F380392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 275 | 202 | 267 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10002119|Ga0114129_1000211915 |
| Length | 211 |
| Sequence | VVAEDGVLLREGLVRLLMEAGHDVVAAVGDGPSLIAAVQNEKPDVSVVDVRMPPSHTDEGLRAAVALRRSGGRTPILVLSQYVELAYADDLLADARGAIGYLLKDAVVDVDGFLDALGRVAAGGTVLDPQVVAQLMIRRRNDPLAELTTREREVLALMAEGASNTAIAKRLVVTEGAVEKHITSIFGKLRLPQDSDQHRRVLAVLAYLRAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 4 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 5 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 6 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 7 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 108 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 114 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 115 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 125 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 126 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 129 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 130 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 131 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 132 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 133 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 134 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 135 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 140 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 155 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 158 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 159 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 160 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 161 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 162 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 163 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 164 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 165 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 166 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 167 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 202 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.36 |
| Metatranscriptomes | 0.73 |
| Isolates | 2.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.73 |
| Nodule | 0.36 |
| Rhizoplane | 5.09 |
| Rhizosphere | 85.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10061704 | 3300005327 | Bacteria | 3054 |
| 2 | Ga0070683_100056341 | 3300005329 | Bacteria | 3650 |
| 3 | Ga0070680_100004650 | 3300005336 | Bacteria | 10321 |
| 4 | Ga0070682_100011634 | 3300005337 | Bacteria | 5032 |
| 5 | Ga0070661_100016038 | 3300005344 | Bacteria | 5288 |
| 6 | Ga0070661_100569624 | 3300005344 | Bacteria | 913 |
| 7 | Ga0070692_10130896 | 3300005345 | Bacteria | 1410 |
| 8 | Ga0070692_10147180 | 3300005345 | Bacteria | 1338 |
| 9 | Ga0070668_100007373 | 3300005347 | Bacteria | 8161 |
| 10 | Ga0070674_100044039 | 3300005356 | Bacteria | 3040 |
| 11 | Ga0070674_100213020 | 3300005356 | Bacteria | 1499 |
| 12 | Ga0070659_100004387 | 3300005366 | Bacteria | 10075 |
| 13 | Ga0070667_100000962 | 3300005367 | Bacteria | 26520 |
| 14 | Ga0070700_100126349 | 3300005441 | Bacteria | 1720 |
| 15 | Ga0070662_100011685 | 3300005457 | Bacteria | 5794 |
| 16 | Ga0070681_10003735 | 3300005458 | Bacteria | 14290 |
| 17 | Ga0068867_100015938 | 3300005459 | Bacteria | 5335 |
| 18 | Ga0070698_100311059 | 3300005471 | Bacteria | 1506 |
| 19 | Ga0070679_100015356 | 3300005530 | Bacteria | 7358 |
| 20 | Ga0068853_100044004 | 3300005539 | Bacteria | 3821 |
| 21 | Ga0068853_100376561 | 3300005539 | Bacteria | 1325 |
| 22 | Ga0070665_100009376 | 3300005548 | Bacteria | 9904 |
| 23 | Ga0070664_100102358 | 3300005564 | Bacteria | 2492 |
| 24 | Ga0068854_100855140 | 3300005578 | Bacteria | 797 |
| 25 | Ga0068856_100142605 | 3300005614 | Bacteria | 2403 |
| 26 | Ga0068856_101360387 | 3300005614 | Bacteria | 725 |
| 27 | Ga0070702_100043236 | 3300005615 | Bacteria | 2538 |
| 28 | Ga0068852_100082076 | 3300005616 | Bacteria | 2863 |
| 29 | Ga0068852_100253246 | 3300005616 | Bacteria | 1688 |
| 30 | Ga0068859_100001201 | 3300005617 | Bacteria | 26431 |
| 31 | Ga0068866_10008042 | 3300005718 | Bacteria | 4431 |
| 32 | Ga0068861_100041721 | 3300005719 | Bacteria | 3437 |
| 33 | Ga0068863_100002210 | 3300005841 | Bacteria | 19325 |
| 34 | Ga0068863_100459510 | 3300005841 | Bacteria | 1250 |
| 35 | Ga0068860_100000156 | 3300005843 | Bacteria | 111148 |
| 36 | Ga0068862_100000019 | 3300005844 | Bacteria | 229485 |
| 37 | Ga0068862_100064845 | 3300005844 | Bacteria | 3145 |
| 38 | Ga0081455_10007438 | 3300005937 | Bacteria | 11538 |
| 39 | Ga0081455_10101978 | 3300005937 | Bacteria | 2302 |
| 40 | Ga0081540_1002138 | 3300005983 | Bacteria | 16440 |
| 41 | Ga0070717_11029578 | 3300006028 | Bacteria | 750 |
| 42 | Ga0075370_10098752 | 3300006353 | Bacteria | 1688 |
| 43 | Ga0075428_100902566 | 3300006844 | Bacteria | 937 |
| 44 | Ga0075431_100097050 | 3300006847 | Bacteria | 3043 |
| 45 | Ga0075433_10002556 | 3300006852 | Bacteria | 13862 |
| 46 | Ga0075434_100000203 | 3300006871 | Bacteria | 40085 |
| 47 | Ga0075434_100704620 | 3300006871 | Bacteria | 1027 |
| 48 | Ga0075436_100222034 | 3300006914 | Bacteria | 1341 |
| 49 | Ga0097620_100001201 | 3300006931 | Bacteria | 26431 |
| 50 | Ga0075435_100008338 | 3300007076 | Bacteria | 7427 |
| 51 | Ga0075435_100105826 | 3300007076 | Bacteria | 2335 |
| 52 | Ga0105240_10023223 | 3300009093 | Bacteria | 8211 |
| 53 | Ga0111539_10168078 | 3300009094 | Bacteria | 2563 |
| 54 | Ga0105245_11499167 | 3300009098 | Bacteria | 725 |
| 55 | Ga0105247_10000023 | 3300009101 | Bacteria | 215645 |
| 56 | Ga0114129_10002119 | 3300009147 | Bacteria | 27345 |
| 57 | Ga0114129_10030640 | 3300009147 | Bacteria | 7610 |
| 58 | Ga0105243_10008401 | 3300009148 | Bacteria | 7924 |
| 59 | Ga0105242_10011571 | 3300009176 | Bacteria | 6785 |
| 60 | Ga0105248_10000409 | 3300009177 | Bacteria | 49854 |
| 61 | Ga0105237_10047121 | 3300009545 | Bacteria | 4334 |
| 62 | Ga0105238_10207565 | 3300009551 | Bacteria | 1935 |
| 63 | Ga0105238_10974481 | 3300009551 | Bacteria | 868 |
| 64 | Ga0105249_10000033 | 3300009553 | Bacteria | 213834 |
| 65 | Ga0105249_10021934 | 3300009553 | Bacteria | 5720 |
| 66 | Ga0105239_10229511 | 3300010375 | Bacteria | 2083 |
| 67 | Ga0157321_1000971 | 3300012487 | Bacteria | 1370 |
| 68 | Ga0157371_10135044 | 3300013102 | Bacteria | 1757 |
| 69 | Ga0157369_10084613 | 3300013105 | Bacteria | 3390 |
| 70 | Ga0163162_10301836 | 3300013306 | Bacteria | 1733 |
| 71 | Ga0157372_10027209 | 3300013307 | Bacteria | 6225 |
| 72 | Ga0157372_10046833 | 3300013307 | Bacteria | 4802 |
| 73 | Ga0163163_10028957 | 3300014325 | Bacteria | 5324 |
| 74 | Ga0157380_10052726 | 3300014326 | Bacteria | 3222 |
| 75 | Ga0206356_10870607 | 3300020070 | Bacteria | 978 |
| 76 | Ga0206353_10838005 | 3300020082 | Bacteria | 3628 |
| 77 | Ga0213875_10038416 | 3300021388 | Bacteria | 2255 |
| 78 | Ga0207642_10002249 | 3300025899 | Bacteria | 6000 |
| 79 | Ga0207710_10000343 | 3300025900 | Bacteria | 34190 |
| 80 | Ga0207688_10055478 | 3300025901 | Bacteria | 2223 |
| 81 | Ga0207688_10062819 | 3300025901 | Bacteria | 2094 |
| 82 | Ga0207643_10115706 | 3300025908 | Bacteria | 1584 |
| 83 | Ga0207643_10172981 | 3300025908 | Bacteria | 1304 |
| 84 | Ga0207663_10155897 | 3300025916 | Bacteria | 1606 |
| 85 | Ga0207660_10952578 | 3300025917 | Bacteria | 700 |
| 86 | Ga0207662_10096132 | 3300025918 | Bacteria | 1829 |
| 87 | Ga0207657_10007474 | 3300025919 | Bacteria | 11196 |
| 88 | Ga0207649_10039415 | 3300025920 | Bacteria | 2865 |
| 89 | Ga0207649_10137298 | 3300025920 | Bacteria | 1669 |
| 90 | Ga0207652_10156561 | 3300025921 | Bacteria | 2041 |
| 91 | Ga0207681_10018359 | 3300025923 | Bacteria | 4407 |
| 92 | Ga0207681_10602783 | 3300025923 | Bacteria | 908 |
| 93 | Ga0207687_10034267 | 3300025927 | Bacteria | 3447 |
| 94 | Ga0207690_10038997 | 3300025932 | Bacteria | 3096 |
| 95 | Ga0207706_10004126 | 3300025933 | Bacteria | 13707 |
| 96 | Ga0207686_10014435 | 3300025934 | Bacteria | 4397 |
| 97 | Ga0207709_10132304 | 3300025935 | Bacteria | 1702 |
| 98 | Ga0207669_10035927 | 3300025937 | Bacteria | 2826 |
| 99 | Ga0207669_10071852 | 3300025937 | Bacteria | 2176 |
| 100 | Ga0207704_10305694 | 3300025938 | Bacteria | 1220 |
| 101 | Ga0207691_10207438 | 3300025940 | Bacteria | 1703 |
| 102 | Ga0207711_10000412 | 3300025941 | Bacteria | 45381 |
| 103 | Ga0207689_10393405 | 3300025942 | Bacteria | 1155 |
| 104 | Ga0207661_10007141 | 3300025944 | Bacteria | 7934 |
| 105 | Ga0207661_10018983 | 3300025944 | Bacteria | 5116 |
| 106 | Ga0207712_10000031 | 3300025961 | Bacteria | 213662 |
| 107 | Ga0207712_10026989 | 3300025961 | Bacteria | 3832 |
| 108 | Ga0207712_10460091 | 3300025961 | Bacteria | 1081 |
| 109 | Ga0207668_10036899 | 3300025972 | Bacteria | 3267 |
| 110 | Ga0207668_10118502 | 3300025972 | Bacteria | 2000 |
| 111 | Ga0207640_10624364 | 3300025981 | Bacteria | 915 |
| 112 | Ga0207658_10000792 | 3300025986 | Bacteria | 26813 |
| 113 | Ga0207639_10068263 | 3300026041 | Bacteria | 2769 |
| 114 | Ga0207708_10034431 | 3300026075 | Bacteria | 3853 |
| 115 | Ga0207708_10162746 | 3300026075 | Bacteria | 1763 |
| 116 | Ga0207641_10004679 | 3300026088 | Bacteria | 11806 |
| 117 | Ga0207641_10400406 | 3300026088 | Bacteria | 1318 |
| 118 | Ga0207648_10027899 | 3300026089 | Bacteria | 5009 |
| 119 | Ga0207675_100002666 | 3300026118 | Bacteria | 17607 |
| 120 | Ga0207698_10065673 | 3300026142 | Bacteria | 2852 |
| 121 | Ga0207428_10019395 | 3300027907 | Bacteria | 5800 |
| 122 | Ga0268266_10012172 | 3300028379 | Bacteria | 7445 |
| 123 | Ga0268265_10000029 | 3300028380 | Bacteria | 229499 |
| 124 | Ga0268265_10447366 | 3300028380 | Bacteria | 1206 |
| 125 | Ga0268264_10000222 | 3300028381 | Bacteria | 111162 |
| 126 | Ga0265338_10045639 | 3300028800 | Bacteria | 4026 |
| 127 | Ga0307512_10072316 | 3300030522 | Bacteria | 2552 |
| 128 | Ga0265340_10012326 | 3300031247 | Bacteria | 4517 |
| 129 | Ga0307408_100263583 | 3300031548 | Bacteria | 1427 |
| 130 | Ga0307508_10002281 | 3300031616 | Bacteria | 20405 |
| 131 | Ga0307405_10003551 | 3300031731 | Bacteria | 7188 |
| 132 | Ga0307413_10013990 | 3300031824 | Bacteria | 4058 |
| 133 | Ga0307413_10602157 | 3300031824 | Bacteria | 900 |
| 134 | Ga0307410_10002419 | 3300031852 | Bacteria | 9019 |
| 135 | Ga0307410_10487768 | 3300031852 | Bacteria | 1012 |
| 136 | Ga0307406_10006181 | 3300031901 | Bacteria | 6588 |
| 137 | Ga0307406_10024104 | 3300031901 | Bacteria | 3630 |
| 138 | Ga0307407_10000778 | 3300031903 | Bacteria | 10537 |
| 139 | Ga0307407_10145779 | 3300031903 | Bacteria | 1533 |
| 140 | Ga0307412_10005378 | 3300031911 | Bacteria | 7185 |
| 141 | Ga0307409_100004287 | 3300031995 | Bacteria | 7976 |
| 142 | Ga0307409_100372365 | 3300031995 | Bacteria | 1355 |
| 143 | Ga0307409_101119865 | 3300031995 | Bacteria | 809 |
| 144 | Ga0307416_100012657 | 3300032002 | Bacteria | 5694 |
| 145 | Ga0307416_100032771 | 3300032002 | Bacteria | 3932 |
| 146 | Ga0307416_100072115 | 3300032002 | Bacteria | 2873 |
| 147 | Ga0307414_10000854 | 3300032004 | Bacteria | 15525 |
| 148 | Ga0307411_10342875 | 3300032005 | Bacteria | 1215 |
| 149 | Ga0307415_100005372 | 3300032126 | Bacteria | 6793 |
| 150 | Ga0307415_100006096 | 3300032126 | Bacteria | 6466 |
| 151 | Ga0307415_100187714 | 3300032126 | Bacteria | 1628 |
| 152 | Ga0307415_100191861 | 3300032126 | Bacteria | 1613 |
| 153 | Ga0307415_100300318 | 3300032126 | Bacteria | 1330 |
| 154 | Ga0307415_101050344 | 3300032126 | Bacteria | 760 |
| 155 | Ga0395899_0065241 | 3300037312 | Bacteria | 2676 |
| 156 | Ga0395899_0201603 | 3300037312 | Bacteria | 1387 |
| 157 | Ga0395900_0026891 | 3300037418 | Bacteria | 5888 |
| 158 | Ga0395900_0052766 | 3300037418 | Bacteria | 4185 |
| 159 | Ga0395900_0082315 | 3300037418 | Bacteria | 3307 |
| 160 | Ga0395900_0268355 | 3300037418 | Bacteria | 1702 |
| 161 | Ga0395898_0028593 | 3300037466 | Bacteria | 5586 |
| 162 | Ga0395898_0041132 | 3300037466 | Bacteria | 4567 |
| 163 | Ga0395898_0186273 | 3300037466 | Bacteria | 1983 |
| 164 | Ga0395898_0297729 | 3300037466 | Bacteria | 1539 |
| 165 | Ga0395898_0391362 | 3300037466 | Bacteria | 1325 |
| 166 | Ga0395905_0115601 | 3300037471 | Bacteria | 2521 |
| 167 | Ga0395905_0171762 | 3300037471 | Bacteria | 2036 |
| 168 | Ga0436364_0086915 | 3300037853 | Bacteria | 6258 |
| 169 | Ga0395901_0006433 | 3300038443 | Bacteria | 11902 |
| 170 | Ga0395901_0010276 | 3300038443 | Bacteria | 9481 |
| 171 | Ga0395901_0053845 | 3300038443 | Bacteria | 4181 |
| 172 | Ga0395901_0139983 | 3300038443 | Bacteria | 2543 |
| 173 | Ga0451837_1478034 | 3300041494 | Bacteria | 1119 |
| 174 | Ga0451839_0843513 | 3300041496 | Bacteria | 851 |
| 175 | Ga0439450_046068 | 3300042008 | Bacteria | 1025 |
| 176 | Ga0439454_030254 | 3300042011 | Bacteria | 845 |
| 177 | Ga0450902_046418 | 3300042137 | Bacteria | 743 |
| 178 | Ga0439464_0038274 | 3300042439 | Bacteria | 1362 |
| 179 | Ga0466965_0056288 | 3300044683 | Bacteria | 1958 |
| 180 | Ga0466970_0149314 | 3300044765 | Bacteria | 1290 |
| 181 | Ga0466957_0204395 | 3300044842 | Bacteria | 1298 |
| 182 | Ga0466960_0019456 | 3300044901 | Bacteria | 2993 |
| 183 | Ga0466960_0055033 | 3300044901 | Bacteria | 1934 |
| 184 | Ga0466959_0713089 | 3300045049 | Bacteria | 672 |
| 185 | Ga0466967_0091175 | 3300045976 | Bacteria | 2769 |
| 186 | Ga0466967_1074401 | 3300045976 | Bacteria | 802 |
| 187 | Ga0495651_0057714 | 3300046462 | Bacteria | 2980 |
| 188 | Ga0495653_0279822 | 3300046463 | Bacteria | 1095 |
| 189 | Ga0495594_0029303 | 3300046499 | Bacteria | 2974 |
| 190 | Ga0495667_0317642 | 3300046559 | Bacteria | 986 |
| 191 | Ga0495656_0245186 | 3300046615 | Bacteria | 903 |
| 192 | Ga0495668_0000204 | 3300046616 | Bacteria | 86683 |
| 193 | Ga0495674_0113160 | 3300047319 | Bacteria | 2299 |
| 194 | Ga0495680_0470534 | 3300047322 | Bacteria | 857 |
| 195 | Ga0496101_0001600 | 3300048904 | Bacteria | 13614 |
| 196 | Ga0496102_0000629 | 3300048905 | Bacteria | 36066 |
| 197 | Ga0496103_0000527 | 3300048906 | Bacteria | 31207 |
| 198 | Ga0496105_0818322 | 3300048908 | Bacteria | 707 |
| 199 | Ga0496108_0054108 | 3300048911 | Bacteria | 3368 |
| 200 | Ga0496109_0014281 | 3300048912 | Bacteria | 6911 |
| 201 | Ga0496109_0426244 | 3300048912 | Bacteria | 1253 |
| 202 | Ga0496110_0057462 | 3300048913 | Bacteria | 3425 |
| 203 | Ga0496110_0329742 | 3300048913 | Bacteria | 1390 |
| 204 | Ga0496111_0147149 | 3300048914 | Bacteria | 1747 |
| 205 | Ga0496112_0009320 | 3300048915 | Bacteria | 8833 |
| 206 | Ga0496114_0004881 | 3300048917 | Bacteria | 10445 |
| 207 | Ga0496114_0406961 | 3300048917 | Bacteria | 1205 |
| 208 | Ga0496114_0495030 | 3300048917 | Bacteria | 1081 |
| 209 | Ga0496116_0031160 | 3300048919 | Bacteria | 3822 |
| 210 | Ga0496117_0000415 | 3300048920 | Bacteria | 71870 |
| 211 | Ga0496118_0002279 | 3300048921 | Bacteria | 26185 |
| 212 | Ga0496119_0015979 | 3300048922 | Bacteria | 5740 |
| 213 | Ga0496120_0022236 | 3300048923 | Bacteria | 3991 |
| 214 | Ga0496121_0004662 | 3300048924 | Bacteria | 18210 |
| 215 | Ga0496124_0076375 | 3300048927 | Bacteria | 2765 |
| 216 | Ga0496125_0016586 | 3300048928 | Bacteria | 7065 |
| 217 | Ga0496126_0018446 | 3300048929 | Bacteria | 6913 |
| 218 | Ga0496126_0032176 | 3300048929 | Bacteria | 4945 |
| 219 | Ga0496126_0094430 | 3300048929 | Bacteria | 2625 |
| 220 | Ga0501032_0002341 | 3300049569 | Bacteria | 14858 |
| 221 | Ga0501033_0001065 | 3300049570 | Bacteria | 25048 |
| 222 | Ga0501034_0003726 | 3300049571 | Bacteria | 17215 |
| 223 | Ga0501034_0412961 | 3300049571 | Bacteria | 1271 |
| 224 | Ga0501036_0000867 | 3300049572 | Bacteria | 22512 |
| 225 | Ga0501037_0010476 | 3300049573 | Bacteria | 6809 |
| 226 | Ga0501038_0000675 | 3300049574 | Bacteria | 30401 |
| 227 | Ga0501039_0001531 | 3300049575 | Bacteria | 17007 |
| 228 | Ga0501042_0201504 | 3300049578 | Bacteria | 1435 |
| 229 | Ga0501043_0002968 | 3300049579 | Bacteria | 14139 |
| 230 | Ga0501047_0010109 | 3300049581 | Bacteria | 8919 |
| 231 | Ga0501048_0114435 | 3300049582 | Bacteria | 1905 |
| 232 | Ga0501067_0004646 | 3300049583 | Bacteria | 7609 |
| 233 | Ga0501067_0035865 | 3300049583 | Bacteria | 2754 |
| 234 | Ga0501068_0257838 | 3300049584 | Bacteria | 1112 |
| 235 | Ga0501069_0001048 | 3300049585 | Bacteria | 13212 |
| 236 | Ga0501069_0044110 | 3300049585 | Bacteria | 2469 |
| 237 | Ga0501069_0053594 | 3300049585 | Bacteria | 2246 |
| 238 | Ga0501070_0008158 | 3300049586 | Bacteria | 8858 |
| 239 | Ga0501070_0230218 | 3300049586 | Bacteria | 1518 |
| 240 | Ga0501071_0080657 | 3300049587 | Bacteria | 2380 |
| 241 | Ga0501073_0016240 | 3300049589 | Bacteria | 5396 |
| 242 | Ga0501073_0041391 | 3300049589 | Bacteria | 3256 |
| 243 | Ga0501079_0337253 | 3300049741 | Bacteria | 1181 |
| 244 | Ga0501080_0005335 | 3300049742 | Bacteria | 11453 |
| 245 | Ga0501080_0247795 | 3300049742 | Bacteria | 1624 |
| 246 | Ga0501083_0021967 | 3300049744 | Bacteria | 4430 |
| 247 | Ga0501035_0002522 | 3300049822 | Bacteria | 17914 |
| 248 | Ga0501044_0042096 | 3300049823 | Bacteria | 4753 |
| 249 | Ga0501044_0089959 | 3300049823 | Bacteria | 3098 |
| 250 | Ga0501045_0212005 | 3300049824 | Bacteria | 1443 |
| 251 | nmdc:mga07m45_65558_c1 | 3300050496 | Bacteria | 2062 |
| 252 | nmdc:mga05p37_20304_c1 | 3300050507 | Bacteria | 8039 |
| 253 | nmdc:mga09592_259948_c1 | 3300050508 | Bacteria | 1505 |
| 254 | nmdc:mga0qj67_33785_c1 | 3300050509 | Bacteria | 3992 |
| 255 | nmdc:mga0qj67_66759_c1 | 3300050509 | Bacteria | 2865 |
| 256 | nmdc:mga06r32_97940_c1 | 3300050510 | Bacteria | 2874 |
| 257 | nmdc:mga08y16_137957_c1 | 3300050511 | Bacteria | 2535 |
| 258 | nmdc:mga08y16_299398_c1 | 3300050511 | Bacteria | 1658 |
| 259 | nmdc:mga08y16_364722_c1 | 3300050511 | Bacteria | 1483 |
| 260 | nmdc:mga08y16_72063_c1 | 3300050511 | Bacteria | 3600 |
| 261 | nmdc:mga0n895_679153_c1 | 3300050512 | Bacteria | 1027 |
| 262 | nmdc:mga0n895_76608_c1 | 3300050512 | Bacteria | 3326 |
| 263 | nmdc:mga0rr50_3987_c1 | 3300050513 | Bacteria | 8601 |
| 264 | nmdc:mga08x19_148068_c1 | 3300050514 | Bacteria | 1588 |
| 265 | nmdc:mga0a205_23810_c1 | 3300050515 | Bacteria | 5811 |
| 266 | Ga0501084_0003690 | 3300054114 | Bacteria | 12430 |
| 267 | Ga0530510_0301864 | 3300061734 | Bacteria | 1198 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0713089 | Ga0466959_0713089_28_630 | 200 |
| 2 | 3300048929 | Ga0496126_0094430 | Ga0496126_0094430_1171_1821 | 202 |
| 3 | 3300048908 | Ga0496105_0818322 | Ga0496105_0818322_79_696 | 205 |
| 4 | iso_pu_bacteria | 2565956761 | 2566996265 | 209 |
| 5 | iso_pu_bacteria | 2904535858 | 2904540903 | 209 |
| 6 | iso_pu_bacteria | 2922554459 | 2922554995 | 209 |
| 7 | 3300006844 | Ga0075428_100902566 | Ga0075428_1009025661 | 210 |
| 8 | iso_pu_bacteria | 2554235005 | 2554260321 | 210 |
| 9 | iso_pu_bacteria | 2738543005 | 2739206694 | 210 |
| 10 | iso_pu_bacteria | 2858868258 | 2858874501 | 210 |
| 11 | iso_pu_bacteria | 2928142448 | 2928145907 | 210 |
| 12 | iso_pu_bacteria | 8055412473 | 8055418807 | 210 |
| 13 | 3300006028 | Ga0070717_11029578 | Ga0070717_110295781 | 211 |
| 14 | 3300009147 | Ga0114129_10002119 | Ga0114129_1000211915 | 211 |
| 15 | 3300009551 | Ga0105238_10974481 | Ga0105238_109744811 | 211 |
| 16 | 3300050507 | nmdc:mga05p37_20304_c1 | nmdc:mga05p37_20304_c1_2428_3063 | 211 |
| 17 | 3300050508 | nmdc:mga09592_259948_c1 | nmdc:mga09592_259948_c1_108_743 | 211 |
| 18 | 3300005345 | Ga0070692_10130896 | Ga0070692_101308962 | 212 |
| 19 | 3300046615 | Ga0495656_0245186 | Ga0495656_0245186_43_681 | 212 |
| 20 | 3300005356 | Ga0070674_100044039 | Ga0070674_1000440392 | 213 |
| 21 | 3300005441 | Ga0070700_100126349 | Ga0070700_1001263491 | 213 |
| 22 | 3300005457 | Ga0070662_100011685 | Ga0070662_1000116854 | 213 |
| 23 | 3300005459 | Ga0068867_100015938 | Ga0068867_1000159384 | 213 |
| 24 | 3300005615 | Ga0070702_100043236 | Ga0070702_1000432362 | 213 |
| 25 | 3300005616 | Ga0068852_100082076 | Ga0068852_1000820762 | 213 |
| 26 | 3300005718 | Ga0068866_10008042 | Ga0068866_100080423 | 213 |
| 27 | 3300005719 | Ga0068861_100041721 | Ga0068861_1000417214 | 213 |
| 28 | 3300005844 | Ga0068862_100064845 | Ga0068862_1000648452 | 213 |
| 29 | 3300006353 | Ga0075370_10098752 | Ga0075370_100987522 | 213 |
| 30 | 3300009176 | Ga0105242_10011571 | Ga0105242_100115713 | 213 |
| 31 | 3300025901 | Ga0207688_10055478 | Ga0207688_100554782 | 213 |
| 32 | 3300025927 | Ga0207687_10034267 | Ga0207687_100342673 | 213 |
| 33 | 3300025933 | Ga0207706_10004126 | Ga0207706_1000412612 | 213 |
| 34 | 3300025934 | Ga0207686_10014435 | Ga0207686_100144356 | 213 |
| 35 | 3300025935 | Ga0207709_10132304 | Ga0207709_101323042 | 213 |
| 36 | 3300025937 | Ga0207669_10071852 | Ga0207669_100718522 | 213 |
| 37 | 3300025972 | Ga0207668_10118502 | Ga0207668_101185022 | 213 |
| 38 | 3300026075 | Ga0207708_10162746 | Ga0207708_101627462 | 213 |
| 39 | 3300026089 | Ga0207648_10027899 | Ga0207648_100278993 | 213 |
| 40 | 3300026118 | Ga0207675_100002666 | Ga0207675_10000266617 | 213 |
| 41 | 3300026142 | Ga0207698_10065673 | Ga0207698_100656732 | 213 |
| 42 | 3300028380 | Ga0268265_10447366 | Ga0268265_104473662 | 213 |
| 43 | 3300031548 | Ga0307408_100263583 | Ga0307408_1002635832 | 213 |
| 44 | 3300031731 | Ga0307405_10003551 | Ga0307405_100035512 | 213 |
| 45 | 3300031852 | Ga0307410_10002419 | Ga0307410_100024197 | 213 |
| 46 | 3300031901 | Ga0307406_10006181 | Ga0307406_100061814 | 213 |
| 47 | 3300031903 | Ga0307407_10000778 | Ga0307407_100007783 | 213 |
| 48 | 3300031911 | Ga0307412_10005378 | Ga0307412_100053781 | 213 |
| 49 | 3300031995 | Ga0307409_100004287 | Ga0307409_1000042874 | 213 |
| 50 | 3300032002 | Ga0307416_100012657 | Ga0307416_1000126576 | 213 |
| 51 | 3300032004 | Ga0307414_10000854 | Ga0307414_100008547 | 213 |
| 52 | 3300032005 | Ga0307411_10342875 | Ga0307411_103428752 | 213 |
| 53 | 3300032126 | Ga0307415_100005372 | Ga0307415_1000053722 | 213 |
| 54 | 3300037418 | Ga0395900_0268355 | Ga0395900_0268355_90_731 | 213 |
| 55 | 3300037466 | Ga0395898_0297729 | Ga0395898_0297729_183_824 | 213 |
| 56 | 3300038443 | Ga0395901_0139983 | Ga0395901_0139983_1799_2440 | 213 |
| 57 | 3300046616 | Ga0495668_0000204 | Ga0495668_0000204_5361_6002 | 213 |
| 58 | 3300048913 | Ga0496110_0329742 | Ga0496110_0329742_569_1210 | 213 |
| 59 | 3300050496 | nmdc:mga07m45_65558_c1 | nmdc:mga07m45_65558_c1_615_1256 | 213 |
| 60 | 3300005344 | Ga0070661_100569624 | Ga0070661_1005696241 | 214 |
| 61 | 3300005356 | Ga0070674_100213020 | Ga0070674_1002130202 | 214 |
| 62 | 3300005367 | Ga0070667_100000962 | Ga0070667_10000096210 | 214 |
| 63 | 3300005471 | Ga0070698_100311059 | Ga0070698_1003110592 | 214 |
| 64 | 3300005539 | Ga0068853_100376561 | Ga0068853_1003765611 | 214 |
| 65 | 3300005548 | Ga0070665_100009376 | Ga0070665_1000093766 | 214 |
| 66 | 3300005614 | Ga0068856_101360387 | Ga0068856_1013603871 | 214 |
| 67 | 3300005617 | Ga0068859_100001201 | Ga0068859_1000012016 | 214 |
| 68 | 3300005841 | Ga0068863_100002210 | Ga0068863_10000221017 | 214 |
| 69 | 3300005841 | Ga0068863_100459510 | Ga0068863_1004595102 | 214 |
| 70 | 3300005843 | Ga0068860_100000156 | Ga0068860_10000015689 | 214 |
| 71 | 3300005844 | Ga0068862_100000019 | Ga0068862_100000019109 | 214 |
| 72 | 3300006931 | Ga0097620_100001201 | Ga0097620_1000012016 | 214 |
| 73 | 3300009098 | Ga0105245_11499167 | Ga0105245_114991671 | 214 |
| 74 | 3300009101 | Ga0105247_10000023 | Ga0105247_10000023109 | 214 |
| 75 | 3300009177 | Ga0105248_10000409 | Ga0105248_1000040921 | 214 |
| 76 | 3300009553 | Ga0105249_10000033 | Ga0105249_1000003387 | 214 |
| 77 | 3300014325 | Ga0163163_10028957 | Ga0163163_100289572 | 214 |
| 78 | 3300025900 | Ga0207710_10000343 | Ga0207710_1000034332 | 214 |
| 79 | 3300025901 | Ga0207688_10062819 | Ga0207688_100628192 | 214 |
| 80 | 3300025908 | Ga0207643_10115706 | Ga0207643_101157062 | 214 |
| 81 | 3300025908 | Ga0207643_10172981 | Ga0207643_101729812 | 214 |
| 82 | 3300025916 | Ga0207663_10155897 | Ga0207663_101558972 | 214 |
| 83 | 3300025918 | Ga0207662_10096132 | Ga0207662_100961322 | 214 |
| 84 | 3300025920 | Ga0207649_10039415 | Ga0207649_100394153 | 214 |
| 85 | 3300025923 | Ga0207681_10018359 | Ga0207681_100183592 | 214 |
| 86 | 3300025923 | Ga0207681_10602783 | Ga0207681_106027832 | 214 |
| 87 | 3300025937 | Ga0207669_10035927 | Ga0207669_100359272 | 214 |
| 88 | 3300025938 | Ga0207704_10305694 | Ga0207704_103056942 | 214 |
| 89 | 3300025940 | Ga0207691_10207438 | Ga0207691_102074382 | 214 |
| 90 | 3300025941 | Ga0207711_10000412 | Ga0207711_1000041230 | 214 |
| 91 | 3300025942 | Ga0207689_10393405 | Ga0207689_103934052 | 214 |
| 92 | 3300025961 | Ga0207712_10000031 | Ga0207712_10000031110 | 214 |
| 93 | 3300025961 | Ga0207712_10460091 | Ga0207712_104600912 | 214 |
| 94 | 3300025972 | Ga0207668_10036899 | Ga0207668_100368992 | 214 |
| 95 | 3300025986 | Ga0207658_10000792 | Ga0207658_1000079221 | 214 |
| 96 | 3300026075 | Ga0207708_10034431 | Ga0207708_100344315 | 214 |
| 97 | 3300026088 | Ga0207641_10004679 | Ga0207641_1000467915 | 214 |
| 98 | 3300026088 | Ga0207641_10400406 | Ga0207641_104004062 | 214 |
| 99 | 3300028379 | Ga0268266_10012172 | Ga0268266_100121724 | 214 |
| 100 | 3300028380 | Ga0268265_10000029 | Ga0268265_10000029106 | 214 |
| 101 | 3300028381 | Ga0268264_10000222 | Ga0268264_1000022287 | 214 |
| 102 | 3300028800 | Ga0265338_10045639 | Ga0265338_100456392 | 214 |
| 103 | 3300030522 | Ga0307512_10072316 | Ga0307512_100723162 | 214 |
| 104 | 3300031247 | Ga0265340_10012326 | Ga0265340_100123263 | 214 |
| 105 | 3300031616 | Ga0307508_10002281 | Ga0307508_100022814 | 214 |
| 106 | 3300031852 | Ga0307410_10487768 | Ga0307410_104877682 | 214 |
| 107 | 3300031903 | Ga0307407_10145779 | Ga0307407_101457791 | 214 |
| 108 | 3300031995 | Ga0307409_100372365 | Ga0307409_1003723652 | 214 |
| 109 | 3300031995 | Ga0307409_101119865 | Ga0307409_1011198652 | 214 |
| 110 | 3300032002 | Ga0307416_100032771 | Ga0307416_1000327713 | 214 |
| 111 | 3300032002 | Ga0307416_100072115 | Ga0307416_1000721154 | 214 |
| 112 | 3300032126 | Ga0307415_100006096 | Ga0307415_1000060964 | 214 |
| 113 | 3300032126 | Ga0307415_100191861 | Ga0307415_1001918613 | 214 |
| 114 | 3300032126 | Ga0307415_100300318 | Ga0307415_1003003182 | 214 |
| 115 | 3300032126 | Ga0307415_101050344 | Ga0307415_1010503441 | 214 |
| 116 | 3300037466 | Ga0395898_0028593 | Ga0395898_0028593_2708_3352 | 214 |
| 117 | 3300041496 | Ga0451839_0843513 | Ga0451839_0843513_138_782 | 214 |
| 118 | 3300042008 | Ga0439450_046068 | Ga0439450_046068_183_827 | 214 |
| 119 | 3300042011 | Ga0439454_030254 | Ga0439454_030254_176_820 | 214 |
| 120 | 3300042137 | Ga0450902_046418 | Ga0450902_046418_70_714 | 214 |
| 121 | 3300042439 | Ga0439464_0038274 | Ga0439464_0038274_107_751 | 214 |
| 122 | 3300044901 | Ga0466960_0019456 | Ga0466960_0019456_1846_2490 | 214 |
| 123 | 3300045976 | Ga0466967_0091175 | Ga0466967_0091175_548_1192 | 214 |
| 124 | 3300045976 | Ga0466967_1074401 | Ga0466967_1074401_147_791 | 214 |
| 125 | 3300046462 | Ga0495651_0057714 | Ga0495651_0057714_416_1060 | 214 |
| 126 | 3300048904 | Ga0496101_0001600 | Ga0496101_0001600_8129_8773 | 214 |
| 127 | 3300048905 | Ga0496102_0000629 | Ga0496102_0000629_13189_13833 | 214 |
| 128 | 3300048906 | Ga0496103_0000527 | Ga0496103_0000527_12410_13054 | 214 |
| 129 | 3300048912 | Ga0496109_0426244 | Ga0496109_0426244_342_986 | 214 |
| 130 | 3300048913 | Ga0496110_0057462 | Ga0496110_0057462_2539_3183 | 214 |
| 131 | 3300048917 | Ga0496114_0004881 | Ga0496114_0004881_5108_5752 | 214 |
| 132 | 3300048917 | Ga0496114_0495030 | Ga0496114_0495030_295_939 | 214 |
| 133 | 3300048919 | Ga0496116_0031160 | Ga0496116_0031160_2285_2929 | 214 |
| 134 | 3300048920 | Ga0496117_0000415 | Ga0496117_0000415_17148_17792 | 214 |
| 135 | 3300048921 | Ga0496118_0002279 | Ga0496118_0002279_17172_17816 | 214 |
| 136 | 3300048922 | Ga0496119_0015979 | Ga0496119_0015979_3320_3964 | 214 |
| 137 | 3300048923 | Ga0496120_0022236 | Ga0496120_0022236_2353_2997 | 214 |
| 138 | 3300048924 | Ga0496121_0004662 | Ga0496121_0004662_11365_12009 | 214 |
| 139 | 3300048927 | Ga0496124_0076375 | Ga0496124_0076375_1777_2421 | 214 |
| 140 | 3300048928 | Ga0496125_0016586 | Ga0496125_0016586_2131_2775 | 214 |
| 141 | 3300048929 | Ga0496126_0018446 | Ga0496126_0018446_1196_1840 | 214 |
| 142 | 3300048929 | Ga0496126_0032176 | Ga0496126_0032176_3906_4562 | 214 |
| 143 | 3300049584 | Ga0501068_0257838 | Ga0501068_0257838_442_1086 | 214 |
| 144 | 3300049585 | Ga0501069_0053594 | Ga0501069_0053594_1345_1989 | 214 |
| 145 | 3300049586 | Ga0501070_0230218 | Ga0501070_0230218_61_705 | 214 |
| 146 | 3300049589 | Ga0501073_0041391 | Ga0501073_0041391_708_1352 | 214 |
| 147 | 3300049742 | Ga0501080_0247795 | Ga0501080_0247795_167_811 | 214 |
| 148 | 3300050509 | nmdc:mga0qj67_33785_c1 | nmdc:mga0qj67_33785_c1_1872_2546 | 214 |
| 149 | 3300050511 | nmdc:mga08y16_137957_c1 | nmdc:mga08y16_137957_c1_1674_2318 | 214 |
| 150 | 3300050511 | nmdc:mga08y16_299398_c1 | nmdc:mga08y16_299398_c1_546_1190 | 214 |
| 151 | 3300005337 | Ga0070682_100011634 | Ga0070682_1000116345 | 215 |
| 152 | 3300005347 | Ga0070668_100007373 | Ga0070668_1000073736 | 215 |
| 153 | 3300005937 | Ga0081455_10007438 | Ga0081455_100074383 | 215 |
| 154 | 3300005937 | Ga0081455_10101978 | Ga0081455_101019782 | 215 |
| 155 | 3300006852 | Ga0075433_10002556 | Ga0075433_100025569 | 215 |
| 156 | 3300006871 | Ga0075434_100000203 | Ga0075434_10000020312 | 215 |
| 157 | 3300006914 | Ga0075436_100222034 | Ga0075436_1002220342 | 215 |
| 158 | 3300007076 | Ga0075435_100008338 | Ga0075435_10000833811 | 215 |
| 159 | 3300007076 | Ga0075435_100105826 | Ga0075435_1001058262 | 215 |
| 160 | 3300009148 | Ga0105243_10008401 | Ga0105243_100084016 | 215 |
| 161 | 3300009553 | Ga0105249_10021934 | Ga0105249_100219345 | 215 |
| 162 | 3300010375 | Ga0105239_10229511 | Ga0105239_102295112 | 215 |
| 163 | 3300012487 | Ga0157321_1000971 | Ga0157321_10009712 | 215 |
| 164 | 3300013306 | Ga0163162_10301836 | Ga0163162_103018362 | 215 |
| 165 | 3300013307 | Ga0157372_10046833 | Ga0157372_100468333 | 215 |
| 166 | 3300014326 | Ga0157380_10052726 | Ga0157380_100527262 | 215 |
| 167 | 3300025899 | Ga0207642_10002249 | Ga0207642_100022495 | 215 |
| 168 | 3300025961 | Ga0207712_10026989 | Ga0207712_100269892 | 215 |
| 169 | 3300027907 | Ga0207428_10019395 | Ga0207428_100193951 | 215 |
| 170 | 3300031824 | Ga0307413_10013990 | Ga0307413_100139904 | 215 |
| 171 | 3300037466 | Ga0395898_0391362 | Ga0395898_0391362_570_1217 | 215 |
| 172 | 3300044683 | Ga0466965_0056288 | Ga0466965_0056288_183_917 | 215 |
| 173 | 3300044765 | Ga0466970_0149314 | Ga0466970_0149314_10_744 | 215 |
| 174 | 3300044901 | Ga0466960_0055033 | Ga0466960_0055033_36_683 | 215 |
| 175 | 3300049569 | Ga0501032_0002341 | Ga0501032_0002341_6129_6857 | 215 |
| 176 | 3300049570 | Ga0501033_0001065 | Ga0501033_0001065_8106_8834 | 215 |
| 177 | 3300049571 | Ga0501034_0412961 | Ga0501034_0412961_98_826 | 215 |
| 178 | 3300049572 | Ga0501036_0000867 | Ga0501036_0000867_2383_3111 | 215 |
| 179 | 3300049573 | Ga0501037_0010476 | Ga0501037_0010476_5277_6005 | 215 |
| 180 | 3300049574 | Ga0501038_0000675 | Ga0501038_0000675_14522_15250 | 215 |
| 181 | 3300049575 | Ga0501039_0001531 | Ga0501039_0001531_9558_10286 | 215 |
| 182 | 3300049578 | Ga0501042_0201504 | Ga0501042_0201504_412_1140 | 215 |
| 183 | 3300049579 | Ga0501043_0002968 | Ga0501043_0002968_7922_8650 | 215 |
| 184 | 3300049581 | Ga0501047_0010109 | Ga0501047_0010109_7572_8300 | 215 |
| 185 | 3300049582 | Ga0501048_0114435 | Ga0501048_0114435_509_1237 | 215 |
| 186 | 3300049583 | Ga0501067_0004646 | Ga0501067_0004646_4926_5666 | 215 |
| 187 | 3300049585 | Ga0501069_0001048 | Ga0501069_0001048_7012_7740 | 215 |
| 188 | 3300049586 | Ga0501070_0008158 | Ga0501070_0008158_5490_6218 | 215 |
| 189 | 3300049587 | Ga0501071_0080657 | Ga0501071_0080657_1169_1897 | 215 |
| 190 | 3300049589 | Ga0501073_0016240 | Ga0501073_0016240_1065_1793 | 215 |
| 191 | 3300049741 | Ga0501079_0337253 | Ga0501079_0337253_61_801 | 215 |
| 192 | 3300049742 | Ga0501080_0005335 | Ga0501080_0005335_2001_2729 | 215 |
| 193 | 3300049744 | Ga0501083_0021967 | Ga0501083_0021967_1702_2430 | 215 |
| 194 | 3300049822 | Ga0501035_0002522 | Ga0501035_0002522_15152_15880 | 215 |
| 195 | 3300049823 | Ga0501044_0042096 | Ga0501044_0042096_936_1664 | 215 |
| 196 | 3300049823 | Ga0501044_0089959 | Ga0501044_0089959_2283_3032 | 215 |
| 197 | 3300049824 | Ga0501045_0212005 | Ga0501045_0212005_97_837 | 215 |
| 198 | 3300050511 | nmdc:mga08y16_364722_c1 | nmdc:mga08y16_364722_c1_143_790 | 215 |
| 199 | 3300050512 | nmdc:mga0n895_76608_c1 | nmdc:mga0n895_76608_c1_821_1468 | 215 |
| 200 | 3300050513 | nmdc:mga0rr50_3987_c1 | nmdc:mga0rr50_3987_c1_4128_4775 | 215 |
| 201 | 3300050514 | nmdc:mga08x19_148068_c1 | nmdc:mga08x19_148068_c1_252_899 | 215 |
| 202 | 3300050515 | nmdc:mga0a205_23810_c1 | nmdc:mga0a205_23810_c1_2569_3216 | 215 |
| 203 | 3300054114 | Ga0501084_0003690 | Ga0501084_0003690_8711_9439 | 215 |
| 204 | 3300061734 | Ga0530510_0301864 | Ga0530510_0301864_354_1001 | 215 |
| 205 | 3300021388 | Ga0213875_10038416 | Ga0213875_100384162 | 216 |
| 206 | 3300025917 | Ga0207660_10952578 | Ga0207660_109525781 | 216 |
| 207 | 3300025944 | Ga0207661_10018983 | Ga0207661_100189836 | 216 |
| 208 | 3300031824 | Ga0307413_10602157 | Ga0307413_106021572 | 216 |
| 209 | 3300031901 | Ga0307406_10024104 | Ga0307406_100241042 | 216 |
| 210 | 3300032126 | Ga0307415_100187714 | Ga0307415_1001877142 | 216 |
| 211 | 3300037471 | Ga0395905_0115601 | Ga0395905_0115601_1517_2167 | 216 |
| 212 | 3300037853 | Ga0436364_0086915 | Ga0436364_0086915_405_1055 | 216 |
| 213 | 3300046463 | Ga0495653_0279822 | Ga0495653_0279822_417_1067 | 216 |
| 214 | 3300046559 | Ga0495667_0317642 | Ga0495667_0317642_283_933 | 216 |
| 215 | 3300047319 | Ga0495674_0113160 | Ga0495674_0113160_1345_1995 | 216 |
| 216 | 3300047322 | Ga0495680_0470534 | Ga0495680_0470534_96_746 | 216 |
| 217 | 3300048911 | Ga0496108_0054108 | Ga0496108_0054108_2459_3109 | 216 |
| 218 | 3300048912 | Ga0496109_0014281 | Ga0496109_0014281_5942_6592 | 216 |
| 219 | 3300048914 | Ga0496111_0147149 | Ga0496111_0147149_819_1469 | 216 |
| 220 | 3300048915 | Ga0496112_0009320 | Ga0496112_0009320_7915_8565 | 216 |
| 221 | 3300048917 | Ga0496114_0406961 | Ga0496114_0406961_302_952 | 216 |
| 222 | 3300049571 | Ga0501034_0003726 | Ga0501034_0003726_11444_12094 | 216 |
| 223 | 3300049583 | Ga0501067_0035865 | Ga0501067_0035865_255_905 | 216 |
| 224 | 3300049585 | Ga0501069_0044110 | Ga0501069_0044110_1455_2105 | 216 |
| 225 | 3300050509 | nmdc:mga0qj67_66759_c1 | nmdc:mga0qj67_66759_c1_2167_2817 | 216 |
| 226 | 3300050510 | nmdc:mga06r32_97940_c1 | nmdc:mga06r32_97940_c1_1879_2529 | 216 |
| 227 | 3300005983 | Ga0081540_1002138 | Ga0081540_10021382 | 217 |
| 228 | 3300037312 | Ga0395899_0065241 | Ga0395899_0065241_133_786 | 217 |
| 229 | 3300037418 | Ga0395900_0052766 | Ga0395900_0052766_1218_1871 | 217 |
| 230 | 3300037466 | Ga0395898_0041132 | Ga0395898_0041132_2333_2986 | 217 |
| 231 | 3300038443 | Ga0395901_0006433 | Ga0395901_0006433_8798_9451 | 217 |
| 232 | 3300044842 | Ga0466957_0204395 | Ga0466957_0204395_126_779 | 217 |
| 233 | 3300046499 | Ga0495594_0029303 | Ga0495594_0029303_1234_1887 | 217 |
| 234 | 3300005327 | Ga0070658_10061704 | Ga0070658_100617044 | 219 |
| 235 | 3300005329 | Ga0070683_100056341 | Ga0070683_1000563412 | 219 |
| 236 | 3300005336 | Ga0070680_100004650 | Ga0070680_10000465010 | 219 |
| 237 | 3300005344 | Ga0070661_100016038 | Ga0070661_1000160383 | 219 |
| 238 | 3300005345 | Ga0070692_10147180 | Ga0070692_101471802 | 219 |
| 239 | 3300005366 | Ga0070659_100004387 | Ga0070659_1000043875 | 219 |
| 240 | 3300005458 | Ga0070681_10003735 | Ga0070681_100037357 | 219 |
| 241 | 3300005530 | Ga0070679_100015356 | Ga0070679_1000153567 | 219 |
| 242 | 3300005539 | Ga0068853_100044004 | Ga0068853_1000440042 | 219 |
| 243 | 3300005564 | Ga0070664_100102358 | Ga0070664_1001023582 | 219 |
| 244 | 3300005578 | Ga0068854_100855140 | Ga0068854_1008551401 | 219 |
| 245 | 3300005614 | Ga0068856_100142605 | Ga0068856_1001426053 | 219 |
| 246 | 3300005616 | Ga0068852_100253246 | Ga0068852_1002532462 | 219 |
| 247 | 3300006847 | Ga0075431_100097050 | Ga0075431_1000970503 | 219 |
| 248 | 3300006871 | Ga0075434_100704620 | Ga0075434_1007046202 | 219 |
| 249 | 3300009093 | Ga0105240_10023223 | Ga0105240_100232239 | 219 |
| 250 | 3300009094 | Ga0111539_10168078 | Ga0111539_101680782 | 219 |
| 251 | 3300009147 | Ga0114129_10030640 | Ga0114129_100306406 | 219 |
| 252 | 3300009545 | Ga0105237_10047121 | Ga0105237_100471213 | 219 |
| 253 | 3300009551 | Ga0105238_10207565 | Ga0105238_102075652 | 219 |
| 254 | 3300013102 | Ga0157371_10135044 | Ga0157371_101350443 | 219 |
| 255 | 3300013105 | Ga0157369_10084613 | Ga0157369_100846133 | 219 |
| 256 | 3300013307 | Ga0157372_10027209 | Ga0157372_100272093 | 219 |
| 257 | 3300020070 | Ga0206356_10870607 | Ga0206356_108706071 | 219 |
| 258 | 3300020082 | Ga0206353_10838005 | Ga0206353_108380053 | 219 |
| 259 | 3300025919 | Ga0207657_10007474 | Ga0207657_100074748 | 219 |
| 260 | 3300025920 | Ga0207649_10137298 | Ga0207649_101372982 | 219 |
| 261 | 3300025921 | Ga0207652_10156561 | Ga0207652_101565613 | 219 |
| 262 | 3300025932 | Ga0207690_10038997 | Ga0207690_100389973 | 219 |
| 263 | 3300025944 | Ga0207661_10007141 | Ga0207661_100071413 | 219 |
| 264 | 3300025981 | Ga0207640_10624364 | Ga0207640_106243642 | 219 |
| 265 | 3300026041 | Ga0207639_10068263 | Ga0207639_100682633 | 219 |
| 266 | 3300037312 | Ga0395899_0201603 | Ga0395899_0201603_680_1339 | 219 |
| 267 | 3300037418 | Ga0395900_0026891 | Ga0395900_0026891_4442_5101 | 219 |
| 268 | 3300037418 | Ga0395900_0082315 | Ga0395900_0082315_23_682 | 219 |
| 269 | 3300037466 | Ga0395898_0186273 | Ga0395898_0186273_873_1532 | 219 |
| 270 | 3300037471 | Ga0395905_0171762 | Ga0395905_0171762_1323_1982 | 219 |
| 271 | 3300038443 | Ga0395901_0010276 | Ga0395901_0010276_8106_8765 | 219 |
| 272 | 3300038443 | Ga0395901_0053845 | Ga0395901_0053845_2161_2820 | 219 |
| 273 | 3300041494 | Ga0451837_1478034 | Ga0451837_1478034_94_753 | 219 |
| 274 | 3300050511 | nmdc:mga08y16_72063_c1 | nmdc:mga08y16_72063_c1_849_1508 | 219 |
| 275 | 3300050512 | nmdc:mga0n895_679153_c1 | nmdc:mga0n895_679153_c1_80_739 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x1k-assembly1.cif.gz_B | crystal structure of the flagellar expression regulator degu from listeria monocytogenes | 0.9481 | 147 | 215 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9431 | 147 | 216 |
| 1zlj-assembly2.cif.gz_C | crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain | 0.943 | 151 | 217 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9409 | 147 | 216 |
| 4qic-assembly1.cif.gz_A | co-crystal structure of anti-anti-sigma factor phyr complexed with anti-sigma factor nepr from bartonella quintana | 0.9338 | 2 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9677 | 151 | 208 | 1.10.10.10 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9352 | 1 | 83 | 3.40.50.2300 |
| 4if4B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9351 | 147 | 216 | 1.10.10.10 |
| 4if4D02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9342 | 147 | 216 | 1.10.10.10 |
| 2o8xC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.933 | 147 | 193 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y7IIA2-F1-model_v4 | Response regulator transcription factor | 0.9975 | 1 | 75 |
GO:0000160
|
| AF-A9WTE0-F1-model_v4 | Two-component response regulator | 0.9927 | 1 | 87 |
GO:0000160
|
| AF-A0A538JGH7-F1-model_v4 | Response regulator | 0.9922 | 2 | 134 |
GO:0000160
GO:0004016 GO:0009190 |
| AF-A0A6H9YBC7-F1-model_v4 | Response regulator transcription factor | 0.9862 | 1 | 139 |
GO:0000160
GO:0003677 |
| AF-A0A3N0DSD5-F1-model_v4 | Response regulator | 0.9851 | 2 | 138 |
GO:0000160
GO:0004016 GO:0009190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar