F380933

General Info

Members Datasets Scaffolds Average Seq Length
276 192 552 129

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100481568|Ga0070669_1004815681
Length 128
Sequence MGVLGMGGLFFRSKDPEALSAWYKEHLGVGGGCVAEGADDTPNEWVWTTRGGPMVFQPFKAETDYFPADKGHMINLRVTGLDGMLDELRAAGIEVITKPEWDDPSLGRFARIHDPEGNAVELWEQPAG

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
91 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
92 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
93 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
94 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
164 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
165 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
166 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
174 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
183 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
184 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
185 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
186 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
187 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
188 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
189 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
190 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
191 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
192 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.77
Nodule 0
Rhizoplane 8.33
Rhizosphere 72.83
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100481568 3300005353 Bacteria 1027
2 Ga0065715_10179406 3300005293 Bacteria 1487
3 Ga0070658_10048233 3300005327 Bacteria 3447
4 Ga0070690_100022973 3300005330 Bacteria 3820
5 Ga0070670_100065416 3300005331 Bacteria 3120
6 Ga0068869_100169726 3300005334 Bacteria 1704
7 Ga0068869_101553911 3300005334 Bacteria 588
8 Ga0070666_10213461 3300005335 Bacteria 1360
9 Ga0070660_100277189 3300005339 Unclassified 1372
10 Ga0070689_100164363 3300005340 Bacteria 1796
11 Ga0070668_100053141 3300005347 Bacteria 3124
12 Ga0070668_100935444 3300005347 Bacteria 776
13 Ga0070675_100469612 3300005354 Bacteria 1130
14 Ga0070675_101507464 3300005354 Bacteria 620
15 Ga0070671_100006584 3300005355 Bacteria 9286
16 Ga0070671_100025736 3300005355 Bacteria 4831
17 Ga0070671_100176314 3300005355 Bacteria 1809
18 Ga0070674_101623235 3300005356 Bacteria 583
19 Ga0070688_101484321 3300005365 Bacteria 551
20 Ga0070659_100273051 3300005366 Bacteria 1405
21 Ga0070667_100000245 3300005367 Bacteria 61419
22 Ga0070667_100352466 3300005367 Bacteria 1333
23 Ga0070663_101620242 3300005455 Bacteria 577
24 Ga0070678_100020862 3300005456 Bacteria 4306
25 Ga0068867_100009276 3300005459 Bacteria 6943
26 Ga0068867_100226646 3300005459 Bacteria 1509
27 Ga0070685_10187391 3300005466 Bacteria 1336
28 Ga0070672_100315476 3300005543 Bacteria 1328
29 Ga0070672_100353989 3300005543 Bacteria 1252
30 Ga0070702_100879003 3300005615 Bacteria 700
31 Ga0070702_101003336 3300005615 Bacteria 661
32 Ga0068859_100025115 3300005617 Bacteria 5980
33 Ga0068864_100079826 3300005618 Bacteria 2866
34 Ga0068866_10004378 3300005718 Bacteria 5797
35 Ga0068861_100759381 3300005719 Bacteria 906
36 Ga0068861_101703623 3300005719 Bacteria 623
37 Ga0068863_100000376 3300005841 Bacteria 45410
38 Ga0068858_100039624 3300005842 Bacteria 4369
39 Ga0068858_100492235 3300005842 Bacteria 1184
40 Ga0068858_100902108 3300005842 Bacteria 864
41 Ga0068860_100213558 3300005843 Bacteria 1872
42 Ga0068862_100510912 3300005844 Bacteria 1142
43 Ga0068862_100754460 3300005844 Bacteria 947
44 Ga0081455_10822592 3300005937 Bacteria 582
45 Ga0081539_10038947 3300005985 Bacteria 2811
46 Ga0075368_10022644 3300006042 Bacteria 2393
47 Ga0075363_100019589 3300006048 Bacteria 3384
48 Ga0075364_10027619 3300006051 Bacteria 3627
49 Ga0075364_10286655 3300006051 Bacteria 1120
50 Ga0075364_10347421 3300006051 Bacteria 1011
51 Ga0075367_10000028 3300006178 Bacteria 31226
52 Ga0075367_10651568 3300006178 Bacteria 670
53 Ga0075366_10503591 3300006195 Bacteria 749
54 Ga0097621_100097408 3300006237 Bacteria 2470
55 Ga0097621_100164989 3300006237 Bacteria 1906
56 Ga0075370_10014876 3300006353 Bacteria 4156
57 Ga0075370_10378580 3300006353 Bacteria 848
58 Ga0068871_100613056 3300006358 Bacteria 991
59 Ga0068865_100130594 3300006881 Bacteria 1882
60 Ga0097620_100025115 3300006931 Bacteria 5980
61 Ga0111539_10630450 3300009094 Bacteria 1248
62 Ga0105245_10001496 3300009098 Bacteria 21142
63 Ga0105245_10127395 3300009098 Bacteria 2385
64 Ga0105243_10071750 3300009148 Bacteria 2801
65 Ga0105243_10103953 3300009148 Bacteria 2363
66 Ga0105241_10483770 3300009174 Bacteria 1101
67 Ga0105242_10029534 3300009176 Bacteria 4374
68 Ga0105248_10019302 3300009177 Bacteria 7543
69 Ga0105248_11794874 3300009177 Bacteria 696
70 Ga0157370_10067200 3300013104 Bacteria 3388
71 Ga0157369_12518511 3300013105 Bacteria 521
72 Ga0157378_10003477 3300013297 Bacteria 13982
73 Ga0157378_10662879 3300013297 Bacteria 1060
74 Ga0157375_10031470 3300013308 Bacteria 5016
75 Ga0157375_10170403 3300013308 Bacteria 2324
76 Ga0157380_12572362 3300014326 Bacteria 575
77 Ga0157379_10373145 3300014968 Bacteria 1308
78 Ga0163161_10010609 3300017792 Bacteria 6378
79 Ga0163161_10042526 3300017792 Bacteria 3268
80 Ga0209147_101661 3300025229 Bacteria 7319
81 Ga0207642_10002427 3300025899 Bacteria 5806
82 Ga0207680_10290248 3300025903 Bacteria 1138
83 Ga0207680_10427267 3300025903 Bacteria 939
84 Ga0207705_10036131 3300025909 Bacteria 3536
85 Ga0207662_11128071 3300025918 Bacteria 557
86 Ga0207657_10645061 3300025919 Bacteria 824
87 Ga0207681_11329931 3300025923 Bacteria 603
88 Ga0207694_10116846 3300025924 Bacteria 2126
89 Ga0207650_10048910 3300025925 Bacteria 3120
90 Ga0207650_10109861 3300025925 Bacteria 2133
91 Ga0207659_11311945 3300025926 Bacteria 621
92 Ga0207687_10010097 3300025927 Bacteria 6173
93 Ga0207644_10020369 3300025931 Bacteria 4510
94 Ga0207686_10105047 3300025934 Bacteria 1893
95 Ga0207686_10416382 3300025934 Bacteria 1027
96 Ga0207709_10294596 3300025935 Bacteria 1204
97 Ga0207670_10608294 3300025936 Bacteria 898
98 Ga0207669_10959621 3300025937 Unclassified 717
99 Ga0207704_11553429 3300025938 Unclassified 568
100 Ga0207691_10112699 3300025940 Bacteria 2417
101 Ga0207711_10128714 3300025941 Bacteria 2268
102 Ga0207711_10135988 3300025941 Bacteria 2207
103 Ga0207689_10182710 3300025942 Bacteria 1729
104 Ga0207668_10004151 3300025972 Bacteria 8497
105 Ga0207668_10924643 3300025972 Bacteria 777
106 Ga0207658_10000042 3300025986 Bacteria 134223
107 Ga0207658_10148669 3300025986 Bacteria 1906
108 Ga0207658_10901443 3300025986 Bacteria 805
109 Ga0207703_10000095 3300026035 Bacteria 104227
110 Ga0207703_10034135 3300026035 Bacteria 4036
111 Ga0207703_10922036 3300026035 Bacteria 837
112 Ga0207703_10985909 3300026035 Bacteria 808
113 Ga0207678_10515398 3300026067 Bacteria 1043
114 Ga0207641_10000046 3300026088 Bacteria 180836
115 Ga0207648_10006684 3300026089 Bacteria 11439
116 Ga0207676_10326803 3300026095 Bacteria 1410
117 Ga0207675_100072547 3300026118 Bacteria 3220
118 Ga0207675_100448140 3300026118 Bacteria 1279
119 Ga0207675_102702445 3300026118 Bacteria 505
120 Ga0207683_10039413 3300026121 Bacteria 4122
121 Ga0207683_10184826 3300026121 Unclassified 1891
122 Ga0209813_10000410 3300027866 Bacteria 10474
123 Ga0268266_10000002 3300028379 Bacteria 3059047
124 Ga0268266_10469330 3300028379 Bacteria 1198
125 Ga0268266_10839664 3300028379 Bacteria 888
126 Ga0268265_10277120 3300028380 Bacteria 1499
127 Ga0268265_11060856 3300028380 Bacteria 803
128 Ga0268264_10020782 3300028381 Bacteria 5365
129 Ga0307517_10030669 3300028786 Bacteria 6292
130 Ga0316177_1117788 3300030731 Bacteria 2290
131 Ga0316176_1045159 3300030732 Bacteria 786
132 Ga0316178_1002727 3300030735 Bacteria 1612
133 Ga0316183_1060871 3300030742 Bacteria 955
134 Ga0316182_1024199 3300030745 Bacteria 1614
135 Ga0307408_100044863 3300031548 Bacteria 3153
136 Ga0307508_10002557 3300031616 Bacteria 19160
137 Ga0307405_10015217 3300031731 Bacteria 4160
138 Ga0307413_10144606 3300031824 Bacteria 1648
139 Ga0307413_10442855 3300031824 Bacteria 1029
140 Ga0307410_10049616 3300031852 Bacteria 2818
141 Ga0307410_10155093 3300031852 Bacteria 1709
142 Ga0307410_10236840 3300031852 Bacteria 1412
143 Ga0307406_10040260 3300031901 Bacteria 2905
144 Ga0307406_10043343 3300031901 Bacteria 2813
145 Ga0307407_10045497 3300031903 Bacteria 2480
146 Ga0307407_10385425 3300031903 Bacteria 1002
147 Ga0307407_10389121 3300031903 Bacteria 997
148 Ga0307407_10435634 3300031903 Bacteria 948
149 Ga0307412_10092687 3300031911 Bacteria 2117
150 Ga0307412_10118298 3300031911 Bacteria 1903
151 Ga0307412_10590410 3300031911 Bacteria 939
152 Ga0307409_100100138 3300031995 Bacteria 2401
153 Ga0307414_10009846 3300032004 Bacteria 5510
154 Ga0307414_10027738 3300032004 Bacteria 3663
155 Ga0307414_10675403 3300032004 Bacteria 933
156 Ga0307414_11017133 3300032004 Bacteria 763
157 Ga0307411_10014911 3300032005 Bacteria 4343
158 Ga0307411_10094789 3300032005 Bacteria 2093
159 Ga0307415_101296652 3300032126 Bacteria 690
160 Ga0307415_102106110 3300032126 Bacteria 551
161 Ga0373927_0055294 3300035695 Bacteria 2567
162 Ga0373937_1929521 3300036401 Bacteria 537
163 Ga0395899_0043350 3300037312 Bacteria 3356
164 Ga0395898_0188392 3300037466 Bacteria 1971
165 Ga0395905_0102961 3300037471 Bacteria 2680
166 Ga0436364_0741418 3300037853 Bacteria 2557
167 Ga0395901_0112112 3300038443 Bacteria 2864
168 Ga0395901_1057040 3300038443 Bacteria 784
169 Ga0451791_0610585 3300041451 Bacteria 514
170 Ga0451793_1841229 3300041452 Bacteria 551
171 Ga0451802_0505743 3300041460 Bacteria 538
172 Ga0495617_005755 3300046452 Bacteria 4377
173 Ga0495627_000112 3300046453 Bacteria 101337
174 Ga0495627_000206 3300046453 Bacteria 63802
175 Ga0495638_0000029 3300046460 Bacteria 330201
176 Ga0495638_0580283 3300046460 Bacteria 553
177 Ga0495650_0000641 3300046471 Bacteria 46353
178 Ga0495583_0000147 3300046506 Bacteria 119035
179 Ga0495608_0337022 3300046511 Bacteria 930
180 Ga0495610_0000085 3300046512 Bacteria 112390
181 Ga0495610_0225431 3300046512 Bacteria 755
182 Ga0495616_0000009 3300046513 Bacteria 225502
183 Ga0495632_0000007 3300046519 Bacteria 343246
184 Ga0495632_0001784 3300046519 Bacteria 17353
185 Ga0495637_0001069 3300046520 Bacteria 17094
186 Ga0495637_0008724 3300046520 Bacteria 4969
187 Ga0495643_0000070 3300046522 Bacteria 170879
188 Ga0495648_0000020 3300046524 Bacteria 254330
189 Ga0495648_0010262 3300046524 Bacteria 7152
190 Ga0495648_0037206 3300046524 Bacteria 3130
191 Ga0495663_0000005 3300046525 Bacteria 342265
192 Ga0495666_0287122 3300046526 Bacteria 745
193 Ga0495633_0000136 3300046558 Bacteria 97314
194 Ga0495633_0002421 3300046558 Bacteria 13190
195 Ga0495633_0018549 3300046558 Bacteria 3531
196 Ga0495633_0024725 3300046558 Bacteria 2964
197 Ga0495633_0037666 3300046558 Bacteria 2313
198 Ga0495633_0069938 3300046558 Bacteria 1638
199 Ga0495668_0015654 3300046616 Bacteria 4424
200 Ga0495625_0180177 3300046660 Bacteria 1406
201 Ga0495661_0131066 3300046665 Bacteria 1373
202 Ga0495671_0000022 3300046692 Bacteria 255591
203 Ga0495671_0000039 3300046692 Bacteria 170879
204 Ga0495673_0000051 3300047469 Bacteria 255511
205 Ga0495673_0073382 3300047469 Bacteria 1434
206 Ga0495681_0000013 3300047470 Bacteria 189155
207 Ga0495686_0005745 3300047472 Bacteria 9697
208 Ga0495686_0090355 3300047472 Bacteria 1860
209 Ga0496100_0133154 3300048903 Bacteria 1753
210 Ga0496100_0851130 3300048903 Bacteria 715
211 Ga0496101_0014906 3300048904 Bacteria 5230
212 Ga0496101_0052752 3300048904 Bacteria 2933
213 Ga0496102_0020076 3300048905 Bacteria 5899
214 Ga0496102_0131949 3300048905 Bacteria 2339
215 Ga0496103_0065952 3300048906 Bacteria 2259
216 Ga0496104_0026122 3300048907 Bacteria 5387
217 Ga0496105_0010376 3300048908 Bacteria 7323
218 Ga0496106_0197294 3300048909 Bacteria 1601
219 Ga0496106_0794816 3300048909 Bacteria 751
220 Ga0496107_0031450 3300048910 Bacteria 3788
221 Ga0496107_0202759 3300048910 Bacteria 1474
222 Ga0496109_0306729 3300048912 Bacteria 1497
223 Ga0496110_0072149 3300048913 Bacteria 3063
224 Ga0496111_0014992 3300048914 Bacteria 5310
225 Ga0496111_0230301 3300048914 Bacteria 1376
226 Ga0496114_0001664 3300048917 Bacteria 16868
227 Ga0496114_0017057 3300048917 Bacteria 5857
228 Ga0496115_0434367 3300048918 Bacteria 1062
229 Ga0496117_0057940 3300048920 Bacteria 2686
230 Ga0496118_0056568 3300048921 Bacteria 2948
231 Ga0496119_0094582 3300048922 Bacteria 1690
232 Ga0496120_0065403 3300048923 Bacteria 2015
233 Ga0496121_0000652 3300048924 Bacteria 64960
234 Ga0496123_0059217 3300048926 Bacteria 2478
235 Ga0496124_0037223 3300048927 Bacteria 4234
236 Ga0496125_0150002 3300048928 Bacteria 1603
237 Ga0496126_0991705 3300048929 Bacteria 631
238 Ga0495682_0176341 3300049460 Bacteria 760
239 Ga0501034_0199085 3300049571 Bacteria 1962
240 Ga0501224_013353 3300049664 Bacteria 1213
241 Ga0501249_000488 3300049679 Bacteria 9794
242 Ga0501259_032446 3300049688 Bacteria 992
243 Ga0501226_022038 3300049853 Bacteria 707
244 nmdc:mga03n38_44523_c1 3300050490 Bacteria 1950
245 nmdc:mga03n38_719949_c1 3300050490 Bacteria 576
246 nmdc:mga00v17_111185_c1 3300050491 Bacteria 1738
247 nmdc:mga00v17_252004_c1 3300050491 Bacteria 1145
248 nmdc:mga00v17_9163_c1 3300050491 Bacteria 5343
249 nmdc:mga0k408_37941_c1 3300050493 Bacteria 2766
250 nmdc:mga06z11_255_c1 3300050494 Bacteria 20756
251 nmdc:mga04h51_62_c1 3300050495 Bacteria 34326
252 nmdc:mga07m45_12534_c1 3300050496 Bacteria 4482
253 Ga0500643_000925 3300053087 Bacteria 18421
254 Ga0500562_002049 3300053108 Bacteria 5034
255 Ga0500562_071552 3300053108 Bacteria 936
256 Ga0500595_040681 3300053119 Bacteria 1498
257 Ga0500607_139942 3300053121 Bacteria 1140
258 Ga0500559_0001226 3300053136 Bacteria 15189
259 Ga0500559_0235928 3300053136 Bacteria 862
260 Ga0500559_0279387 3300053136 Bacteria 785
261 Ga0500559_0335821 3300053136 Bacteria 708
262 Ga0500568_0036967 3300053139 Bacteria 1984
263 Ga0500604_0019056 3300053151 Bacteria 1918
264 Ga0500616_0020704 3300053153 Bacteria 3693
265 Ga0500622_0158306 3300053156 Bacteria 1064
266 Ga0500624_000028 3300053157 Bacteria 106675
267 Ga0500627_0000576 3300053158 Bacteria 9881
268 Ga0500596_000590 3300053735 Bacteria 6958
269 Ga0500661_000095 3300055283 Bacteria 14070
270 2512644455 2512564014 Bacteria 4639632
271 2809063420 2808606401 Bacteria 4586670
272 2809079144 2808606404 Bacteria 4652788
273 2809083482 2808606405 Bacteria 4586632
274 2857484395 2857481737 Bacteria 4761446
275 2880520690 2880518877 Bacteria 5012590
276 2919712428 2919709256 Bacteria 4318106
277 Ga0070669_100481568
278 Ga0065715_10179406
279 Ga0070658_10048233
280 Ga0070690_100022973
281 Ga0070670_100065416
282 Ga0068869_100169726
283 Ga0068869_101553911
284 Ga0070666_10213461
285 Ga0070660_100277189
286 Ga0070689_100164363
287 Ga0070668_100053141
288 Ga0070668_100935444
289 Ga0070675_100469612
290 Ga0070675_101507464
291 Ga0070671_100006584
292 Ga0070671_100025736
293 Ga0070671_100176314
294 Ga0070674_101623235
295 Ga0070688_101484321
296 Ga0070659_100273051
297 Ga0070667_100000245
298 Ga0070667_100352466
299 Ga0070663_101620242
300 Ga0070678_100020862
301 Ga0068867_100009276
302 Ga0068867_100226646
303 Ga0070685_10187391
304 Ga0070672_100315476
305 Ga0070672_100353989
306 Ga0070702_100879003
307 Ga0070702_101003336
308 Ga0068859_100025115
309 Ga0068864_100079826
310 Ga0068866_10004378
311 Ga0068861_100759381
312 Ga0068861_101703623
313 Ga0068863_100000376
314 Ga0068858_100039624
315 Ga0068858_100492235
316 Ga0068858_100902108
317 Ga0068860_100213558
318 Ga0068862_100510912
319 Ga0068862_100754460
320 Ga0081455_10822592
321 Ga0081539_10038947
322 Ga0075368_10022644
323 Ga0075363_100019589
324 Ga0075364_10027619
325 Ga0075364_10286655
326 Ga0075364_10347421
327 Ga0075367_10000028
328 Ga0075367_10651568
329 Ga0075366_10503591
330 Ga0097621_100097408
331 Ga0097621_100164989
332 Ga0075370_10014876
333 Ga0075370_10378580
334 Ga0068871_100613056
335 Ga0068865_100130594
336 Ga0097620_100025115
337 Ga0111539_10630450
338 Ga0105245_10001496
339 Ga0105245_10127395
340 Ga0105243_10071750
341 Ga0105243_10103953
342 Ga0105241_10483770
343 Ga0105242_10029534
344 Ga0105248_10019302
345 Ga0105248_11794874
346 Ga0157370_10067200
347 Ga0157369_12518511
348 Ga0157378_10003477
349 Ga0157378_10662879
350 Ga0157375_10031470
351 Ga0157375_10170403
352 Ga0157380_12572362
353 Ga0157379_10373145
354 Ga0163161_10010609
355 Ga0163161_10042526
356 Ga0209147_101661
357 Ga0207642_10002427
358 Ga0207680_10290248
359 Ga0207680_10427267
360 Ga0207705_10036131
361 Ga0207662_11128071
362 Ga0207657_10645061
363 Ga0207681_11329931
364 Ga0207694_10116846
365 Ga0207650_10048910
366 Ga0207650_10109861
367 Ga0207659_11311945
368 Ga0207687_10010097
369 Ga0207644_10020369
370 Ga0207686_10105047
371 Ga0207686_10416382
372 Ga0207709_10294596
373 Ga0207670_10608294
374 Ga0207669_10959621
375 Ga0207704_11553429
376 Ga0207691_10112699
377 Ga0207711_10128714
378 Ga0207711_10135988
379 Ga0207689_10182710
380 Ga0207668_10004151
381 Ga0207668_10924643
382 Ga0207658_10000042
383 Ga0207658_10148669
384 Ga0207658_10901443
385 Ga0207703_10000095
386 Ga0207703_10034135
387 Ga0207703_10922036
388 Ga0207703_10985909
389 Ga0207678_10515398
390 Ga0207641_10000046
391 Ga0207648_10006684
392 Ga0207676_10326803
393 Ga0207675_100072547
394 Ga0207675_100448140
395 Ga0207675_102702445
396 Ga0207683_10039413
397 Ga0207683_10184826
398 Ga0209813_10000410
399 Ga0268266_10000002
400 Ga0268266_10469330
401 Ga0268266_10839664
402 Ga0268265_10277120
403 Ga0268265_11060856
404 Ga0268264_10020782
405 Ga0307517_10030669
406 Ga0316177_1117788
407 Ga0316176_1045159
408 Ga0316178_1002727
409 Ga0316183_1060871
410 Ga0316182_1024199
411 Ga0307408_100044863
412 Ga0307508_10002557
413 Ga0307405_10015217
414 Ga0307413_10144606
415 Ga0307413_10442855
416 Ga0307410_10049616
417 Ga0307410_10155093
418 Ga0307410_10236840
419 Ga0307406_10040260
420 Ga0307406_10043343
421 Ga0307407_10045497
422 Ga0307407_10385425
423 Ga0307407_10389121
424 Ga0307407_10435634
425 Ga0307412_10092687
426 Ga0307412_10118298
427 Ga0307412_10590410
428 Ga0307409_100100138
429 Ga0307414_10009846
430 Ga0307414_10027738
431 Ga0307414_10675403
432 Ga0307414_11017133
433 Ga0307411_10014911
434 Ga0307411_10094789
435 Ga0307415_101296652
436 Ga0307415_102106110
437 Ga0373927_0055294
438 Ga0373937_1929521
439 Ga0395899_0043350
440 Ga0395898_0188392
441 Ga0395905_0102961
442 Ga0436364_0741418
443 Ga0395901_0112112
444 Ga0395901_1057040
445 Ga0451791_0610585
446 Ga0451793_1841229
447 Ga0451802_0505743
448 Ga0495617_005755
449 Ga0495627_000112
450 Ga0495627_000206
451 Ga0495638_0000029
452 Ga0495638_0580283
453 Ga0495650_0000641
454 Ga0495583_0000147
455 Ga0495608_0337022
456 Ga0495610_0000085
457 Ga0495610_0225431
458 Ga0495616_0000009
459 Ga0495632_0000007
460 Ga0495632_0001784
461 Ga0495637_0001069
462 Ga0495637_0008724
463 Ga0495643_0000070
464 Ga0495648_0000020
465 Ga0495648_0010262
466 Ga0495648_0037206
467 Ga0495663_0000005
468 Ga0495666_0287122
469 Ga0495633_0000136
470 Ga0495633_0002421
471 Ga0495633_0018549
472 Ga0495633_0024725
473 Ga0495633_0037666
474 Ga0495633_0069938
475 Ga0495668_0015654
476 Ga0495625_0180177
477 Ga0495661_0131066
478 Ga0495671_0000022
479 Ga0495671_0000039
480 Ga0495673_0000051
481 Ga0495673_0073382
482 Ga0495681_0000013
483 Ga0495686_0005745
484 Ga0495686_0090355
485 Ga0496100_0133154
486 Ga0496100_0851130
487 Ga0496101_0014906
488 Ga0496101_0052752
489 Ga0496102_0020076
490 Ga0496102_0131949
491 Ga0496103_0065952
492 Ga0496104_0026122
493 Ga0496105_0010376
494 Ga0496106_0197294
495 Ga0496106_0794816
496 Ga0496107_0031450
497 Ga0496107_0202759
498 Ga0496109_0306729
499 Ga0496110_0072149
500 Ga0496111_0014992
501 Ga0496111_0230301
502 Ga0496114_0001664
503 Ga0496114_0017057
504 Ga0496115_0434367
505 Ga0496117_0057940
506 Ga0496118_0056568
507 Ga0496119_0094582
508 Ga0496120_0065403
509 Ga0496121_0000652
510 Ga0496123_0059217
511 Ga0496124_0037223
512 Ga0496125_0150002
513 Ga0496126_0991705
514 Ga0495682_0176341
515 Ga0501034_0199085
516 Ga0501224_013353
517 Ga0501249_000488
518 Ga0501259_032446
519 Ga0501226_022038
520 nmdc:mga03n38_44523_c1
521 nmdc:mga03n38_719949_c1
522 nmdc:mga00v17_111185_c1
523 nmdc:mga00v17_252004_c1
524 nmdc:mga00v17_9163_c1
525 nmdc:mga0k408_37941_c1
526 nmdc:mga06z11_255_c1
527 nmdc:mga04h51_62_c1
528 nmdc:mga07m45_12534_c1
529 Ga0500643_000925
530 Ga0500562_002049
531 Ga0500562_071552
532 Ga0500595_040681
533 Ga0500607_139942
534 Ga0500559_0001226
535 Ga0500559_0235928
536 Ga0500559_0279387
537 Ga0500559_0335821
538 Ga0500568_0036967
539 Ga0500604_0019056
540 Ga0500616_0020704
541 Ga0500622_0158306
542 Ga0500624_000028
543 Ga0500627_0000576
544 Ga0500596_000590
545 Ga0500661_000095
546 2512644455
547 2809063420
548 2809079144
549 2809083482
550 2857484395
551 2880520690
552 2919712428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

8

123

0.82

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

122

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xi3-assembly1.cif.gz_AAA crystal structure of tetra-tandem repeat in extending region of large adhesion protein 0.8229 109 124
1sqi-assembly1.cif.gz_B structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases 0.8006 73 125
6ixn-assembly1.cif.gz_B crystal structure of isocitrate dehydrogenase from ostreococcus tauri in complex with nad+ and citrate 0.7645 109 125
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.7375 1 125
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.731 3 123
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.819 71 123 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7932 70 125 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7902 71 123 3.30.720.110
af_Q2FYM3_64_210_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7802 70 124 3.10.180.10
af_Q2FVX7_247_334_3.30.390.30 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.7737 82 123 3.30.390.30
ID Description Score Start End GO Terms
AF-A0A3D3SIC2-F1-model_v4 deleted 0.9604 65 127
AF-A0A3D3SIC2-F1-model_v4 deleted 0.9318 65 127
AF-A0A847BG19-F1-model_v4 VOC family protein 0.8492 73 125
AF-A0A402BDA0-F1-model_v4 VOC domain-containing protein 0.8308 67 127
AF-A0A7W9V8U4-F1-model_v4 deleted 0.8304 1 126

Map