F380472

General Info

Members Datasets Scaffolds Average Seq Length
275 174 550 355

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10054552|Ga0207684_100545523
Length 427
Sequence VLSAAKHLLFSTFDSRFFVAPLLRMTAWSDSQRAAQPSQESAFGHGRPMKQRMNHRPTNMASRESGPSRGQAPKPGSPESFIIAPDDRILVTGAAGFIGSRVVESLLDRGFRHVVCFARPSSDLARLEASIKGRPPGARIEVLRGNLLSRADCEAASKGVTVIYHLAAGTGEKSFPDAFMNSVVTTRNLLEASVKYACLKRFVLVSSFAVYTNRQKSRRLDESCPVEPHPELSGNAYCFAKVKQEQIVTEFSKKFAIPYVIVRPGSVYGPGHTEITGRVGIRVFGPFLHFGGFNRIPFAYVDNCAEAIVLAGLVRGVEGETFNVLDDDTPSSRRFLKLYKQNVRAFKSAYVPHMFSYALCYLWEKYSQISEGQLPPAFNRRRWYAEWRRTSYSNRKIKERLGWVPKVPTSEALRLYFSSCAQGRQHA

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.09
Rhizosphere 98.91
Stem 0
Stem Tuber 0
Unclassified 16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10054552 3300025910 Bacteria 3391
2 Ga0065707_10112656 3300005295 Bacteria 2353
3 Ga0070690_100010121 3300005330 Bacteria 5479
4 Ga0070690_100054237 3300005330 Bacteria 2566
5 Ga0068868_100067173 3300005338 Bacteria 2853
6 Ga0070689_100000051 3300005340 Bacteria 73958
7 Ga0070689_100063282 3300005340 Unclassified 2879
8 Ga0070687_100084881 3300005343 Bacteria 1736
9 Ga0070675_100000514 3300005354 Bacteria 26343
10 Ga0070675_100338006 3300005354 Unclassified 1333
11 Ga0070673_100004423 3300005364 Bacteria 8892
12 Ga0070673_100008901 3300005364 Bacteria 6709
13 Ga0070688_100000243 3300005365 Bacteria 28823
14 Ga0070688_100007413 3300005365 Bacteria 5913
15 Ga0070714_100000975 3300005435 Bacteria 20443
16 Ga0070714_100018557 3300005435 Bacteria 5654
17 Ga0070714_100140669 3300005435 Bacteria 2166
18 Ga0070713_100212796 3300005436 Bacteria 1751
19 Ga0070713_100287751 3300005436 Bacteria 1509
20 Ga0070701_10001995 3300005438 Bacteria 7738
21 Ga0070701_10007899 3300005438 Bacteria 4574
22 Ga0070700_100006403 3300005441 Bacteria 6294
23 Ga0070694_100006100 3300005444 Bacteria 7311
24 Ga0070694_100242952 3300005444 Unclassified 1359
25 Ga0070708_100049013 3300005445 Bacteria 3736
26 Ga0070708_100132564 3300005445 Bacteria 2307
27 Ga0070678_100077021 3300005456 Unclassified 2514
28 Ga0070681_10229870 3300005458 Bacteria 1769
29 Ga0068867_100000941 3300005459 Bacteria 19796
30 Ga0068867_100243845 3300005459 Bacteria 1458
31 Ga0070685_10001116 3300005466 Bacteria 14352
32 Ga0070706_100001780 3300005467 Bacteria 22315
33 Ga0070706_100011497 3300005467 Bacteria 8229
34 Ga0070706_100064328 3300005467 Bacteria 3390
35 Ga0070706_100155347 3300005467 Unclassified 2136
36 Ga0070698_100084046 3300005471 Bacteria 3172
37 Ga0070698_100095094 3300005471 Bacteria 2958
38 Ga0070699_100076845 3300005518 Unclassified 2906
39 Ga0070697_100026084 3300005536 Unclassified 4664
40 Ga0070697_100027535 3300005536 Bacteria 4548
41 Ga0070697_100058274 3300005536 Bacteria 3143
42 Ga0070686_100000074 3300005544 Bacteria 73901
43 Ga0070686_100003294 3300005544 Bacteria 8841
44 Ga0070704_100052674 3300005549 Bacteria 2872
45 Ga0068855_100000682 3300005563 Bacteria 41517
46 Ga0068857_100020075 3300005577 Bacteria 5875
47 Ga0068856_100134574 3300005614 Bacteria 2477
48 Ga0068852_100026840 3300005616 Unclassified 4687
49 Ga0068859_100033225 3300005617 Bacteria 5181
50 Ga0068863_100003512 3300005841 Bacteria 15469
51 Ga0068858_100096472 3300005842 Bacteria 2755
52 Ga0081455_10000468 3300005937 Bacteria 52454
53 Ga0097621_100001006 3300006237 Bacteria 19840
54 Ga0097621_100142495 3300006237 Bacteria 2049
55 Ga0068871_100000933 3300006358 Bacteria 19508
56 Ga0068871_100088255 3300006358 Bacteria 2580
57 Ga0075428_100067681 3300006844 Unclassified 3908
58 Ga0075430_100000205 3300006846 Bacteria 40377
59 Ga0075430_100064803 3300006846 Unclassified 3070
60 Ga0075431_100000772 3300006847 Bacteria 27775
61 Ga0075431_100074517 3300006847 Viruses 3502
62 Ga0075431_100222065 3300006847 Unclassified 1927
63 Ga0075433_10192182 3300006852 Bacteria 1816
64 Ga0075433_10197252 3300006852 Bacteria 1790
65 Ga0075434_100001758 3300006871 Bacteria 18632
66 Ga0075434_100006708 3300006871 Bacteria 10576
67 Ga0075434_100021278 3300006871 Bacteria 6304
68 Ga0075434_100046219 3300006871 Unclassified 4320
69 Ga0075434_100064050 3300006871 Bacteria 3660
70 Ga0075429_100048730 3300006880 Unclassified 3683
71 Ga0068865_100000235 3300006881 Bacteria 30781
72 Ga0075436_100025833 3300006914 Bacteria 4042
73 Ga0075436_100033038 3300006914 Unclassified 3565
74 Ga0097620_100033225 3300006931 Bacteria 5181
75 Ga0075435_100034770 3300007076 Bacteria 3995
76 Ga0099794_10002458 3300007265 Bacteria 6830
77 Ga0099794_10018815 3300007265 Bacteria 3102
78 Ga0099795_10000106 3300007788 Bacteria 13793
79 Ga0105240_10000485 3300009093 Bacteria 73513
80 Ga0105240_10004963 3300009093 Bacteria 20004
81 Ga0105245_10014863 3300009098 Bacteria 6780
82 Ga0114129_10002871 3300009147 Bacteria 24116
83 Ga0114129_10009828 3300009147 Bacteria 13644
84 Ga0114129_10015346 3300009147 Bacteria 10899
85 Ga0114129_10041590 3300009147 Bacteria 6474
86 Ga0114129_10137765 3300009147 Unclassified 3348
87 Ga0114129_10212773 3300009147 Bacteria 2612
88 Ga0114129_10213374 3300009147 Bacteria 2608
89 Ga0105241_10024699 3300009174 Bacteria 4464
90 Ga0105242_10001186 3300009176 Bacteria 20541
91 Ga0105242_10031245 3300009176 Unclassified 4251
92 Ga0105242_10152587 3300009176 Unclassified 2016
93 Ga0105248_10004420 3300009177 Bacteria 15561
94 Ga0105248_10053638 3300009177 Bacteria 4523
95 Ga0105237_10208531 3300009545 Bacteria 1954
96 Ga0105238_10027455 3300009551 Bacteria 5801
97 Ga0105249_10048222 3300009553 Bacteria 3883
98 Ga0099796_10000927 3300010159 Bacteria 5454
99 Ga0105239_10049431 3300010375 Unclassified 4611
100 Ga0157370_10015943 3300013104 Bacteria 7624
101 Ga0157369_10026854 3300013105 Bacteria 6384
102 Ga0157374_10004014 3300013296 Bacteria 12373
103 Ga0157374_10004421 3300013296 Bacteria 11818
104 Ga0157374_10017458 3300013296 Bacteria 6319
105 Ga0157374_10022764 3300013296 Bacteria 5595
106 Ga0157378_10004198 3300013297 Bacteria 12718
107 Ga0157378_10110610 3300013297 Unclassified 2518
108 Ga0157378_10135620 3300013297 Unclassified 2282
109 Ga0157372_10016215 3300013307 Bacteria 7993
110 Ga0157372_10019867 3300013307 Bacteria 7239
111 Ga0157375_10099918 3300013308 Bacteria 2981
112 Ga0163163_10163803 3300014325 Unclassified 2269
113 Ga0157380_10011182 3300014326 Bacteria 6477
114 Ga0157379_10185474 3300014968 Bacteria 1880
115 Ga0157379_10341900 3300014968 Bacteria 1369
116 Ga0157376_10008860 3300014969 Bacteria 7280
117 Ga0157376_10123829 3300014969 Bacteria 2295
118 Ga0207684_10000331 3300025910 Bacteria 66229
119 Ga0207684_10002868 3300025910 Bacteria 17112
120 Ga0207684_10011871 3300025910 Bacteria 7592
121 Ga0207684_10123090 3300025910 Unclassified 2224
122 Ga0207654_10083676 3300025911 Bacteria 1927
123 Ga0207695_10000491 3300025913 Bacteria 84480
124 Ga0207695_10275234 3300025913 Archaea 1578
125 Ga0207662_10053013 3300025918 Bacteria 2415
126 Ga0207662_10092048 3300025918 Unclassified 1866
127 Ga0207646_10210764 3300025922 Unclassified 1755
128 Ga0207694_10027452 3300025924 Unclassified 4336
129 Ga0207659_10000191 3300025926 Bacteria 36537
130 Ga0207664_10001271 3300025929 Bacteria 16636
131 Ga0207664_10007163 3300025929 Bacteria 7733
132 Ga0207664_10075979 3300025929 Bacteria 2718
133 Ga0207686_10009367 3300025934 Bacteria 5311
134 Ga0207670_10000060 3300025936 Bacteria 77828
135 Ga0207670_10035537 3300025936 Bacteria 3232
136 Ga0207711_10024536 3300025941 Bacteria 5055
137 Ga0207711_10259464 3300025941 Unclassified 1597
138 Ga0207667_10000317 3300025949 Bacteria 67128
139 Ga0207651_10005483 3300025960 Bacteria 6522
140 Ga0207651_10043541 3300025960 Bacteria 2997
141 Ga0207677_10069460 3300026023 Bacteria 2478
142 Ga0207703_10092513 3300026035 Bacteria 2545
143 Ga0207703_10153705 3300026035 Bacteria 2009
144 Ga0207708_10009613 3300026075 Bacteria 7169
145 Ga0207702_10142049 3300026078 Bacteria 2174
146 Ga0207641_10001369 3300026088 Bacteria 24139
147 Ga0207648_10007581 3300026089 Bacteria 10644
148 Ga0207674_10028561 3300026116 Bacteria 5886
149 Ga0207675_100392444 3300026118 Bacteria 1366
150 Ga0207683_10126721 3300026121 Unclassified 2295
151 Ga0207698_10020721 3300026142 Unclassified 4531
152 Ga0209588_1004945 3300027671 Unclassified 3790
153 Ga0209588_1033874 3300027671 Bacteria 1639
154 Ga0268266_10017853 3300028379 Bacteria 6046
155 Ga0265319_1000301 3300028563 Bacteria 36705
156 Ga0265318_10004918 3300028577 Bacteria 6372
157 Ga0265760_10049860 3300031090 Bacteria 1259
158 Ga0265330_10000393 3300031235 Bacteria 30125
159 Ga0265332_10008222 3300031238 Bacteria 4691
160 Ga0265320_10000218 3300031240 Bacteria 46495
161 Ga0265325_10006581 3300031241 Bacteria 7038
162 Ga0265325_10010036 3300031241 Bacteria 5502
163 Ga0265325_10050488 3300031241 Bacteria 2142
164 Ga0265325_10051277 3300031241 Bacteria 2122
165 Ga0265329_10022490 3300031242 Unclassified 2108
166 Ga0265339_10001485 3300031249 Bacteria 17319
167 Ga0265339_10005138 3300031249 Bacteria 8778
168 Ga0265316_10002063 3300031344 Bacteria 21156
169 Ga0265316_10006021 3300031344 Bacteria 11662
170 Ga0265316_10029379 3300031344 Bacteria 4522
171 Ga0265316_10036465 3300031344 Bacteria 3976
172 Ga0265316_10085754 3300031344 Bacteria 2409
173 Ga0265313_10002659 3300031595 Bacteria 15178
174 Ga0265313_10007179 3300031595 Bacteria 7671
175 Ga0265314_10024405 3300031711 Bacteria 4585
176 Ga0265342_10000161 3300031712 Bacteria 75750
177 Ga0265342_10001489 3300031712 Bacteria 21730
178 Ga0373956_0062391 3300035119 Bacteria 1689
179 Ga0373955_0027949 3300035172 Unclassified 2921
180 Ga0373924_0015153 3300035410 Unclassified 2925
181 Ga0373935_0011864 3300035692 Bacteria 5235
182 Ga0373935_0236062 3300035692 Bacteria 1275
183 Ga0373927_0212999 3300035695 Bacteria 1269
184 Ga0373947_0041984 3300035725 Bacteria 2729
185 Ga0373937_0123797 3300036401 Unclassified 2411
186 Ga0436361_0048153 3300039447 Bacteria 35068
187 Ga0453684_0588154 3300044712 Unclassified 1221
188 Ga0451576_0148949 3300045051 Bacteria 2441
189 Ga0451576_0223097 3300045051 Bacteria 1968
190 Ga0451576_0276348 3300045051 Bacteria 1756
191 Ga0451576_0464570 3300045051 Bacteria 1329
192 Ga0495653_0035254 3300046463 Bacteria 3950
193 Ga0495580_0050665 3300046472 Bacteria 2936
194 Ga0495580_0132426 3300046472 Bacteria 1729
195 Ga0495582_0019910 3300046473 Bacteria 3671
196 Ga0495639_0027707 3300046475 Bacteria 2508
197 Ga0495662_0040377 3300046476 Bacteria 2253
198 Ga0495664_0000245 3300046477 Bacteria 26100
199 Ga0495594_0000050 3300046499 Bacteria 52300
200 Ga0495608_0008766 3300046511 Bacteria 7075
201 Ga0495630_0002329 3300046517 Bacteria 13211
202 Ga0495652_0020909 3300046529 Bacteria 5815
203 Ga0495665_0002961 3300046531 Bacteria 9170
204 Ga0495640_0007722 3300046533 Bacteria 8458
205 Ga0495586_0002156 3300046535 Bacteria 10692
206 Ga0495587_0028691 3300046536 Bacteria 3382
207 Ga0495598_0016543 3300046537 Unclassified 1884
208 Ga0495645_0176652 3300046543 Unclassified 1466
209 Ga0495667_0011875 3300046559 Bacteria 5900
210 Ga0495667_0041059 3300046559 Unclassified 3069
211 Ga0495667_0153138 3300046559 Bacteria 1484
212 Ga0495634_0014833 3300046642 Bacteria 5603
213 Ga0495635_0000559 3300046663 Bacteria 23713
214 Ga0495599_0090164 3300046678 Unclassified 1913
215 Ga0495646_0000207 3300046680 Bacteria 29021
216 Ga0495658_0033998 3300046683 Bacteria 2795
217 Ga0495613_0000499 3300046689 Bacteria 33220
218 Ga0495613_0001830 3300046689 Bacteria 16161
219 Ga0495613_0250057 3300046689 Unclassified 1237
220 Ga0495624_0014668 3300046690 Bacteria 5308
221 Ga0495600_0000778 3300046809 Bacteria 16837
222 Ga0495581_0000216 3300047315 Bacteria 27030
223 Ga0495604_0001241 3300047317 Bacteria 20903
224 Ga0495674_0000777 3300047319 Bacteria 30336
225 Ga0495680_0024926 3300047322 Bacteria 4954
226 Ga0495675_0009288 3300047444 Bacteria 6117
227 Ga0495684_0007330 3300047471 Bacteria 8544
228 Ga0495614_0000166 3300048089 Bacteria 24175
229 Ga0496108_0233284 3300048911 Bacteria 1600
230 Ga0496112_0087658 3300048915 Bacteria 3080
231 Ga0496114_0021898 3300048917 Bacteria 5203
232 Ga0501034_0002031 3300049571 Bacteria 25437
233 Ga0501039_0150985 3300049575 Bacteria 1825
234 Ga0501041_0013320 3300049577 Bacteria 4873
235 Ga0501043_0223530 3300049579 Bacteria 1456
236 Ga0501047_0000851 3300049581 Bacteria 31367
237 Ga0501048_0078649 3300049582 Bacteria 2328
238 Ga0501071_0002671 3300049587 Bacteria 10916
239 Ga0501073_0007409 3300049589 Bacteria 8153
240 Ga0501075_0025604 3300049591 Bacteria 4335
241 Ga0501076_0005800 3300049592 Bacteria 8910
242 Ga0501080_0047466 3300049742 Bacteria 3998
243 nmdc:mga05p37_101628_c1 3300050507 Bacteria 3540
244 nmdc:mga05p37_12003_c1 3300050507 Bacteria 10338
245 nmdc:mga05p37_17155_c1 3300050507 Bacteria 8735
246 nmdc:mga05p37_177972_c1 3300050507 Viruses 2590
247 nmdc:mga05p37_514062_c1 3300050507 Bacteria 1371
248 nmdc:mga05p37_5432_c1 3300050507 Bacteria 14974
249 nmdc:mga09592_51566_c1 3300050508 Unclassified 3472
250 nmdc:mga0qj67_33884_c1 3300050509 Bacteria 3987
251 nmdc:mga06r32_200365_c1 3300050510 Bacteria 1984
252 nmdc:mga06r32_42132_c1 3300050510 Bacteria 4340
253 nmdc:mga06r32_82621_c1 3300050510 Bacteria 3129
254 nmdc:mga08y16_129749_c1 3300050511 Bacteria 2622
255 nmdc:mga0n895_1205_c1 3300050512 Bacteria 19071
256 nmdc:mga0n895_176418_c1 3300050512 Bacteria 2168
257 nmdc:mga0n895_48934_c1 3300050512 Unclassified 4140
258 nmdc:mga0n895_767_c1 3300050512 Bacteria 22787
259 nmdc:mga0rr50_24222_c1 3300050513 Unclassified 4201
260 nmdc:mga0rr50_373113_c1 3300050513 Bacteria 1202
261 nmdc:mga0rr50_42434_c1 3300050513 Bacteria 3322
262 nmdc:mga0rr50_59638_c1 3300050513 Bacteria 2866
263 nmdc:mga08x19_108496_c1 3300050514 Bacteria 1849
264 nmdc:mga08x19_122364_c1 3300050514 Bacteria 1745
265 nmdc:mga08x19_196908_c1 3300050514 Bacteria 1380
266 nmdc:mga08x19_27160_c1 3300050514 Unclassified 3578
267 nmdc:mga08x19_44837_c1 3300050514 Bacteria 2824
268 nmdc:mga0a205_273362_c1 3300050515 Bacteria 1566
269 nmdc:mga0a205_57481_c1 3300050515 Bacteria 1964
270 nmdc:mga0a205_7088_c1 3300050515 Bacteria 10127
271 Ga0495595_0064406 3300053084 Bacteria 1723
272 Ga0495619_0008755 3300053085 Bacteria 6398
273 Ga0501084_0003367 3300054114 Bacteria 12948
274 Ga0501084_0168757 3300054114 Bacteria 1847
275 Ga0501082_0027588 3300060353 Unclassified 4888
276 Ga0207684_10054552
277 Ga0065707_10112656
278 Ga0070690_100010121
279 Ga0070690_100054237
280 Ga0068868_100067173
281 Ga0070689_100000051
282 Ga0070689_100063282
283 Ga0070687_100084881
284 Ga0070675_100000514
285 Ga0070675_100338006
286 Ga0070673_100004423
287 Ga0070673_100008901
288 Ga0070688_100000243
289 Ga0070688_100007413
290 Ga0070714_100000975
291 Ga0070714_100018557
292 Ga0070714_100140669
293 Ga0070713_100212796
294 Ga0070713_100287751
295 Ga0070701_10001995
296 Ga0070701_10007899
297 Ga0070700_100006403
298 Ga0070694_100006100
299 Ga0070694_100242952
300 Ga0070708_100049013
301 Ga0070708_100132564
302 Ga0070678_100077021
303 Ga0070681_10229870
304 Ga0068867_100000941
305 Ga0068867_100243845
306 Ga0070685_10001116
307 Ga0070706_100001780
308 Ga0070706_100011497
309 Ga0070706_100064328
310 Ga0070706_100155347
311 Ga0070698_100084046
312 Ga0070698_100095094
313 Ga0070699_100076845
314 Ga0070697_100026084
315 Ga0070697_100027535
316 Ga0070697_100058274
317 Ga0070686_100000074
318 Ga0070686_100003294
319 Ga0070704_100052674
320 Ga0068855_100000682
321 Ga0068857_100020075
322 Ga0068856_100134574
323 Ga0068852_100026840
324 Ga0068859_100033225
325 Ga0068863_100003512
326 Ga0068858_100096472
327 Ga0081455_10000468
328 Ga0097621_100001006
329 Ga0097621_100142495
330 Ga0068871_100000933
331 Ga0068871_100088255
332 Ga0075428_100067681
333 Ga0075430_100000205
334 Ga0075430_100064803
335 Ga0075431_100000772
336 Ga0075431_100074517
337 Ga0075431_100222065
338 Ga0075433_10192182
339 Ga0075433_10197252
340 Ga0075434_100001758
341 Ga0075434_100006708
342 Ga0075434_100021278
343 Ga0075434_100046219
344 Ga0075434_100064050
345 Ga0075429_100048730
346 Ga0068865_100000235
347 Ga0075436_100025833
348 Ga0075436_100033038
349 Ga0097620_100033225
350 Ga0075435_100034770
351 Ga0099794_10002458
352 Ga0099794_10018815
353 Ga0099795_10000106
354 Ga0105240_10000485
355 Ga0105240_10004963
356 Ga0105245_10014863
357 Ga0114129_10002871
358 Ga0114129_10009828
359 Ga0114129_10015346
360 Ga0114129_10041590
361 Ga0114129_10137765
362 Ga0114129_10212773
363 Ga0114129_10213374
364 Ga0105241_10024699
365 Ga0105242_10001186
366 Ga0105242_10031245
367 Ga0105242_10152587
368 Ga0105248_10004420
369 Ga0105248_10053638
370 Ga0105237_10208531
371 Ga0105238_10027455
372 Ga0105249_10048222
373 Ga0099796_10000927
374 Ga0105239_10049431
375 Ga0157370_10015943
376 Ga0157369_10026854
377 Ga0157374_10004014
378 Ga0157374_10004421
379 Ga0157374_10017458
380 Ga0157374_10022764
381 Ga0157378_10004198
382 Ga0157378_10110610
383 Ga0157378_10135620
384 Ga0157372_10016215
385 Ga0157372_10019867
386 Ga0157375_10099918
387 Ga0163163_10163803
388 Ga0157380_10011182
389 Ga0157379_10185474
390 Ga0157379_10341900
391 Ga0157376_10008860
392 Ga0157376_10123829
393 Ga0207684_10000331
394 Ga0207684_10002868
395 Ga0207684_10011871
396 Ga0207684_10123090
397 Ga0207654_10083676
398 Ga0207695_10000491
399 Ga0207695_10275234
400 Ga0207662_10053013
401 Ga0207662_10092048
402 Ga0207646_10210764
403 Ga0207694_10027452
404 Ga0207659_10000191
405 Ga0207664_10001271
406 Ga0207664_10007163
407 Ga0207664_10075979
408 Ga0207686_10009367
409 Ga0207670_10000060
410 Ga0207670_10035537
411 Ga0207711_10024536
412 Ga0207711_10259464
413 Ga0207667_10000317
414 Ga0207651_10005483
415 Ga0207651_10043541
416 Ga0207677_10069460
417 Ga0207703_10092513
418 Ga0207703_10153705
419 Ga0207708_10009613
420 Ga0207702_10142049
421 Ga0207641_10001369
422 Ga0207648_10007581
423 Ga0207674_10028561
424 Ga0207675_100392444
425 Ga0207683_10126721
426 Ga0207698_10020721
427 Ga0209588_1004945
428 Ga0209588_1033874
429 Ga0268266_10017853
430 Ga0265319_1000301
431 Ga0265318_10004918
432 Ga0265760_10049860
433 Ga0265330_10000393
434 Ga0265332_10008222
435 Ga0265320_10000218
436 Ga0265325_10006581
437 Ga0265325_10010036
438 Ga0265325_10050488
439 Ga0265325_10051277
440 Ga0265329_10022490
441 Ga0265339_10001485
442 Ga0265339_10005138
443 Ga0265316_10002063
444 Ga0265316_10006021
445 Ga0265316_10029379
446 Ga0265316_10036465
447 Ga0265316_10085754
448 Ga0265313_10002659
449 Ga0265313_10007179
450 Ga0265314_10024405
451 Ga0265342_10000161
452 Ga0265342_10001489
453 Ga0373956_0062391
454 Ga0373955_0027949
455 Ga0373924_0015153
456 Ga0373935_0011864
457 Ga0373935_0236062
458 Ga0373927_0212999
459 Ga0373947_0041984
460 Ga0373937_0123797
461 Ga0436361_0048153
462 Ga0453684_0588154
463 Ga0451576_0148949
464 Ga0451576_0223097
465 Ga0451576_0276348
466 Ga0451576_0464570
467 Ga0495653_0035254
468 Ga0495580_0050665
469 Ga0495580_0132426
470 Ga0495582_0019910
471 Ga0495639_0027707
472 Ga0495662_0040377
473 Ga0495664_0000245
474 Ga0495594_0000050
475 Ga0495608_0008766
476 Ga0495630_0002329
477 Ga0495652_0020909
478 Ga0495665_0002961
479 Ga0495640_0007722
480 Ga0495586_0002156
481 Ga0495587_0028691
482 Ga0495598_0016543
483 Ga0495645_0176652
484 Ga0495667_0011875
485 Ga0495667_0041059
486 Ga0495667_0153138
487 Ga0495634_0014833
488 Ga0495635_0000559
489 Ga0495599_0090164
490 Ga0495646_0000207
491 Ga0495658_0033998
492 Ga0495613_0000499
493 Ga0495613_0001830
494 Ga0495613_0250057
495 Ga0495624_0014668
496 Ga0495600_0000778
497 Ga0495581_0000216
498 Ga0495604_0001241
499 Ga0495674_0000777
500 Ga0495680_0024926
501 Ga0495675_0009288
502 Ga0495684_0007330
503 Ga0495614_0000166
504 Ga0496108_0233284
505 Ga0496112_0087658
506 Ga0496114_0021898
507 Ga0501034_0002031
508 Ga0501039_0150985
509 Ga0501041_0013320
510 Ga0501043_0223530
511 Ga0501047_0000851
512 Ga0501048_0078649
513 Ga0501071_0002671
514 Ga0501073_0007409
515 Ga0501075_0025604
516 Ga0501076_0005800
517 Ga0501080_0047466
518 nmdc:mga05p37_101628_c1
519 nmdc:mga05p37_12003_c1
520 nmdc:mga05p37_17155_c1
521 nmdc:mga05p37_177972_c1
522 nmdc:mga05p37_514062_c1
523 nmdc:mga05p37_5432_c1
524 nmdc:mga09592_51566_c1
525 nmdc:mga0qj67_33884_c1
526 nmdc:mga06r32_200365_c1
527 nmdc:mga06r32_42132_c1
528 nmdc:mga06r32_82621_c1
529 nmdc:mga08y16_129749_c1
530 nmdc:mga0n895_1205_c1
531 nmdc:mga0n895_176418_c1
532 nmdc:mga0n895_48934_c1
533 nmdc:mga0n895_767_c1
534 nmdc:mga0rr50_24222_c1
535 nmdc:mga0rr50_373113_c1
536 nmdc:mga0rr50_42434_c1
537 nmdc:mga0rr50_59638_c1
538 nmdc:mga08x19_108496_c1
539 nmdc:mga08x19_122364_c1
540 nmdc:mga08x19_196908_c1
541 nmdc:mga08x19_27160_c1
542 nmdc:mga08x19_44837_c1
543 nmdc:mga0a205_273362_c1
544 nmdc:mga0a205_57481_c1
545 nmdc:mga0a205_7088_c1
546 Ga0495595_0064406
547 Ga0495619_0008755
548 Ga0501084_0003367
549 Ga0501084_0168757
550 Ga0501082_0027588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

89

213

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

89

324

0.84

PF07993

NAD_binding_4

Male sterility protein

91

305

0.83

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

90

415

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

90

343

0.75

PF13460

NAD_binding_10

NAD(P)H-binding

93

282

0.75

PF08659

KR

KR domain

88

218

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ak6-assembly1.cif.gz_P cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a 0.8201 13 272
3m2p-assembly3.cif.gz_E the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8055 11 352
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.8031 11 352
6rfq-assembly1.cif.gz_E cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.8022 6 275
6kv9-assembly1.cif.gz_A-2 moee5 in complex with udp-glucuronic acid and nad 0.8021 13 350
ID Description Score Start End Superfamily
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8715 9 121 3.40.50.20
af_I1KVW6_141_273_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8708 9 121 3.40.50.20
6bwlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8705 13 251 3.40.50.720
af_I1KG15_128_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8695 9 121 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8609 13 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V9PBB1-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9884 64 354
AF-A0A7V3WGU4-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9806 134 353
AF-A0A1E7IWL9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9779 1 354
AF-A0A1E7IWL9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9751 1 354
AF-A0A2V9PBB1-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9717 64 354

Map