F380392

General Info

Members Datasets Scaffolds Average Seq Length
275 202 267 217

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10002119|Ga0114129_1000211915
Length 211
Sequence VVAEDGVLLREGLVRLLMEAGHDVVAAVGDGPSLIAAVQNEKPDVSVVDVRMPPSHTDEGLRAAVALRRSGGRTPILVLSQYVELAYADDLLADARGAIGYLLKDAVVDVDGFLDALGRVAAGGTVLDPQVVAQLMIRRRNDPLAELTTREREVLALMAEGASNTAIAKRLVVTEGAVEKHITSIFGKLRLPQDSDQHRRVLAVLAYLRAP

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
4 2858868258 Micromonospora sp. MH33 Isolate Unclassified
5 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
6 2922554459 Rhodococcus sp. 66b Isolate Unclassified
7 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
130 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
131 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
132 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.73
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0.36
Rhizoplane 5.09
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10061704 3300005327 Bacteria 3054
2 Ga0070683_100056341 3300005329 Bacteria 3650
3 Ga0070680_100004650 3300005336 Bacteria 10321
4 Ga0070682_100011634 3300005337 Bacteria 5032
5 Ga0070661_100016038 3300005344 Bacteria 5288
6 Ga0070661_100569624 3300005344 Bacteria 913
7 Ga0070692_10130896 3300005345 Bacteria 1410
8 Ga0070692_10147180 3300005345 Bacteria 1338
9 Ga0070668_100007373 3300005347 Bacteria 8161
10 Ga0070674_100044039 3300005356 Bacteria 3040
11 Ga0070674_100213020 3300005356 Bacteria 1499
12 Ga0070659_100004387 3300005366 Bacteria 10075
13 Ga0070667_100000962 3300005367 Bacteria 26520
14 Ga0070700_100126349 3300005441 Bacteria 1720
15 Ga0070662_100011685 3300005457 Bacteria 5794
16 Ga0070681_10003735 3300005458 Bacteria 14290
17 Ga0068867_100015938 3300005459 Bacteria 5335
18 Ga0070698_100311059 3300005471 Bacteria 1506
19 Ga0070679_100015356 3300005530 Bacteria 7358
20 Ga0068853_100044004 3300005539 Bacteria 3821
21 Ga0068853_100376561 3300005539 Bacteria 1325
22 Ga0070665_100009376 3300005548 Bacteria 9904
23 Ga0070664_100102358 3300005564 Bacteria 2492
24 Ga0068854_100855140 3300005578 Bacteria 797
25 Ga0068856_100142605 3300005614 Bacteria 2403
26 Ga0068856_101360387 3300005614 Bacteria 725
27 Ga0070702_100043236 3300005615 Bacteria 2538
28 Ga0068852_100082076 3300005616 Bacteria 2863
29 Ga0068852_100253246 3300005616 Bacteria 1688
30 Ga0068859_100001201 3300005617 Bacteria 26431
31 Ga0068866_10008042 3300005718 Bacteria 4431
32 Ga0068861_100041721 3300005719 Bacteria 3437
33 Ga0068863_100002210 3300005841 Bacteria 19325
34 Ga0068863_100459510 3300005841 Bacteria 1250
35 Ga0068860_100000156 3300005843 Bacteria 111148
36 Ga0068862_100000019 3300005844 Bacteria 229485
37 Ga0068862_100064845 3300005844 Bacteria 3145
38 Ga0081455_10007438 3300005937 Bacteria 11538
39 Ga0081455_10101978 3300005937 Bacteria 2302
40 Ga0081540_1002138 3300005983 Bacteria 16440
41 Ga0070717_11029578 3300006028 Bacteria 750
42 Ga0075370_10098752 3300006353 Bacteria 1688
43 Ga0075428_100902566 3300006844 Bacteria 937
44 Ga0075431_100097050 3300006847 Bacteria 3043
45 Ga0075433_10002556 3300006852 Bacteria 13862
46 Ga0075434_100000203 3300006871 Bacteria 40085
47 Ga0075434_100704620 3300006871 Bacteria 1027
48 Ga0075436_100222034 3300006914 Bacteria 1341
49 Ga0097620_100001201 3300006931 Bacteria 26431
50 Ga0075435_100008338 3300007076 Bacteria 7427
51 Ga0075435_100105826 3300007076 Bacteria 2335
52 Ga0105240_10023223 3300009093 Bacteria 8211
53 Ga0111539_10168078 3300009094 Bacteria 2563
54 Ga0105245_11499167 3300009098 Bacteria 725
55 Ga0105247_10000023 3300009101 Bacteria 215645
56 Ga0114129_10002119 3300009147 Bacteria 27345
57 Ga0114129_10030640 3300009147 Bacteria 7610
58 Ga0105243_10008401 3300009148 Bacteria 7924
59 Ga0105242_10011571 3300009176 Bacteria 6785
60 Ga0105248_10000409 3300009177 Bacteria 49854
61 Ga0105237_10047121 3300009545 Bacteria 4334
62 Ga0105238_10207565 3300009551 Bacteria 1935
63 Ga0105238_10974481 3300009551 Bacteria 868
64 Ga0105249_10000033 3300009553 Bacteria 213834
65 Ga0105249_10021934 3300009553 Bacteria 5720
66 Ga0105239_10229511 3300010375 Bacteria 2083
67 Ga0157321_1000971 3300012487 Bacteria 1370
68 Ga0157371_10135044 3300013102 Bacteria 1757
69 Ga0157369_10084613 3300013105 Bacteria 3390
70 Ga0163162_10301836 3300013306 Bacteria 1733
71 Ga0157372_10027209 3300013307 Bacteria 6225
72 Ga0157372_10046833 3300013307 Bacteria 4802
73 Ga0163163_10028957 3300014325 Bacteria 5324
74 Ga0157380_10052726 3300014326 Bacteria 3222
75 Ga0206356_10870607 3300020070 Bacteria 978
76 Ga0206353_10838005 3300020082 Bacteria 3628
77 Ga0213875_10038416 3300021388 Bacteria 2255
78 Ga0207642_10002249 3300025899 Bacteria 6000
79 Ga0207710_10000343 3300025900 Bacteria 34190
80 Ga0207688_10055478 3300025901 Bacteria 2223
81 Ga0207688_10062819 3300025901 Bacteria 2094
82 Ga0207643_10115706 3300025908 Bacteria 1584
83 Ga0207643_10172981 3300025908 Bacteria 1304
84 Ga0207663_10155897 3300025916 Bacteria 1606
85 Ga0207660_10952578 3300025917 Bacteria 700
86 Ga0207662_10096132 3300025918 Bacteria 1829
87 Ga0207657_10007474 3300025919 Bacteria 11196
88 Ga0207649_10039415 3300025920 Bacteria 2865
89 Ga0207649_10137298 3300025920 Bacteria 1669
90 Ga0207652_10156561 3300025921 Bacteria 2041
91 Ga0207681_10018359 3300025923 Bacteria 4407
92 Ga0207681_10602783 3300025923 Bacteria 908
93 Ga0207687_10034267 3300025927 Bacteria 3447
94 Ga0207690_10038997 3300025932 Bacteria 3096
95 Ga0207706_10004126 3300025933 Bacteria 13707
96 Ga0207686_10014435 3300025934 Bacteria 4397
97 Ga0207709_10132304 3300025935 Bacteria 1702
98 Ga0207669_10035927 3300025937 Bacteria 2826
99 Ga0207669_10071852 3300025937 Bacteria 2176
100 Ga0207704_10305694 3300025938 Bacteria 1220
101 Ga0207691_10207438 3300025940 Bacteria 1703
102 Ga0207711_10000412 3300025941 Bacteria 45381
103 Ga0207689_10393405 3300025942 Bacteria 1155
104 Ga0207661_10007141 3300025944 Bacteria 7934
105 Ga0207661_10018983 3300025944 Bacteria 5116
106 Ga0207712_10000031 3300025961 Bacteria 213662
107 Ga0207712_10026989 3300025961 Bacteria 3832
108 Ga0207712_10460091 3300025961 Bacteria 1081
109 Ga0207668_10036899 3300025972 Bacteria 3267
110 Ga0207668_10118502 3300025972 Bacteria 2000
111 Ga0207640_10624364 3300025981 Bacteria 915
112 Ga0207658_10000792 3300025986 Bacteria 26813
113 Ga0207639_10068263 3300026041 Bacteria 2769
114 Ga0207708_10034431 3300026075 Bacteria 3853
115 Ga0207708_10162746 3300026075 Bacteria 1763
116 Ga0207641_10004679 3300026088 Bacteria 11806
117 Ga0207641_10400406 3300026088 Bacteria 1318
118 Ga0207648_10027899 3300026089 Bacteria 5009
119 Ga0207675_100002666 3300026118 Bacteria 17607
120 Ga0207698_10065673 3300026142 Bacteria 2852
121 Ga0207428_10019395 3300027907 Bacteria 5800
122 Ga0268266_10012172 3300028379 Bacteria 7445
123 Ga0268265_10000029 3300028380 Bacteria 229499
124 Ga0268265_10447366 3300028380 Bacteria 1206
125 Ga0268264_10000222 3300028381 Bacteria 111162
126 Ga0265338_10045639 3300028800 Bacteria 4026
127 Ga0307512_10072316 3300030522 Bacteria 2552
128 Ga0265340_10012326 3300031247 Bacteria 4517
129 Ga0307408_100263583 3300031548 Bacteria 1427
130 Ga0307508_10002281 3300031616 Bacteria 20405
131 Ga0307405_10003551 3300031731 Bacteria 7188
132 Ga0307413_10013990 3300031824 Bacteria 4058
133 Ga0307413_10602157 3300031824 Bacteria 900
134 Ga0307410_10002419 3300031852 Bacteria 9019
135 Ga0307410_10487768 3300031852 Bacteria 1012
136 Ga0307406_10006181 3300031901 Bacteria 6588
137 Ga0307406_10024104 3300031901 Bacteria 3630
138 Ga0307407_10000778 3300031903 Bacteria 10537
139 Ga0307407_10145779 3300031903 Bacteria 1533
140 Ga0307412_10005378 3300031911 Bacteria 7185
141 Ga0307409_100004287 3300031995 Bacteria 7976
142 Ga0307409_100372365 3300031995 Bacteria 1355
143 Ga0307409_101119865 3300031995 Bacteria 809
144 Ga0307416_100012657 3300032002 Bacteria 5694
145 Ga0307416_100032771 3300032002 Bacteria 3932
146 Ga0307416_100072115 3300032002 Bacteria 2873
147 Ga0307414_10000854 3300032004 Bacteria 15525
148 Ga0307411_10342875 3300032005 Bacteria 1215
149 Ga0307415_100005372 3300032126 Bacteria 6793
150 Ga0307415_100006096 3300032126 Bacteria 6466
151 Ga0307415_100187714 3300032126 Bacteria 1628
152 Ga0307415_100191861 3300032126 Bacteria 1613
153 Ga0307415_100300318 3300032126 Bacteria 1330
154 Ga0307415_101050344 3300032126 Bacteria 760
155 Ga0395899_0065241 3300037312 Bacteria 2676
156 Ga0395899_0201603 3300037312 Bacteria 1387
157 Ga0395900_0026891 3300037418 Bacteria 5888
158 Ga0395900_0052766 3300037418 Bacteria 4185
159 Ga0395900_0082315 3300037418 Bacteria 3307
160 Ga0395900_0268355 3300037418 Bacteria 1702
161 Ga0395898_0028593 3300037466 Bacteria 5586
162 Ga0395898_0041132 3300037466 Bacteria 4567
163 Ga0395898_0186273 3300037466 Bacteria 1983
164 Ga0395898_0297729 3300037466 Bacteria 1539
165 Ga0395898_0391362 3300037466 Bacteria 1325
166 Ga0395905_0115601 3300037471 Bacteria 2521
167 Ga0395905_0171762 3300037471 Bacteria 2036
168 Ga0436364_0086915 3300037853 Bacteria 6258
169 Ga0395901_0006433 3300038443 Bacteria 11902
170 Ga0395901_0010276 3300038443 Bacteria 9481
171 Ga0395901_0053845 3300038443 Bacteria 4181
172 Ga0395901_0139983 3300038443 Bacteria 2543
173 Ga0451837_1478034 3300041494 Bacteria 1119
174 Ga0451839_0843513 3300041496 Bacteria 851
175 Ga0439450_046068 3300042008 Bacteria 1025
176 Ga0439454_030254 3300042011 Bacteria 845
177 Ga0450902_046418 3300042137 Bacteria 743
178 Ga0439464_0038274 3300042439 Bacteria 1362
179 Ga0466965_0056288 3300044683 Bacteria 1958
180 Ga0466970_0149314 3300044765 Bacteria 1290
181 Ga0466957_0204395 3300044842 Bacteria 1298
182 Ga0466960_0019456 3300044901 Bacteria 2993
183 Ga0466960_0055033 3300044901 Bacteria 1934
184 Ga0466959_0713089 3300045049 Bacteria 672
185 Ga0466967_0091175 3300045976 Bacteria 2769
186 Ga0466967_1074401 3300045976 Bacteria 802
187 Ga0495651_0057714 3300046462 Bacteria 2980
188 Ga0495653_0279822 3300046463 Bacteria 1095
189 Ga0495594_0029303 3300046499 Bacteria 2974
190 Ga0495667_0317642 3300046559 Bacteria 986
191 Ga0495656_0245186 3300046615 Bacteria 903
192 Ga0495668_0000204 3300046616 Bacteria 86683
193 Ga0495674_0113160 3300047319 Bacteria 2299
194 Ga0495680_0470534 3300047322 Bacteria 857
195 Ga0496101_0001600 3300048904 Bacteria 13614
196 Ga0496102_0000629 3300048905 Bacteria 36066
197 Ga0496103_0000527 3300048906 Bacteria 31207
198 Ga0496105_0818322 3300048908 Bacteria 707
199 Ga0496108_0054108 3300048911 Bacteria 3368
200 Ga0496109_0014281 3300048912 Bacteria 6911
201 Ga0496109_0426244 3300048912 Bacteria 1253
202 Ga0496110_0057462 3300048913 Bacteria 3425
203 Ga0496110_0329742 3300048913 Bacteria 1390
204 Ga0496111_0147149 3300048914 Bacteria 1747
205 Ga0496112_0009320 3300048915 Bacteria 8833
206 Ga0496114_0004881 3300048917 Bacteria 10445
207 Ga0496114_0406961 3300048917 Bacteria 1205
208 Ga0496114_0495030 3300048917 Bacteria 1081
209 Ga0496116_0031160 3300048919 Bacteria 3822
210 Ga0496117_0000415 3300048920 Bacteria 71870
211 Ga0496118_0002279 3300048921 Bacteria 26185
212 Ga0496119_0015979 3300048922 Bacteria 5740
213 Ga0496120_0022236 3300048923 Bacteria 3991
214 Ga0496121_0004662 3300048924 Bacteria 18210
215 Ga0496124_0076375 3300048927 Bacteria 2765
216 Ga0496125_0016586 3300048928 Bacteria 7065
217 Ga0496126_0018446 3300048929 Bacteria 6913
218 Ga0496126_0032176 3300048929 Bacteria 4945
219 Ga0496126_0094430 3300048929 Bacteria 2625
220 Ga0501032_0002341 3300049569 Bacteria 14858
221 Ga0501033_0001065 3300049570 Bacteria 25048
222 Ga0501034_0003726 3300049571 Bacteria 17215
223 Ga0501034_0412961 3300049571 Bacteria 1271
224 Ga0501036_0000867 3300049572 Bacteria 22512
225 Ga0501037_0010476 3300049573 Bacteria 6809
226 Ga0501038_0000675 3300049574 Bacteria 30401
227 Ga0501039_0001531 3300049575 Bacteria 17007
228 Ga0501042_0201504 3300049578 Bacteria 1435
229 Ga0501043_0002968 3300049579 Bacteria 14139
230 Ga0501047_0010109 3300049581 Bacteria 8919
231 Ga0501048_0114435 3300049582 Bacteria 1905
232 Ga0501067_0004646 3300049583 Bacteria 7609
233 Ga0501067_0035865 3300049583 Bacteria 2754
234 Ga0501068_0257838 3300049584 Bacteria 1112
235 Ga0501069_0001048 3300049585 Bacteria 13212
236 Ga0501069_0044110 3300049585 Bacteria 2469
237 Ga0501069_0053594 3300049585 Bacteria 2246
238 Ga0501070_0008158 3300049586 Bacteria 8858
239 Ga0501070_0230218 3300049586 Bacteria 1518
240 Ga0501071_0080657 3300049587 Bacteria 2380
241 Ga0501073_0016240 3300049589 Bacteria 5396
242 Ga0501073_0041391 3300049589 Bacteria 3256
243 Ga0501079_0337253 3300049741 Bacteria 1181
244 Ga0501080_0005335 3300049742 Bacteria 11453
245 Ga0501080_0247795 3300049742 Bacteria 1624
246 Ga0501083_0021967 3300049744 Bacteria 4430
247 Ga0501035_0002522 3300049822 Bacteria 17914
248 Ga0501044_0042096 3300049823 Bacteria 4753
249 Ga0501044_0089959 3300049823 Bacteria 3098
250 Ga0501045_0212005 3300049824 Bacteria 1443
251 nmdc:mga07m45_65558_c1 3300050496 Bacteria 2062
252 nmdc:mga05p37_20304_c1 3300050507 Bacteria 8039
253 nmdc:mga09592_259948_c1 3300050508 Bacteria 1505
254 nmdc:mga0qj67_33785_c1 3300050509 Bacteria 3992
255 nmdc:mga0qj67_66759_c1 3300050509 Bacteria 2865
256 nmdc:mga06r32_97940_c1 3300050510 Bacteria 2874
257 nmdc:mga08y16_137957_c1 3300050511 Bacteria 2535
258 nmdc:mga08y16_299398_c1 3300050511 Bacteria 1658
259 nmdc:mga08y16_364722_c1 3300050511 Bacteria 1483
260 nmdc:mga08y16_72063_c1 3300050511 Bacteria 3600
261 nmdc:mga0n895_679153_c1 3300050512 Bacteria 1027
262 nmdc:mga0n895_76608_c1 3300050512 Bacteria 3326
263 nmdc:mga0rr50_3987_c1 3300050513 Bacteria 8601
264 nmdc:mga08x19_148068_c1 3300050514 Bacteria 1588
265 nmdc:mga0a205_23810_c1 3300050515 Bacteria 5811
266 Ga0501084_0003690 3300054114 Bacteria 12430
267 Ga0530510_0301864 3300061734 Bacteria 1198

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0713089 Ga0466959_0713089_28_630 200
2 3300048929 Ga0496126_0094430 Ga0496126_0094430_1171_1821 202
3 3300048908 Ga0496105_0818322 Ga0496105_0818322_79_696 205
4 iso_pu_bacteria 2565956761 2566996265 209
5 iso_pu_bacteria 2904535858 2904540903 209
6 iso_pu_bacteria 2922554459 2922554995 209
7 3300006844 Ga0075428_100902566 Ga0075428_1009025661 210
8 iso_pu_bacteria 2554235005 2554260321 210
9 iso_pu_bacteria 2738543005 2739206694 210
10 iso_pu_bacteria 2858868258 2858874501 210
11 iso_pu_bacteria 2928142448 2928145907 210
12 iso_pu_bacteria 8055412473 8055418807 210
13 3300006028 Ga0070717_11029578 Ga0070717_110295781 211
14 3300009147 Ga0114129_10002119 Ga0114129_1000211915 211
15 3300009551 Ga0105238_10974481 Ga0105238_109744811 211
16 3300050507 nmdc:mga05p37_20304_c1 nmdc:mga05p37_20304_c1_2428_3063 211
17 3300050508 nmdc:mga09592_259948_c1 nmdc:mga09592_259948_c1_108_743 211
18 3300005345 Ga0070692_10130896 Ga0070692_101308962 212
19 3300046615 Ga0495656_0245186 Ga0495656_0245186_43_681 212
20 3300005356 Ga0070674_100044039 Ga0070674_1000440392 213
21 3300005441 Ga0070700_100126349 Ga0070700_1001263491 213
22 3300005457 Ga0070662_100011685 Ga0070662_1000116854 213
23 3300005459 Ga0068867_100015938 Ga0068867_1000159384 213
24 3300005615 Ga0070702_100043236 Ga0070702_1000432362 213
25 3300005616 Ga0068852_100082076 Ga0068852_1000820762 213
26 3300005718 Ga0068866_10008042 Ga0068866_100080423 213
27 3300005719 Ga0068861_100041721 Ga0068861_1000417214 213
28 3300005844 Ga0068862_100064845 Ga0068862_1000648452 213
29 3300006353 Ga0075370_10098752 Ga0075370_100987522 213
30 3300009176 Ga0105242_10011571 Ga0105242_100115713 213
31 3300025901 Ga0207688_10055478 Ga0207688_100554782 213
32 3300025927 Ga0207687_10034267 Ga0207687_100342673 213
33 3300025933 Ga0207706_10004126 Ga0207706_1000412612 213
34 3300025934 Ga0207686_10014435 Ga0207686_100144356 213
35 3300025935 Ga0207709_10132304 Ga0207709_101323042 213
36 3300025937 Ga0207669_10071852 Ga0207669_100718522 213
37 3300025972 Ga0207668_10118502 Ga0207668_101185022 213
38 3300026075 Ga0207708_10162746 Ga0207708_101627462 213
39 3300026089 Ga0207648_10027899 Ga0207648_100278993 213
40 3300026118 Ga0207675_100002666 Ga0207675_10000266617 213
41 3300026142 Ga0207698_10065673 Ga0207698_100656732 213
42 3300028380 Ga0268265_10447366 Ga0268265_104473662 213
43 3300031548 Ga0307408_100263583 Ga0307408_1002635832 213
44 3300031731 Ga0307405_10003551 Ga0307405_100035512 213
45 3300031852 Ga0307410_10002419 Ga0307410_100024197 213
46 3300031901 Ga0307406_10006181 Ga0307406_100061814 213
47 3300031903 Ga0307407_10000778 Ga0307407_100007783 213
48 3300031911 Ga0307412_10005378 Ga0307412_100053781 213
49 3300031995 Ga0307409_100004287 Ga0307409_1000042874 213
50 3300032002 Ga0307416_100012657 Ga0307416_1000126576 213
51 3300032004 Ga0307414_10000854 Ga0307414_100008547 213
52 3300032005 Ga0307411_10342875 Ga0307411_103428752 213
53 3300032126 Ga0307415_100005372 Ga0307415_1000053722 213
54 3300037418 Ga0395900_0268355 Ga0395900_0268355_90_731 213
55 3300037466 Ga0395898_0297729 Ga0395898_0297729_183_824 213
56 3300038443 Ga0395901_0139983 Ga0395901_0139983_1799_2440 213
57 3300046616 Ga0495668_0000204 Ga0495668_0000204_5361_6002 213
58 3300048913 Ga0496110_0329742 Ga0496110_0329742_569_1210 213
59 3300050496 nmdc:mga07m45_65558_c1 nmdc:mga07m45_65558_c1_615_1256 213
60 3300005344 Ga0070661_100569624 Ga0070661_1005696241 214
61 3300005356 Ga0070674_100213020 Ga0070674_1002130202 214
62 3300005367 Ga0070667_100000962 Ga0070667_10000096210 214
63 3300005471 Ga0070698_100311059 Ga0070698_1003110592 214
64 3300005539 Ga0068853_100376561 Ga0068853_1003765611 214
65 3300005548 Ga0070665_100009376 Ga0070665_1000093766 214
66 3300005614 Ga0068856_101360387 Ga0068856_1013603871 214
67 3300005617 Ga0068859_100001201 Ga0068859_1000012016 214
68 3300005841 Ga0068863_100002210 Ga0068863_10000221017 214
69 3300005841 Ga0068863_100459510 Ga0068863_1004595102 214
70 3300005843 Ga0068860_100000156 Ga0068860_10000015689 214
71 3300005844 Ga0068862_100000019 Ga0068862_100000019109 214
72 3300006931 Ga0097620_100001201 Ga0097620_1000012016 214
73 3300009098 Ga0105245_11499167 Ga0105245_114991671 214
74 3300009101 Ga0105247_10000023 Ga0105247_10000023109 214
75 3300009177 Ga0105248_10000409 Ga0105248_1000040921 214
76 3300009553 Ga0105249_10000033 Ga0105249_1000003387 214
77 3300014325 Ga0163163_10028957 Ga0163163_100289572 214
78 3300025900 Ga0207710_10000343 Ga0207710_1000034332 214
79 3300025901 Ga0207688_10062819 Ga0207688_100628192 214
80 3300025908 Ga0207643_10115706 Ga0207643_101157062 214
81 3300025908 Ga0207643_10172981 Ga0207643_101729812 214
82 3300025916 Ga0207663_10155897 Ga0207663_101558972 214
83 3300025918 Ga0207662_10096132 Ga0207662_100961322 214
84 3300025920 Ga0207649_10039415 Ga0207649_100394153 214
85 3300025923 Ga0207681_10018359 Ga0207681_100183592 214
86 3300025923 Ga0207681_10602783 Ga0207681_106027832 214
87 3300025937 Ga0207669_10035927 Ga0207669_100359272 214
88 3300025938 Ga0207704_10305694 Ga0207704_103056942 214
89 3300025940 Ga0207691_10207438 Ga0207691_102074382 214
90 3300025941 Ga0207711_10000412 Ga0207711_1000041230 214
91 3300025942 Ga0207689_10393405 Ga0207689_103934052 214
92 3300025961 Ga0207712_10000031 Ga0207712_10000031110 214
93 3300025961 Ga0207712_10460091 Ga0207712_104600912 214
94 3300025972 Ga0207668_10036899 Ga0207668_100368992 214
95 3300025986 Ga0207658_10000792 Ga0207658_1000079221 214
96 3300026075 Ga0207708_10034431 Ga0207708_100344315 214
97 3300026088 Ga0207641_10004679 Ga0207641_1000467915 214
98 3300026088 Ga0207641_10400406 Ga0207641_104004062 214
99 3300028379 Ga0268266_10012172 Ga0268266_100121724 214
100 3300028380 Ga0268265_10000029 Ga0268265_10000029106 214
101 3300028381 Ga0268264_10000222 Ga0268264_1000022287 214
102 3300028800 Ga0265338_10045639 Ga0265338_100456392 214
103 3300030522 Ga0307512_10072316 Ga0307512_100723162 214
104 3300031247 Ga0265340_10012326 Ga0265340_100123263 214
105 3300031616 Ga0307508_10002281 Ga0307508_100022814 214
106 3300031852 Ga0307410_10487768 Ga0307410_104877682 214
107 3300031903 Ga0307407_10145779 Ga0307407_101457791 214
108 3300031995 Ga0307409_100372365 Ga0307409_1003723652 214
109 3300031995 Ga0307409_101119865 Ga0307409_1011198652 214
110 3300032002 Ga0307416_100032771 Ga0307416_1000327713 214
111 3300032002 Ga0307416_100072115 Ga0307416_1000721154 214
112 3300032126 Ga0307415_100006096 Ga0307415_1000060964 214
113 3300032126 Ga0307415_100191861 Ga0307415_1001918613 214
114 3300032126 Ga0307415_100300318 Ga0307415_1003003182 214
115 3300032126 Ga0307415_101050344 Ga0307415_1010503441 214
116 3300037466 Ga0395898_0028593 Ga0395898_0028593_2708_3352 214
117 3300041496 Ga0451839_0843513 Ga0451839_0843513_138_782 214
118 3300042008 Ga0439450_046068 Ga0439450_046068_183_827 214
119 3300042011 Ga0439454_030254 Ga0439454_030254_176_820 214
120 3300042137 Ga0450902_046418 Ga0450902_046418_70_714 214
121 3300042439 Ga0439464_0038274 Ga0439464_0038274_107_751 214
122 3300044901 Ga0466960_0019456 Ga0466960_0019456_1846_2490 214
123 3300045976 Ga0466967_0091175 Ga0466967_0091175_548_1192 214
124 3300045976 Ga0466967_1074401 Ga0466967_1074401_147_791 214
125 3300046462 Ga0495651_0057714 Ga0495651_0057714_416_1060 214
126 3300048904 Ga0496101_0001600 Ga0496101_0001600_8129_8773 214
127 3300048905 Ga0496102_0000629 Ga0496102_0000629_13189_13833 214
128 3300048906 Ga0496103_0000527 Ga0496103_0000527_12410_13054 214
129 3300048912 Ga0496109_0426244 Ga0496109_0426244_342_986 214
130 3300048913 Ga0496110_0057462 Ga0496110_0057462_2539_3183 214
131 3300048917 Ga0496114_0004881 Ga0496114_0004881_5108_5752 214
132 3300048917 Ga0496114_0495030 Ga0496114_0495030_295_939 214
133 3300048919 Ga0496116_0031160 Ga0496116_0031160_2285_2929 214
134 3300048920 Ga0496117_0000415 Ga0496117_0000415_17148_17792 214
135 3300048921 Ga0496118_0002279 Ga0496118_0002279_17172_17816 214
136 3300048922 Ga0496119_0015979 Ga0496119_0015979_3320_3964 214
137 3300048923 Ga0496120_0022236 Ga0496120_0022236_2353_2997 214
138 3300048924 Ga0496121_0004662 Ga0496121_0004662_11365_12009 214
139 3300048927 Ga0496124_0076375 Ga0496124_0076375_1777_2421 214
140 3300048928 Ga0496125_0016586 Ga0496125_0016586_2131_2775 214
141 3300048929 Ga0496126_0018446 Ga0496126_0018446_1196_1840 214
142 3300048929 Ga0496126_0032176 Ga0496126_0032176_3906_4562 214
143 3300049584 Ga0501068_0257838 Ga0501068_0257838_442_1086 214
144 3300049585 Ga0501069_0053594 Ga0501069_0053594_1345_1989 214
145 3300049586 Ga0501070_0230218 Ga0501070_0230218_61_705 214
146 3300049589 Ga0501073_0041391 Ga0501073_0041391_708_1352 214
147 3300049742 Ga0501080_0247795 Ga0501080_0247795_167_811 214
148 3300050509 nmdc:mga0qj67_33785_c1 nmdc:mga0qj67_33785_c1_1872_2546 214
149 3300050511 nmdc:mga08y16_137957_c1 nmdc:mga08y16_137957_c1_1674_2318 214
150 3300050511 nmdc:mga08y16_299398_c1 nmdc:mga08y16_299398_c1_546_1190 214
151 3300005337 Ga0070682_100011634 Ga0070682_1000116345 215
152 3300005347 Ga0070668_100007373 Ga0070668_1000073736 215
153 3300005937 Ga0081455_10007438 Ga0081455_100074383 215
154 3300005937 Ga0081455_10101978 Ga0081455_101019782 215
155 3300006852 Ga0075433_10002556 Ga0075433_100025569 215
156 3300006871 Ga0075434_100000203 Ga0075434_10000020312 215
157 3300006914 Ga0075436_100222034 Ga0075436_1002220342 215
158 3300007076 Ga0075435_100008338 Ga0075435_10000833811 215
159 3300007076 Ga0075435_100105826 Ga0075435_1001058262 215
160 3300009148 Ga0105243_10008401 Ga0105243_100084016 215
161 3300009553 Ga0105249_10021934 Ga0105249_100219345 215
162 3300010375 Ga0105239_10229511 Ga0105239_102295112 215
163 3300012487 Ga0157321_1000971 Ga0157321_10009712 215
164 3300013306 Ga0163162_10301836 Ga0163162_103018362 215
165 3300013307 Ga0157372_10046833 Ga0157372_100468333 215
166 3300014326 Ga0157380_10052726 Ga0157380_100527262 215
167 3300025899 Ga0207642_10002249 Ga0207642_100022495 215
168 3300025961 Ga0207712_10026989 Ga0207712_100269892 215
169 3300027907 Ga0207428_10019395 Ga0207428_100193951 215
170 3300031824 Ga0307413_10013990 Ga0307413_100139904 215
171 3300037466 Ga0395898_0391362 Ga0395898_0391362_570_1217 215
172 3300044683 Ga0466965_0056288 Ga0466965_0056288_183_917 215
173 3300044765 Ga0466970_0149314 Ga0466970_0149314_10_744 215
174 3300044901 Ga0466960_0055033 Ga0466960_0055033_36_683 215
175 3300049569 Ga0501032_0002341 Ga0501032_0002341_6129_6857 215
176 3300049570 Ga0501033_0001065 Ga0501033_0001065_8106_8834 215
177 3300049571 Ga0501034_0412961 Ga0501034_0412961_98_826 215
178 3300049572 Ga0501036_0000867 Ga0501036_0000867_2383_3111 215
179 3300049573 Ga0501037_0010476 Ga0501037_0010476_5277_6005 215
180 3300049574 Ga0501038_0000675 Ga0501038_0000675_14522_15250 215
181 3300049575 Ga0501039_0001531 Ga0501039_0001531_9558_10286 215
182 3300049578 Ga0501042_0201504 Ga0501042_0201504_412_1140 215
183 3300049579 Ga0501043_0002968 Ga0501043_0002968_7922_8650 215
184 3300049581 Ga0501047_0010109 Ga0501047_0010109_7572_8300 215
185 3300049582 Ga0501048_0114435 Ga0501048_0114435_509_1237 215
186 3300049583 Ga0501067_0004646 Ga0501067_0004646_4926_5666 215
187 3300049585 Ga0501069_0001048 Ga0501069_0001048_7012_7740 215
188 3300049586 Ga0501070_0008158 Ga0501070_0008158_5490_6218 215
189 3300049587 Ga0501071_0080657 Ga0501071_0080657_1169_1897 215
190 3300049589 Ga0501073_0016240 Ga0501073_0016240_1065_1793 215
191 3300049741 Ga0501079_0337253 Ga0501079_0337253_61_801 215
192 3300049742 Ga0501080_0005335 Ga0501080_0005335_2001_2729 215
193 3300049744 Ga0501083_0021967 Ga0501083_0021967_1702_2430 215
194 3300049822 Ga0501035_0002522 Ga0501035_0002522_15152_15880 215
195 3300049823 Ga0501044_0042096 Ga0501044_0042096_936_1664 215
196 3300049823 Ga0501044_0089959 Ga0501044_0089959_2283_3032 215
197 3300049824 Ga0501045_0212005 Ga0501045_0212005_97_837 215
198 3300050511 nmdc:mga08y16_364722_c1 nmdc:mga08y16_364722_c1_143_790 215
199 3300050512 nmdc:mga0n895_76608_c1 nmdc:mga0n895_76608_c1_821_1468 215
200 3300050513 nmdc:mga0rr50_3987_c1 nmdc:mga0rr50_3987_c1_4128_4775 215
201 3300050514 nmdc:mga08x19_148068_c1 nmdc:mga08x19_148068_c1_252_899 215
202 3300050515 nmdc:mga0a205_23810_c1 nmdc:mga0a205_23810_c1_2569_3216 215
203 3300054114 Ga0501084_0003690 Ga0501084_0003690_8711_9439 215
204 3300061734 Ga0530510_0301864 Ga0530510_0301864_354_1001 215
205 3300021388 Ga0213875_10038416 Ga0213875_100384162 216
206 3300025917 Ga0207660_10952578 Ga0207660_109525781 216
207 3300025944 Ga0207661_10018983 Ga0207661_100189836 216
208 3300031824 Ga0307413_10602157 Ga0307413_106021572 216
209 3300031901 Ga0307406_10024104 Ga0307406_100241042 216
210 3300032126 Ga0307415_100187714 Ga0307415_1001877142 216
211 3300037471 Ga0395905_0115601 Ga0395905_0115601_1517_2167 216
212 3300037853 Ga0436364_0086915 Ga0436364_0086915_405_1055 216
213 3300046463 Ga0495653_0279822 Ga0495653_0279822_417_1067 216
214 3300046559 Ga0495667_0317642 Ga0495667_0317642_283_933 216
215 3300047319 Ga0495674_0113160 Ga0495674_0113160_1345_1995 216
216 3300047322 Ga0495680_0470534 Ga0495680_0470534_96_746 216
217 3300048911 Ga0496108_0054108 Ga0496108_0054108_2459_3109 216
218 3300048912 Ga0496109_0014281 Ga0496109_0014281_5942_6592 216
219 3300048914 Ga0496111_0147149 Ga0496111_0147149_819_1469 216
220 3300048915 Ga0496112_0009320 Ga0496112_0009320_7915_8565 216
221 3300048917 Ga0496114_0406961 Ga0496114_0406961_302_952 216
222 3300049571 Ga0501034_0003726 Ga0501034_0003726_11444_12094 216
223 3300049583 Ga0501067_0035865 Ga0501067_0035865_255_905 216
224 3300049585 Ga0501069_0044110 Ga0501069_0044110_1455_2105 216
225 3300050509 nmdc:mga0qj67_66759_c1 nmdc:mga0qj67_66759_c1_2167_2817 216
226 3300050510 nmdc:mga06r32_97940_c1 nmdc:mga06r32_97940_c1_1879_2529 216
227 3300005983 Ga0081540_1002138 Ga0081540_10021382 217
228 3300037312 Ga0395899_0065241 Ga0395899_0065241_133_786 217
229 3300037418 Ga0395900_0052766 Ga0395900_0052766_1218_1871 217
230 3300037466 Ga0395898_0041132 Ga0395898_0041132_2333_2986 217
231 3300038443 Ga0395901_0006433 Ga0395901_0006433_8798_9451 217
232 3300044842 Ga0466957_0204395 Ga0466957_0204395_126_779 217
233 3300046499 Ga0495594_0029303 Ga0495594_0029303_1234_1887 217
234 3300005327 Ga0070658_10061704 Ga0070658_100617044 219
235 3300005329 Ga0070683_100056341 Ga0070683_1000563412 219
236 3300005336 Ga0070680_100004650 Ga0070680_10000465010 219
237 3300005344 Ga0070661_100016038 Ga0070661_1000160383 219
238 3300005345 Ga0070692_10147180 Ga0070692_101471802 219
239 3300005366 Ga0070659_100004387 Ga0070659_1000043875 219
240 3300005458 Ga0070681_10003735 Ga0070681_100037357 219
241 3300005530 Ga0070679_100015356 Ga0070679_1000153567 219
242 3300005539 Ga0068853_100044004 Ga0068853_1000440042 219
243 3300005564 Ga0070664_100102358 Ga0070664_1001023582 219
244 3300005578 Ga0068854_100855140 Ga0068854_1008551401 219
245 3300005614 Ga0068856_100142605 Ga0068856_1001426053 219
246 3300005616 Ga0068852_100253246 Ga0068852_1002532462 219
247 3300006847 Ga0075431_100097050 Ga0075431_1000970503 219
248 3300006871 Ga0075434_100704620 Ga0075434_1007046202 219
249 3300009093 Ga0105240_10023223 Ga0105240_100232239 219
250 3300009094 Ga0111539_10168078 Ga0111539_101680782 219
251 3300009147 Ga0114129_10030640 Ga0114129_100306406 219
252 3300009545 Ga0105237_10047121 Ga0105237_100471213 219
253 3300009551 Ga0105238_10207565 Ga0105238_102075652 219
254 3300013102 Ga0157371_10135044 Ga0157371_101350443 219
255 3300013105 Ga0157369_10084613 Ga0157369_100846133 219
256 3300013307 Ga0157372_10027209 Ga0157372_100272093 219
257 3300020070 Ga0206356_10870607 Ga0206356_108706071 219
258 3300020082 Ga0206353_10838005 Ga0206353_108380053 219
259 3300025919 Ga0207657_10007474 Ga0207657_100074748 219
260 3300025920 Ga0207649_10137298 Ga0207649_101372982 219
261 3300025921 Ga0207652_10156561 Ga0207652_101565613 219
262 3300025932 Ga0207690_10038997 Ga0207690_100389973 219
263 3300025944 Ga0207661_10007141 Ga0207661_100071413 219
264 3300025981 Ga0207640_10624364 Ga0207640_106243642 219
265 3300026041 Ga0207639_10068263 Ga0207639_100682633 219
266 3300037312 Ga0395899_0201603 Ga0395899_0201603_680_1339 219
267 3300037418 Ga0395900_0026891 Ga0395900_0026891_4442_5101 219
268 3300037418 Ga0395900_0082315 Ga0395900_0082315_23_682 219
269 3300037466 Ga0395898_0186273 Ga0395898_0186273_873_1532 219
270 3300037471 Ga0395905_0171762 Ga0395905_0171762_1323_1982 219
271 3300038443 Ga0395901_0010276 Ga0395901_0010276_8106_8765 219
272 3300038443 Ga0395901_0053845 Ga0395901_0053845_2161_2820 219
273 3300041494 Ga0451837_1478034 Ga0451837_1478034_94_753 219
274 3300050511 nmdc:mga08y16_72063_c1 nmdc:mga08y16_72063_c1_849_1508 219
275 3300050512 nmdc:mga0n895_679153_c1 nmdc:mga0n895_679153_c1_80_739 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

1

111

0.94

PF00196

GerE

Bacterial regulatory proteins, luxR family

145

202

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9481 147 215
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9431 147 216
1zlj-assembly2.cif.gz_C crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain 0.943 151 217
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9409 147 216
4qic-assembly1.cif.gz_A co-crystal structure of anti-anti-sigma factor phyr complexed with anti-sigma factor nepr from bartonella quintana 0.9338 2 79
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9677 151 208 1.10.10.10
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9352 1 83 3.40.50.2300
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9351 147 216 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9342 147 216 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.933 147 193 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y7IIA2-F1-model_v4 Response regulator transcription factor 0.9975 1 75 GO:0000160
AF-A9WTE0-F1-model_v4 Two-component response regulator 0.9927 1 87 GO:0000160
AF-A0A538JGH7-F1-model_v4 Response regulator 0.9922 2 134 GO:0000160
GO:0004016
GO:0009190
AF-A0A6H9YBC7-F1-model_v4 Response regulator transcription factor 0.9862 1 139 GO:0000160
GO:0003677
AF-A0A3N0DSD5-F1-model_v4 Response regulator 0.9851 2 138 GO:0000160
GO:0004016
GO:0009190

Feature Viewer

pLDDT pTM Quality
88.95 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map