496
394 Ga0207660_10192467
395 Ga0207652_10036858
396 Ga0207646_10185446
397 Ga0207646_10384242
398 Ga0207646_10491028
399 Ga0207681_10491376
400 Ga0207681_10590587
401 Ga0207650_10000262
402 Ga0207644_10298817
403 Ga0207686_10034879
404 Ga0207704_10766501
405 Ga0207711_10042371
406 Ga0207711_10820193
407 Ga0207661_10000001
408 Ga0207661_10000020
409 Ga0207661_10907841
410 Ga0207667_10192226
411 Ga0207712_10456939
412 Ga0207640_10005046
413 Ga0207658_10052945
414 Ga0207677_10000249
415 Ga0207677_10203841
416 Ga0207703_10043985
417 Ga0207703_10178895
418 Ga0207703_10206458
419 Ga0207708_10479295
420 Ga0207702_11124140
421 Ga0207641_10155741
422 Ga0207641_11025931
423 Ga0207676_10401675
424 Ga0207676_10751092
425 Ga0209971_1028104
426 Ga0209998_10029578
427 Ga0268266_10022431
428 Ga0268264_10282871
429 Ga0265338_10013986
430 Ga0373953_0021653
431 Ga0373957_0097483
432 Ga0373946_0296556
433 Ga0373955_0034696
434 Ga0373955_0401198
435 Ga0373924_0219059
436 Ga0373935_0435869
437 Ga0373935_0682624
438 Ga0373933_0595192
439 Ga0373937_0004427
440 Ga0373937_0010265
441 Ga0373937_0023955
442 Ga0373937_0130760
443 Ga0373937_0398720
444 Ga0373925_0002527
445 Ga0373925_0523951
446 Ga0436360_1060552
447 Ga0436361_0823858
448 Ga0436363_0420633
449 Ga0451577_0009755
450 Ga0453684_0233568
451 Ga0451576_0059155
452 Ga0466967_0193168
453 Ga0466967_0206458
454 Ga0495629_0260906
455 Ga0495629_0401874
456 Ga0495651_0016567
457 Ga0495653_0047598
458 Ga0495580_0017151
459 Ga0495580_0257472
460 Ga0495580_0522180
461 Ga0495580_0522189
462 Ga0495582_0352723
463 Ga0495605_0058330
464 Ga0495662_0034991
465 Ga0495594_0020912
466 Ga0495608_0164713
467 Ga0495618_0100861
468 Ga0495618_0107308
469 Ga0495618_0135403
470 Ga0495628_0043607
471 Ga0495628_0068534
472 Ga0495628_0108886
473 Ga0495630_0292401
474 Ga0495652_0315449
475 Ga0495665_0242910
476 Ga0495587_0038846
477 Ga0495645_0009025
478 Ga0495645_0112123
479 Ga0495667_0011610
480 Ga0495667_0091895
481 Ga0495668_0389689
482 Ga0495634_0170695
483 Ga0495635_0099115
484 Ga0495635_0157631
485 Ga0495657_0007716
486 Ga0495623_0018913
487 Ga0495646_0011041
488 Ga0495669_0024096
489 Ga0495613_0009964
490 Ga0495613_0184628
491 Ga0495600_0091034
492 Ga0495600_0283174
493 Ga0495600_0566292
494 Ga0495581_0032829
495 Ga0495581_0232385
496 Ga0495674_0011391
497 Ga0495674_0318476
498 Ga0495680_0032129
499 Ga0495683_0105615
500 Ga0495684_0217550
501 Ga0495602_0214656
502 Ga0496102_0559713
503 Ga0496103_0494487
504 Ga0496104_0015667
505 Ga0496104_0212527
506 Ga0496104_0842527
507 Ga0496105_0186952
508 Ga0496105_0312104
509 Ga0496108_0846893
510 Ga0496108_1057314
511 Ga0496109_1048872
512 Ga0496109_1127091
513 Ga0496110_0257916
514 Ga0496111_0001303
515 Ga0496112_0310945
516 Ga0496112_0329634
517 Ga0496112_0362808
518 Ga0496112_0833578
519 Ga0496113_0212051
520 Ga0496113_0551561
521 Ga0496114_0350864
522 Ga0496114_0410764
523 Ga0496115_0347556
524 Ga0496115_0419393
525 Ga0501036_0306758
526 Ga0501039_0137636
527 Ga0501071_0137640
528 Ga0501073_0002882
529 Ga0501075_0351521
530 Ga0501080_0001163
531 Ga0501035_0341813
532 nmdc:mga05p37_10950_c1
533 nmdc:mga05p37_38505_c1
534 nmdc:mga05p37_4620_c1
535 nmdc:mga05p37_50197_c1
536 nmdc:mga05p37_698735_c1
537 nmdc:mga09592_216993_c1
538 nmdc:mga06r32_854883_c1
539 nmdc:mga06r32_987595_c1
540 nmdc:mga08y16_322367_c1
541 nmdc:mga0n895_278255_c1
542 nmdc:mga0n895_320013_c1
543 nmdc:mga0n895_98583_c1
544 nmdc:mga0rr50_498893_c1
545 nmdc:mga0a205_105993_c1
546 nmdc:mga0a205_1167460_c1
547 nmdc:mga0a205_727400_c1
548 Ga0495655_0119928
549 Ga0495595_0351151
550 Ga0495619_0379207
551 Ga0500555_027936
552 Ga0501082_0853242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

154

203

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

42

110

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

148

201

0.91

Map