F380315

General Info

Members Datasets Scaffolds Average Seq Length
275 212 550 404

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10000684|Ga0081539_1000068457
Length 414
Sequence VRVLLIGSGGREHALAIGLAADPSVEHLIAAPGNPGIAQVAELRDVDASDPAAVATLAVEVAADLVIVGPEAPLVAGVADAVRAKGVACFGPSAAAARLEGSKEFAKEVMAAAGVPTARHHACVTEADVQRALDDFGPPYVVKNDGLAAGKGVVVTSSVEEALAHAADCGKVVIEQYLSGPEVSLFVVTDGTAAVPLTPAQDFKRIGDDDTGPNTGGMGAYAPLPWAPPNLVERVMAETVEPTLTEMRNRGTPFVGLLYVGLALTSDGPKVIEFNARFGDPETQVVLALLDTPLGGLLRAAATGTLAAHGPLTWRPGAAVTVVVASANYPGNPRTGDVIGGAERPGVIHAGTARRADGALVSAGGRVLSPTAVGPDLAAARDAAYALIDGITMDGSQHRTDIALRAAQGRIKVP

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
99 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
166 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
167 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
168 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
169 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
170 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
171 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
172 2643221590 Nocardioides sp. Root682 Isolate Unclassified
173 2643221615 Nocardioides sp. Root224 Isolate Unclassified
174 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
175 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
176 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
177 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
178 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
179 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
180 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
181 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
182 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
183 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
184 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
185 2858868258 Micromonospora sp. MH33 Isolate Unclassified
186 2858882152 Micromonospora noduli MED15 Isolate Nodule
187 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
188 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
189 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
190 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
191 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
192 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
193 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
194 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
195 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
196 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
197 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
198 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
199 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
200 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
201 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
202 2902582711 Micromonospora sp. AP08 Isolate Unclassified
203 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
204 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
205 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
206 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
207 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
208 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
209 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
210 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
211 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
212 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.55
Metatranscriptomes 0.36
Isolates 17.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 2.18
Rhizoplane 5.45
Rhizosphere 78.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10000684 3300005985 Bacteria 67889
2 JGI24735J21928_10002027 3300002067 Bacteria 7134
3 JGI25406J46586_10005592 3300003203 Bacteria 5820
4 Ga0070658_10030043 3300005327 Bacteria 4367
5 Ga0070683_100045722 3300005329 Bacteria 4041
6 Ga0070683_100173124 3300005329 Bacteria 2049
7 Ga0068869_100041820 3300005334 Bacteria 3282
8 Ga0068869_100071578 3300005334 Bacteria 2567
9 Ga0070666_10011361 3300005335 Bacteria 5587
10 Ga0070682_100011366 3300005337 Bacteria 5085
11 Ga0070682_100067628 3300005337 Bacteria 2276
12 Ga0068868_100005389 3300005338 Bacteria 8988
13 Ga0070660_100122369 3300005339 Bacteria 2077
14 Ga0070661_100068615 3300005344 Bacteria 2606
15 Ga0070668_100015708 3300005347 Bacteria 5663
16 Ga0070669_100097867 3300005353 Bacteria 2209
17 Ga0070675_100014059 3300005354 Bacteria 6304
18 Ga0070673_100056002 3300005364 Bacteria 3109
19 Ga0070659_100040979 3300005366 Bacteria 3619
20 Ga0070659_100111769 3300005366 Bacteria 2206
21 Ga0070667_100021653 3300005367 Bacteria 5335
22 Ga0070709_10037814 3300005434 Bacteria 2950
23 Ga0070710_10009978 3300005437 Bacteria 4656
24 Ga0070700_100023591 3300005441 Bacteria 3600
25 Ga0070663_100076496 3300005455 Bacteria 2448
26 Ga0070662_100115816 3300005457 Bacteria 2048
27 Ga0070684_100001624 3300005535 Bacteria 16269
28 Ga0070684_100021488 3300005535 Bacteria 5372
29 Ga0070695_100012527 3300005545 Bacteria 5090
30 Ga0070696_100001919 3300005546 Bacteria 13686
31 Ga0070704_100021159 3300005549 Bacteria 4211
32 Ga0068855_100014904 3300005563 Bacteria 9364
33 Ga0068857_100035582 3300005577 Bacteria 4410
34 Ga0068857_100137655 3300005577 Bacteria 2205
35 Ga0068857_100289783 3300005577 Bacteria 1507
36 Ga0068854_100075940 3300005578 Bacteria 2468
37 Ga0068856_100045834 3300005614 Bacteria 4306
38 Ga0070702_100006536 3300005615 Bacteria 5526
39 Ga0068859_100119568 3300005617 Bacteria 2701
40 Ga0068862_100055372 3300005844 Bacteria 3397
41 Ga0081455_10000561 3300005937 Bacteria 48447
42 Ga0081540_1001694 3300005983 Bacteria 18700
43 Ga0081539_10000143 3300005985 Bacteria 165345
44 Ga0081539_10009619 3300005985 Bacteria 8026
45 Ga0081539_10037078 3300005985 Bacteria 2908
46 Ga0075365_10073370 3300006038 Bacteria 2307
47 Ga0068871_100044307 3300006358 Bacteria 3577
48 Ga0075428_100000203 3300006844 Bacteria 56882
49 Ga0075428_100002783 3300006844 Bacteria 19053
50 Ga0075428_100013585 3300006844 Bacteria 9066
51 Ga0075430_100021627 3300006846 Bacteria 5467
52 Ga0075431_100007580 3300006847 Bacteria 10806
53 Ga0075431_100011717 3300006847 Bacteria 8845
54 Ga0075431_100026349 3300006847 Bacteria 5964
55 Ga0075431_100034743 3300006847 Bacteria 5193
56 Ga0075431_100139724 3300006847 Bacteria 2497
57 Ga0075433_10051648 3300006852 Bacteria 3581
58 Ga0075433_10086677 3300006852 Bacteria 2765
59 Ga0075429_100001858 3300006880 Bacteria 17483
60 Ga0075429_100005041 3300006880 Bacteria 11363
61 Ga0075429_100024919 3300006880 Bacteria 5193
62 Ga0068865_100060408 3300006881 Bacteria 2654
63 Ga0075436_100022081 3300006914 Bacteria 4370
64 Ga0097620_100119575 3300006931 Bacteria 2701
65 Ga0075435_100039851 3300007076 Bacteria 3750
66 Ga0105240_10019327 3300009093 Bacteria 9105
67 Ga0105240_10147535 3300009093 Bacteria 2805
68 Ga0111539_10138698 3300009094 Bacteria 2848
69 Ga0105245_10012896 3300009098 Bacteria 7286
70 Ga0114129_10000522 3300009147 Bacteria 46865
71 Ga0114129_10000597 3300009147 Bacteria 44562
72 Ga0114129_10017102 3300009147 Bacteria 10327
73 Ga0114129_10025207 3300009147 Bacteria 8427
74 Ga0114129_10054650 3300009147 Bacteria 5598
75 Ga0105237_10008885 3300009545 Bacteria 10828
76 Ga0105249_10004161 3300009553 Bacteria 12497
77 Ga0105239_10009367 3300010375 Bacteria 11051
78 Ga0105239_10010829 3300010375 Bacteria 10190
79 Ga0105239_10070148 3300010375 Bacteria 3849
80 Ga0105246_10005385 3300011119 Bacteria 7790
81 Ga0105246_10073779 3300011119 Bacteria 2410
82 Ga0157370_10090493 3300013104 Bacteria 2873
83 Ga0157374_10122278 3300013296 Bacteria 2513
84 Ga0163162_10259995 3300013306 Bacteria 1868
85 Ga0157372_10010788 3300013307 Bacteria 9727
86 Ga0157372_10127946 3300013307 Bacteria 2921
87 Ga0157375_10239268 3300013308 Bacteria 1975
88 Ga0157377_10038254 3300014745 Bacteria 2647
89 Ga0157376_10021428 3300014969 Bacteria 5019
90 Ga0163161_10026321 3300017792 Bacteria 4120
91 Ga0206353_11063375 3300020082 Bacteria 2294
92 Ga0207653_10016652 3300025885 Bacteria 2309
93 Ga0207692_10006850 3300025898 Bacteria 4640
94 Ga0207680_10136362 3300025903 Bacteria 1622
95 Ga0207647_10045681 3300025904 Bacteria 2732
96 Ga0207699_10046204 3300025906 Bacteria 2545
97 Ga0207645_10087007 3300025907 Bacteria 2008
98 Ga0207707_10143587 3300025912 Bacteria 2086
99 Ga0207695_10027948 3300025913 Bacteria 6270
100 Ga0207671_10013943 3300025914 Bacteria 6378
101 Ga0207662_10031762 3300025918 Bacteria 3069
102 Ga0207662_10118262 3300025918 Bacteria 1659
103 Ga0207657_10086298 3300025919 Bacteria 2627
104 Ga0207657_10095724 3300025919 Bacteria 2470
105 Ga0207694_10054724 3300025924 Bacteria 3096
106 Ga0207659_10073012 3300025926 Bacteria 2510
107 Ga0207687_10014465 3300025927 Bacteria 5162
108 Ga0207687_10047643 3300025927 Bacteria 2972
109 Ga0207700_10172722 3300025928 Bacteria 1804
110 Ga0207664_10024185 3300025929 Bacteria 4563
111 Ga0207706_10004988 3300025933 Bacteria 12398
112 Ga0207706_10034394 3300025933 Bacteria 4509
113 Ga0207665_10000873 3300025939 Bacteria 20381
114 Ga0207691_10139266 3300025940 Bacteria 2139
115 Ga0207689_10038511 3300025942 Bacteria 3960
116 Ga0207661_10026355 3300025944 Bacteria 4428
117 Ga0207679_10021080 3300025945 Bacteria 4409
118 Ga0207651_10234190 3300025960 Bacteria 1493
119 Ga0207712_10023918 3300025961 Bacteria 4038
120 Ga0207640_10134375 3300025981 Bacteria 1793
121 Ga0207678_10051123 3300026067 Bacteria 3568
122 Ga0207678_10094929 3300026067 Bacteria 2549
123 Ga0207708_10044480 3300026075 Bacteria 3383
124 Ga0207708_10126541 3300026075 Bacteria 1995
125 Ga0207702_10035602 3300026078 Bacteria 4163
126 Ga0207676_10135562 3300026095 Bacteria 2100
127 Ga0207674_10044538 3300026116 Bacteria 4570
128 Ga0207675_100015240 3300026118 Bacteria 7170
129 Ga0207683_10018084 3300026121 Bacteria 6010
130 Ga0207428_10079694 3300027907 Bacteria 2560
131 Ga0268264_10070394 3300028381 Bacteria 2961
132 Ga0265337_1000893 3300028556 Bacteria 15679
133 Ga0265326_10001908 3300028558 Bacteria 7135
134 Ga0265319_1002219 3300028563 Bacteria 10806
135 Ga0265334_10001290 3300028573 Bacteria 12096
136 Ga0265318_10021774 3300028577 Bacteria 2570
137 Ga0265336_10001802 3300028666 Bacteria 9360
138 Ga0307515_10000095 3300028794 Bacteria 208513
139 Ga0307515_10111748 3300028794 Bacteria 3184
140 Ga0265338_10003655 3300028800 Bacteria 21423
141 Ga0265324_10036211 3300029957 Bacteria 1716
142 Ga0265332_10002704 3300031238 Bacteria 8861
143 Ga0265320_10000942 3300031240 Bacteria 21704
144 Ga0265325_10012390 3300031241 Bacteria 4878
145 Ga0265327_10032082 3300031251 Bacteria 2944
146 Ga0265316_10031162 3300031344 Bacteria 4363
147 Ga0307513_10178403 3300031456 Bacteria 1991
148 Ga0307509_10203875 3300031507 Bacteria 1811
149 Ga0307508_10196967 3300031616 Bacteria 1615
150 Ga0265314_10001428 3300031711 Bacteria 26754
151 Ga0307516_10010360 3300031730 Bacteria 10259
152 Ga0307516_10041175 3300031730 Bacteria 4594
153 Ga0307409_100008222 3300031995 Bacteria 6314
154 Ga0307409_100013583 3300031995 Bacteria 5250
155 Ga0307409_100113997 3300031995 Bacteria 2273
156 Ga0307416_100024523 3300032002 Bacteria 4405
157 Ga0307416_100164603 3300032002 Bacteria 2055
158 Ga0307415_100045137 3300032126 Bacteria 2952
159 Ga0307507_10000002 3300033179 Bacteria 388650
160 Ga0373951_0006650 3300035091 Bacteria 2640
161 Ga0373961_0002085 3300035241 Bacteria 5321
162 Ga0373962_0008994 3300035242 Bacteria 2466
163 Ga0373937_0092604 3300036401 Bacteria 2801
164 Ga0395899_0038649 3300037312 Bacteria 3574
165 Ga0395900_0006502 3300037418 Bacteria 12182
166 Ga0395898_0031483 3300037466 Bacteria 5299
167 Ga0395898_0078965 3300037466 Bacteria 3175
168 Ga0395905_0021066 3300037471 Bacteria 6173
169 Ga0395901_0023710 3300038443 Bacteria 6292
170 Ga0395901_0037040 3300038443 Bacteria 5045
171 Ga0395901_0123215 3300038443 Bacteria 2724
172 Ga0466972_0068056 3300044658 Bacteria 1701
173 Ga0466961_0172363 3300044693 Bacteria 1345
174 Ga0466963_0020737 3300044694 Bacteria 4136
175 Ga0466963_0138994 3300044694 Bacteria 1682
176 Ga0466970_0099285 3300044765 Bacteria 1585
177 Ga0466959_0064388 3300045049 Bacteria 2661
178 Ga0466958_0026326 3300045836 Bacteria 3437
179 Ga0466958_0058663 3300045836 Bacteria 2340
180 Ga0466967_0001655 3300045976 Bacteria 13202
181 Ga0466967_0005391 3300045976 Bacteria 8855
182 Ga0466967_0019694 3300045976 Bacteria 5433
183 Ga0466967_0155055 3300045976 Bacteria 2144
184 Ga0466967_0177325 3300045976 Bacteria 2008
185 Ga0495606_0006826 3300046507 Bacteria 10420
186 Ga0495618_0028225 3300046514 Bacteria 3497
187 Ga0495632_0034031 3300046519 Bacteria 2611
188 Ga0495668_0001729 3300046616 Bacteria 20118
189 Ga0495625_0005690 3300046660 Bacteria 11289
190 Ga0495646_0059730 3300046680 Bacteria 2276
191 Ga0495600_0137235 3300046809 Bacteria 1588
192 Ga0495680_0069091 3300047322 Bacteria 2696
193 Ga0495626_0001543 3300048091 Bacteria 18096
194 Ga0496100_0019393 3300048903 Bacteria 4057
195 Ga0496103_0138999 3300048906 Bacteria 1553
196 Ga0496104_0008050 3300048907 Bacteria 9349
197 Ga0496107_0035943 3300048910 Bacteria 3553
198 Ga0496108_0011279 3300048911 Bacteria 7259
199 Ga0496108_0053878 3300048911 Bacteria 3375
200 Ga0496109_0064392 3300048912 Bacteria 3355
201 Ga0496109_0162119 3300048912 Bacteria 2095
202 Ga0496110_0006152 3300048913 Bacteria 9465
203 Ga0496110_0180564 3300048913 Bacteria 1916
204 Ga0496111_0037550 3300048914 Bacteria 3466
205 Ga0496111_0099786 3300048914 Bacteria 2132
206 Ga0496112_0009236 3300048915 Bacteria 8864
207 Ga0496113_0179787 3300048916 Bacteria 1677
208 Ga0496114_0129612 3300048917 Bacteria 2177
209 nmdc:mga05p37_157_c1 3300050507 Bacteria 65045
210 nmdc:mga05p37_42114_c1 3300050507 Bacteria 5610
211 nmdc:mga05p37_76015_c1 3300050507 Bacteria 4135
212 nmdc:mga05p37_86_c1 3300050507 Bacteria 81974
213 nmdc:mga09592_161932_c1 3300050508 Bacteria 1933
214 nmdc:mga09592_25_c1 3300050508 Bacteria 44492
215 nmdc:mga0qj67_10399_c1 3300050509 Bacteria 6952
216 nmdc:mga0qj67_164_c1 3300050509 Bacteria 44665
217 nmdc:mga06r32_14444_c1 3300050510 Bacteria 7167
218 nmdc:mga06r32_202925_c1 3300050510 Bacteria 1970
219 nmdc:mga06r32_281_c1 3300050510 Bacteria 42391
220 nmdc:mga06r32_3112_c1 3300050510 Bacteria 14857
221 nmdc:mga06r32_65462_c1 3300050510 Bacteria 3506
222 nmdc:mga06r32_94732_c1 3300050510 Bacteria 2922
223 nmdc:mga0n895_108552_c1 3300050512 Bacteria 2790
224 nmdc:mga0a205_100574_c1 3300050515 Bacteria 2790
225 nmdc:mga0a205_62687_c1 3300050515 Bacteria 3592
226 Ga0495595_0059615 3300053084 Bacteria 1785
227 Ga0500641_0012880 3300053096 Bacteria 3063
228 Ga0466962_0019778 3300061719 Bacteria 3235
229 2515497457 2515154088 Bacteria 5526283
230 2515722192 2515154129 Bacteria 5584369
231 2515756085 2515154137 Bacteria 5711575
232 2516084706 2515154202 Bacteria 5471270
233 2516091457 2515154203 Bacteria 5458536
234 2623585974 2622736626 Bacteria 7181580
235 2643959563 2643221590 Bacteria 5214697
236 2644092939 2643221615 Bacteria 5487866
237 2644322552 2643221657 Bacteria 5490246
238 2676486161 2675903059 Bacteria 8644972
239 2772646778 2772190715 Bacteria 6959372
240 2812330994 2811994874 Bacteria 5367947
241 2831940852 2831935698 Bacteria 5963223
242 2832005735 2832004796 Bacteria 6538017
243 2837274948 2837268691 Bacteria 7850704
244 2855671839 2855670206 Bacteria 7120389
245 2855676922 2855676851 Bacteria 7063653
246 2857289767 2857288857 Bacteria 7189066
247 2858852484 2858848962 Bacteria 6963058
248 2858869589 2858868258 Bacteria 7683772
249 2858887765 2858882152 Bacteria 7230291
250 2858895261 2858888857 Bacteria 7060307
251 2858898743 2858895516 Bacteria 7378898
252 2858904736 2858902515 Bacteria 7086037
253 2866070212 2866065130 Bacteria 6518152
254 2867304521 2867302475 Bacteria 7087181
255 2867319064 2867312974 Bacteria 7058875
256 2867324628 2867319477 Bacteria 7069771
257 2867347759 2867346516 Bacteria 7608576
258 2867510206 2867507094 Bacteria 6506033
259 2869049741 2869048445 Bacteria 6875584
260 2869064694 2869061728 Bacteria 7112407
261 2869070971 2869068681 Bacteria 7205615
262 2880494299 2880489317 Bacteria 7096270
263 2880498027 2880495981 Bacteria 7340502
264 2887484562 2887478801 Bacteria 8972725
265 2902587674 2902582711 Bacteria 6187705
266 2929220070 2929219909 Bacteria 6984360
267 2929226589 2929226422 Bacteria 7248583
268 2996226043 2996221748 Bacteria 6799777
269 8003832191 8003830390 Bacteria 6541657
270 8003870659 8003870546 Bacteria 7396674
271 8054705579 8054704163 Bacteria 7247792
272 8054733441 8054727385 Bacteria 7558670
273 8054737127 8054734606 Bacteria 6947278
274 8055416299 8055412473 Bacteria 6257500
275 8056064601 8056060235 Bacteria 7259403
276 Ga0081539_10000684
277 JGI24735J21928_10002027
278 JGI25406J46586_10005592
279 Ga0070658_10030043
280 Ga0070683_100045722
281 Ga0070683_100173124
282 Ga0068869_100041820
283 Ga0068869_100071578
284 Ga0070666_10011361
285 Ga0070682_100011366
286 Ga0070682_100067628
287 Ga0068868_100005389
288 Ga0070660_100122369
289 Ga0070661_100068615
290 Ga0070668_100015708
291 Ga0070669_100097867
292 Ga0070675_100014059
293 Ga0070673_100056002
294 Ga0070659_100040979
295 Ga0070659_100111769
296 Ga0070667_100021653
297 Ga0070709_10037814
298 Ga0070710_10009978
299 Ga0070700_100023591
300 Ga0070663_100076496
301 Ga0070662_100115816
302 Ga0070684_100001624
303 Ga0070684_100021488
304 Ga0070695_100012527
305 Ga0070696_100001919
306 Ga0070704_100021159
307 Ga0068855_100014904
308 Ga0068857_100035582
309 Ga0068857_100137655
310 Ga0068857_100289783
311 Ga0068854_100075940
312 Ga0068856_100045834
313 Ga0070702_100006536
314 Ga0068859_100119568
315 Ga0068862_100055372
316 Ga0081455_10000561
317 Ga0081540_1001694
318 Ga0081539_10000143
319 Ga0081539_10009619
320 Ga0081539_10037078
321 Ga0075365_10073370
322 Ga0068871_100044307
323 Ga0075428_100000203
324 Ga0075428_100002783
325 Ga0075428_100013585
326 Ga0075430_100021627
327 Ga0075431_100007580
328 Ga0075431_100011717
329 Ga0075431_100026349
330 Ga0075431_100034743
331 Ga0075431_100139724
332 Ga0075433_10051648
333 Ga0075433_10086677
334 Ga0075429_100001858
335 Ga0075429_100005041
336 Ga0075429_100024919
337 Ga0068865_100060408
338 Ga0075436_100022081
339 Ga0097620_100119575
340 Ga0075435_100039851
341 Ga0105240_10019327
342 Ga0105240_10147535
343 Ga0111539_10138698
344 Ga0105245_10012896
345 Ga0114129_10000522
346 Ga0114129_10000597
347 Ga0114129_10017102
348 Ga0114129_10025207
349 Ga0114129_10054650
350 Ga0105237_10008885
351 Ga0105249_10004161
352 Ga0105239_10009367
353 Ga0105239_10010829
354 Ga0105239_10070148
355 Ga0105246_10005385
356 Ga0105246_10073779
357 Ga0157370_10090493
358 Ga0157374_10122278
359 Ga0163162_10259995
360 Ga0157372_10010788
361 Ga0157372_10127946
362 Ga0157375_10239268
363 Ga0157377_10038254
364 Ga0157376_10021428
365 Ga0163161_10026321
366 Ga0206353_11063375
367 Ga0207653_10016652
368 Ga0207692_10006850
369 Ga0207680_10136362
370 Ga0207647_10045681
371 Ga0207699_10046204
372 Ga0207645_10087007
373 Ga0207707_10143587
374 Ga0207695_10027948
375 Ga0207671_10013943
376 Ga0207662_10031762
377 Ga0207662_10118262
378 Ga0207657_10086298
379 Ga0207657_10095724
380 Ga0207694_10054724
381 Ga0207659_10073012
382 Ga0207687_10014465
383 Ga0207687_10047643
384 Ga0207700_10172722
385 Ga0207664_10024185
386 Ga0207706_10004988
387 Ga0207706_10034394
388 Ga0207665_10000873
389 Ga0207691_10139266
390 Ga0207689_10038511
391 Ga0207661_10026355
392 Ga0207679_10021080
393 Ga0207651_10234190
394 Ga0207712_10023918
395 Ga0207640_10134375
396 Ga0207678_10051123
397 Ga0207678_10094929
398 Ga0207708_10044480
399 Ga0207708_10126541
400 Ga0207702_10035602
401 Ga0207676_10135562
402 Ga0207674_10044538
403 Ga0207675_100015240
404 Ga0207683_10018084
405 Ga0207428_10079694
406 Ga0268264_10070394
407 Ga0265337_1000893
408 Ga0265326_10001908
409 Ga0265319_1002219
410 Ga0265334_10001290
411 Ga0265318_10021774
412 Ga0265336_10001802
413 Ga0307515_10000095
414 Ga0307515_10111748
415 Ga0265338_10003655
416 Ga0265324_10036211
417 Ga0265332_10002704
418 Ga0265320_10000942
419 Ga0265325_10012390
420 Ga0265327_10032082
421 Ga0265316_10031162
422 Ga0307513_10178403
423 Ga0307509_10203875
424 Ga0307508_10196967
425 Ga0265314_10001428
426 Ga0307516_10010360
427 Ga0307516_10041175
428 Ga0307409_100008222
429 Ga0307409_100013583
430 Ga0307409_100113997
431 Ga0307416_100024523
432 Ga0307416_100164603
433 Ga0307415_100045137
434 Ga0307507_10000002
435 Ga0373951_0006650
436 Ga0373961_0002085
437 Ga0373962_0008994
438 Ga0373937_0092604
439 Ga0395899_0038649
440 Ga0395900_0006502
441 Ga0395898_0031483
442 Ga0395898_0078965
443 Ga0395905_0021066
444 Ga0395901_0023710
445 Ga0395901_0037040
446 Ga0395901_0123215
447 Ga0466972_0068056
448 Ga0466961_0172363
449 Ga0466963_0020737
450 Ga0466963_0138994
451 Ga0466970_0099285
452 Ga0466959_0064388
453 Ga0466958_0026326
454 Ga0466958_0058663
455 Ga0466967_0001655
456 Ga0466967_0005391
457 Ga0466967_0019694
458 Ga0466967_0155055
459 Ga0466967_0177325
460 Ga0495606_0006826
461 Ga0495618_0028225
462 Ga0495632_0034031
463 Ga0495668_0001729
464 Ga0495625_0005690
465 Ga0495646_0059730
466 Ga0495600_0137235
467 Ga0495680_0069091
468 Ga0495626_0001543
469 Ga0496100_0019393
470 Ga0496103_0138999
471 Ga0496104_0008050
472 Ga0496107_0035943
473 Ga0496108_0011279
474 Ga0496108_0053878
475 Ga0496109_0064392
476 Ga0496109_0162119
477 Ga0496110_0006152
478 Ga0496110_0180564
479 Ga0496111_0037550
480 Ga0496111_0099786
481 Ga0496112_0009236
482 Ga0496113_0179787
483 Ga0496114_0129612
484 nmdc:mga05p37_157_c1
485 nmdc:mga05p37_42114_c1
486 nmdc:mga05p37_76015_c1
487 nmdc:mga05p37_86_c1
488 nmdc:mga09592_161932_c1
489 nmdc:mga09592_25_c1
490 nmdc:mga0qj67_10399_c1
491 nmdc:mga0qj67_164_c1
492 nmdc:mga06r32_14444_c1
493 nmdc:mga06r32_202925_c1
494 nmdc:mga06r32_281_c1
495 nmdc:mga06r32_3112_c1
496 nmdc:mga06r32_65462_c1
497 nmdc:mga06r32_94732_c1
498 nmdc:mga0n895_108552_c1
499 nmdc:mga0a205_100574_c1
500 nmdc:mga0a205_62687_c1
501 Ga0495595_0059615
502 Ga0500641_0012880
503 Ga0466962_0019778
504 2515497457
505 2515722192
506 2515756085
507 2516084706
508 2516091457
509 2623585974
510 2643959563
511 2644092939
512 2644322552
513 2676486161
514 2772646778
515 2812330994
516 2831940852
517 2832005735
518 2837274948
519 2855671839
520 2855676922
521 2857289767
522 2858852484
523 2858869589
524 2858887765
525 2858895261
526 2858898743
527 2858904736
528 2866070212
529 2867304521
530 2867319064
531 2867324628
532 2867347759
533 2867510206
534 2869049741
535 2869064694
536 2869070971
537 2880494299
538 2880498027
539 2887484562
540 2902587674
541 2929220070
542 2929226589
543 2996226043
544 8003832191
545 8003870659
546 8054705579
547 8054733441
548 8054737127
549 8055416299
550 8056064601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02844

GARS_N

Phosphoribosylglycinamide synthetase, N domain

1

100

0.99

PF01071

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain

101

283

0.98

PF02843

GARS_C

Phosphoribosylglycinamide synthetase, C domain

319

405

0.94

PF02655

ATP-grasp_3

ATP-grasp domain

102

281

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9569 1 402
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9432 1 402
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9377 1 406
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9333 1 406
2xd4-assembly1.cif.gz_A nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase 0.9324 1 406
ID Description Score Start End Superfamily
af_P9WHM9_327_413_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9982 319 403 3.90.600.10
af_P9WHM9_188_326_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9866 179 316 3.30.470.20
af_P9WHM9_188_326_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9727 179 316 3.30.470.20
af_P9WHM9_2_93_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9713 2 93 3.40.50.20
af_P9WHM9_327_413_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9642 319 403 3.90.600.10
ID Description Score Start End GO Terms
AF-A0A6B3HMF0-F1-model_v4 Phosphoribosylamine--glycine ligase 0.9865 1 87 GO:0004637
GO:0009113
AF-A0A4Y9MPT1-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9854 1 406 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A4Y9MPT1-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9806 1 406 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A543CL16-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9778 1 404 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A095Y7I8-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9774 1 404 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872

Map