F380089

General Info

Members Datasets Scaffolds Average Seq Length
274 192 251 344

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935390628|2935391282
Length 390
Sequence VFQGPERTAWQDVPDPAIKDPADVIVRVDAVTICGTDLHIVKGDLPEVVPGRVLGHEAVGTVVECGGDVRSVRPGDRVLVSCISSCGRCRFCREGRYGQCRGGGGWVLGHTIDGTQAEYVRVPFADLSVYPLPSTVDSAEAVLLADVFPTSYEVGVLNGEVRPGDTVVVVGAGPVGLAAIATARLYSPGRVIAVDLASSRLEKARELGADAIVNAAEDPERLVDDLTDGLGADVVMEAVGAPGTFEMCTRMVRPGGRVANIGVHGKPATLHLEDLWIKDITLTTGLVDTRSTPMLLRMLAAGRLPTASLITHRFELGQMEEAYEVFSRAGETGALKIVLGGPRHDDLPYRTRRASRGRDPPCARGSAGKAFWISGEGRRRRLPADWRGCR

Samples

Sample ID Description Type Environment
1 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
2 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
3 2643221714 Streptomyces sp. Root264 Isolate Unclassified
4 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
5 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
6 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
7 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
8 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
9 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
10 2862574272 Streptomyces sp. AcE210 Isolate Nodule
11 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
12 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
13 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
14 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
15 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
16 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
57 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
76 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
77 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
86 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
183 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
184 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
190 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
191 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
192 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.51
Metatranscriptomes 0.73
Isolates 8.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0.73
Rhizoplane 4.74
Rhizosphere 78.83
Stem 0
Stem Tuber 0
Unclassified 13.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10043795 3300003320 Bacteria 5697
2 rootH1_10011831 3300003323 Bacteria 9228
3 rootH1_10024977 3300003316 Bacteria 1346
4 rootH1_10024977 3300003323 Bacteria 25411
5 Ga0006562J51391_1070987 3300003578 Bacteria 4180
6 Ga0070658_10263981 3300005327 Bacteria 1463
7 Ga0070683_100082768 3300005329 Bacteria 3006
8 Ga0070690_100183373 3300005330 Bacteria 1447
9 Ga0068869_100098852 3300005334 Bacteria 2205
10 Ga0068868_100198909 3300005338 Bacteria 1670
11 Ga0070668_100129188 3300005347 Bacteria 2027
12 Ga0070674_100019826 3300005356 Bacteria 4281
13 Ga0070703_10031812 3300005406 Bacteria 1598
14 Ga0070681_10000044 3300005458 Bacteria 85697
15 Ga0070681_10408671 3300005458 Bacteria 1269
16 Ga0070679_100000022 3300005530 Bacteria 123735
17 Ga0070684_100055197 3300005535 Bacteria 3462
18 Ga0070672_100208540 3300005543 Bacteria 1636
19 Ga0068856_100152556 3300005614 Bacteria 2320
20 Ga0068852_100312471 3300005616 Bacteria 1524
21 Ga0075367_10002899 3300006178 Bacteria 7988
22 Ga0075428_100004412 3300006844 Bacteria 15537
23 Ga0075430_100000091 3300006846 Bacteria 52409
24 Ga0105245_10037456 3300009098 Bacteria 4312
25 Ga0105248_10283054 3300009177 Bacteria 1867
26 Ga0105249_10273504 3300009553 Bacteria 1684
27 Ga0157370_10414325 3300013104 Bacteria 1240
28 Ga0157369_10009541 3300013105 Bacteria 11100
29 Ga0157369_10216747 3300013105 Bacteria 2004
30 Ga0157375_10002239 3300013308 Bacteria 16723
31 Ga0157375_10455173 3300013308 Bacteria 1445
32 Ga0163163_10062854 3300014325 Bacteria 3680
33 Ga0182008_10004667 3300014497 Bacteria 7963
34 Ga0182007_10003186 3300015262 Bacteria 7842
35 Ga0163161_10228244 3300017792 Bacteria 1444
36 Ga0206353_11485339 3300020082 Bacteria 1216
37 Ga0207688_10007930 3300025901 Bacteria 5778
38 Ga0207707_10000041 3300025912 Bacteria 130140
39 Ga0207652_10000033 3300025921 Bacteria 139131
40 Ga0207691_10069083 3300025940 Bacteria 3192
41 Ga0207640_10304142 3300025981 Bacteria 1263
42 Ga0207674_10256688 3300026116 Bacteria 1695
43 Ga0207698_10351918 3300026142 Bacteria 1392
44 Ga0207698_10495896 3300026142 Bacteria 1187
45 Ga0307515_10000683 3300028794 Bacteria 78103
46 Ga0307515_10255360 3300028794 Bacteria 1498
47 Ga0307511_10030405 3300030521 Bacteria 4852
48 Ga0307512_10004092 3300030522 Bacteria 16218
49 Ga0307512_10019201 3300030522 Bacteria 6229
50 Ga0265327_10004391 3300031251 Bacteria 12516
51 Ga0265316_10001369 3300031344 Bacteria 26260
52 Ga0307513_10011436 3300031456 Bacteria 11032
53 Ga0307509_10010601 3300031507 Bacteria 11264
54 Ga0307509_10035705 3300031507 Bacteria 5453
55 Ga0307408_100045122 3300031548 Bacteria 3146
56 Ga0307508_10020448 3300031616 Bacteria 6011
57 Ga0307508_10079175 3300031616 Bacteria 2867
58 Ga0307508_10124784 3300031616 Bacteria 2177
59 Ga0307514_10011371 3300031649 Bacteria 7400
60 Ga0307516_10026224 3300031730 Bacteria 5921
61 Ga0307516_10027089 3300031730 Bacteria 5815
62 Ga0307516_10031664 3300031730 Bacteria 5331
63 Ga0307516_10061824 3300031730 Bacteria 3632
64 Ga0307516_10118615 3300031730 Bacteria 2440
65 Ga0307518_10021538 3300031838 Bacteria 4638
66 Ga0307406_10022721 3300031901 Bacteria 3723
67 Ga0307406_10030973 3300031901 Bacteria 3253
68 Ga0307407_10015724 3300031903 Bacteria 3750
69 Ga0307412_10081482 3300031911 Bacteria 2238
70 Ga0307409_100062092 3300031995 Bacteria 2923
71 Ga0307416_100030429 3300032002 Bacteria 4050
72 Ga0307415_100140780 3300032126 Bacteria 1842
73 Ga0307507_10027516 3300033179 Bacteria 6092
74 Ga0307510_10001830 3300033180 Bacteria 23821
75 Ga0307510_10059629 3300033180 Bacteria 3937
76 Ga0373950_0008073 3300034818 Bacteria 1647
77 Ga0373940_0005345 3300035088 Bacteria 2775
78 Ga0373942_0000136 3300035207 Bacteria 17474
79 Ga0395899_0205307 3300037312 Bacteria 1371
80 Ga0395900_0044515 3300037418 Bacteria 4573
81 Ga0395898_0027838 3300037466 Bacteria 5668
82 Ga0395898_0071638 3300037466 Bacteria 3349
83 Ga0395905_0262005 3300037471 Bacteria 1614
84 Ga0395901_0019474 3300038443 Bacteria 6939
85 Ga0395901_0159264 3300038443 Bacteria 2371
86 Ga0395901_0243323 3300038443 Bacteria 1876
87 Ga0439436_0008850 3300041404 Bacteria 3089
88 Ga0439436_0021204 3300041404 Bacteria 1933
89 Ga0451853_1814077 3300041512 Bacteria 20470
90 Ga0439433_0009448 3300041999 Bacteria 2124
91 Ga0439442_028160 3300042002 Bacteria 1171
92 Ga0439449_0015011 3300042007 Bacteria 2910
93 Ga0439457_000888 3300042014 Bacteria 9036
94 Ga0439457_001152 3300042014 Bacteria 7956
95 Ga0451577_0431662 3300042876 Bacteria 1196
96 Ga0466969_0008533 3300044656 Bacteria 5438
97 Ga0466969_0058616 3300044656 Bacteria 1874
98 Ga0466972_0001518 3300044658 Bacteria 11308
99 Ga0466972_0004169 3300044658 Bacteria 7218
100 Ga0466965_0000518 3300044683 Bacteria 13770
101 Ga0466965_0055222 3300044683 Bacteria 1976
102 Ga0466965_0179941 3300044683 Bacteria 1115
103 Ga0466966_0001516 3300044684 Bacteria 14892
104 Ga0466966_0015759 3300044684 Bacteria 4997
105 Ga0466961_0000640 3300044693 Bacteria 21980
106 Ga0466961_0004757 3300044693 Bacteria 8546
107 Ga0466963_0000047 3300044694 Bacteria 40057
108 Ga0466964_0001538 3300044706 Bacteria 7935
109 Ga0453684_0064048 3300044712 Bacteria 4698
110 Ga0466971_0000233 3300044719 Bacteria 21193
111 Ga0466971_0041902 3300044719 Bacteria 2057
112 Ga0466970_0000378 3300044765 Bacteria 21629
113 Ga0466957_0000319 3300044842 Bacteria 23345
114 Ga0466959_0004910 3300045049 Bacteria 9057
115 Ga0466959_0033514 3300045049 Bacteria 3798
116 Ga0451576_0122908 3300045051 Bacteria 2703
117 Ga0466958_0000122 3300045836 Bacteria 25398
118 Ga0466967_0000547 3300045976 Bacteria 18283
119 Ga0495592_0012143 3300046454 Bacteria 6536
120 Ga0495603_0000591 3300046455 Bacteria 20377
121 Ga0495603_0020825 3300046455 Bacteria 3970
122 Ga0495603_0028704 3300046455 Bacteria 3356
123 Ga0495629_0001131 3300046459 Bacteria 21102
124 Ga0495629_0002185 3300046459 Bacteria 15099
125 Ga0495629_0003011 3300046459 Bacteria 12823
126 Ga0495629_0027364 3300046459 Bacteria 4047
127 Ga0495638_0021137 3300046460 Bacteria 4293
128 Ga0495651_0011481 3300046462 Bacteria 6802
129 Ga0495582_0233040 3300046473 Bacteria 1054
130 Ga0495664_0008139 3300046477 Bacteria 5838
131 Ga0495664_0130340 3300046477 Bacteria 1522
132 Ga0495585_0016638 3300046492 Bacteria 4261
133 Ga0495594_0013539 3300046499 Bacteria 4260
134 Ga0495618_0045595 3300046514 Bacteria 2766
135 Ga0495618_0135360 3300046514 Bacteria 1576
136 Ga0495628_0018756 3300046516 Bacteria 5727
137 Ga0495628_0026031 3300046516 Bacteria 4775
138 Ga0495632_0019820 3300046519 Bacteria 3656
139 Ga0495666_0006655 3300046526 Bacteria 5810
140 Ga0495652_0033876 3300046529 Bacteria 4455
141 Ga0495640_0000238 3300046533 Bacteria 36866
142 Ga0495640_0172338 3300046533 Bacteria 1382
143 Ga0495587_0007853 3300046536 Bacteria 6890
144 Ga0495645_0081671 3300046543 Bacteria 2319
145 Ga0495622_0000459 3300046557 Bacteria 26071
146 Ga0495634_0004085 3300046642 Bacteria 11559
147 Ga0495634_0146462 3300046642 Bacteria 1496
148 Ga0495611_0025194 3300046648 Bacteria 2591
149 Ga0495635_0013220 3300046663 Bacteria 5777
150 Ga0495588_0000515 3300046674 Bacteria 18686
151 Ga0495588_0009873 3300046674 Bacteria 4425
152 Ga0495657_0002420 3300046675 Bacteria 15726
153 Ga0495657_0006152 3300046675 Bacteria 9406
154 Ga0495623_0038990 3300046679 Bacteria 3037
155 Ga0495646_0004549 3300046680 Bacteria 8737
156 Ga0495646_0017034 3300046680 Bacteria 4612
157 Ga0495658_0030968 3300046683 Bacteria 2909
158 Ga0495613_0003309 3300046689 Bacteria 12064
159 Ga0495613_0004702 3300046689 Bacteria 10244
160 Ga0495613_0006632 3300046689 Bacteria 8647
161 Ga0495613_0111251 3300046689 Bacteria 1973
162 Ga0495589_0001091 3300046794 Bacteria 16189
163 Ga0495589_0036649 3300046794 Bacteria 2458
164 Ga0495600_0021030 3300046809 Bacteria 4175
165 Ga0495660_0128642 3300046810 Bacteria 1273
166 Ga0495581_0041728 3300047315 Bacteria 2655
167 Ga0495604_0015023 3300047317 Bacteria 6176
168 Ga0495604_0029435 3300047317 Bacteria 4369
169 Ga0495672_0012874 3300047320 Bacteria 5803
170 Ga0495672_0024249 3300047320 Bacteria 3912
171 Ga0495676_0002748 3300047321 Bacteria 15785
172 Ga0495676_0003304 3300047321 Bacteria 14576
173 Ga0495676_0004479 3300047321 Bacteria 12770
174 Ga0495676_0005153 3300047321 Bacteria 11970
175 Ga0495676_0022048 3300047321 Bacteria 5550
176 Ga0495676_0144606 3300047321 Bacteria 1700
177 Ga0495687_007869 3300047443 Bacteria 6199
178 Ga0495687_009846 3300047443 Bacteria 5300
179 Ga0495675_0010713 3300047444 Bacteria 5739
180 Ga0495685_000634 3300047447 Bacteria 10765
181 Ga0495685_008336 3300047447 Bacteria 3440
182 Ga0495593_0000705 3300047673 Bacteria 19295
183 Ga0495602_0030086 3300048088 Bacteria 5158
184 Ga0495602_0180732 3300048088 Bacteria 1627
185 Ga0495614_0001537 3300048089 Bacteria 10001
186 Ga0495614_0002389 3300048089 Bacteria 8348
187 Ga0496101_0018806 3300048904 Bacteria 4704
188 Ga0496102_0177010 3300048905 Bacteria 2009
189 Ga0496108_0113032 3300048911 Bacteria 2324
190 Ga0496108_0192537 3300048911 Bacteria 1768
191 Ga0496109_0004610 3300048912 Bacteria 11502
192 Ga0496110_0033376 3300048913 Bacteria 4452
193 Ga0496111_0007833 3300048914 Bacteria 7036
194 Ga0496112_0001887 3300048915 Bacteria 16527
195 Ga0496112_0145193 3300048915 Bacteria 2341
196 Ga0496112_0559541 3300048915 Bacteria 1077
197 Ga0496113_0044887 3300048916 Bacteria 3275
198 Ga0496114_0003337 3300048917 Bacteria 12340
199 Ga0496114_0153504 3300048917 Bacteria 1998
200 Ga0501031_0056568 3300049568 Bacteria 2556
201 Ga0501032_0001463 3300049569 Bacteria 18788
202 Ga0501032_0227346 3300049569 Bacteria 1213
203 Ga0501033_0032437 3300049570 Bacteria 3924
204 Ga0501033_0127671 3300049570 Bacteria 1843
205 Ga0501034_0001245 3300049571 Bacteria 34615
206 Ga0501034_0375924 3300049571 Bacteria 1346
207 Ga0501036_0000668 3300049572 Bacteria 25177
208 Ga0501037_0002303 3300049573 Bacteria 13782
209 Ga0501038_0102418 3300049574 Bacteria 2382
210 Ga0501039_0000294 3300049575 Bacteria 35512
211 Ga0501040_0100452 3300049576 Bacteria 2017
212 Ga0501042_0020971 3300049578 Bacteria 4551
213 Ga0501043_0000026 3300049579 Bacteria 149818
214 Ga0501043_0153355 3300049579 Bacteria 1802
215 Ga0501046_0000019 3300049580 Bacteria 219823
216 Ga0501046_0000596 3300049580 Bacteria 35421
217 Ga0501046_0003679 3300049580 Bacteria 14047
218 Ga0501047_0000019 3300049581 Bacteria 265794
219 Ga0501047_0082574 3300049581 Bacteria 3088
220 Ga0501047_0193571 3300049581 Bacteria 1896
221 Ga0501048_0000025 3300049582 Bacteria 67320
222 Ga0501048_0000185 3300049582 Bacteria 39725
223 Ga0501067_0016386 3300049583 Bacteria 4095
224 Ga0501069_0001840 3300049585 Bacteria 10585
225 Ga0501070_0004000 3300049586 Bacteria 12666
226 Ga0501071_0015688 3300049587 Bacteria 5202
227 Ga0501073_0025750 3300049589 Bacteria 4215
228 Ga0501074_0000257 3300049590 Bacteria 30059
229 Ga0501080_0000484 3300049742 Bacteria 30966
230 Ga0501080_0002302 3300049742 Bacteria 16645
231 Ga0501083_0012890 3300049744 Bacteria 5847
232 Ga0501035_0036039 3300049822 Bacteria 4486
233 Ga0501035_0047117 3300049822 Bacteria 3872
234 Ga0501035_0268496 3300049822 Bacteria 1444
235 Ga0501035_0411767 3300049822 Bacteria 1123
236 Ga0501044_0000279 3300049823 Bacteria 64930
237 Ga0501044_0028336 3300049823 Bacteria 5912
238 Ga0501044_0098497 3300049823 Bacteria 2943
239 Ga0501045_0001681 3300049824 Bacteria 14894
240 Ga0501045_0099038 3300049824 Bacteria 2157
241 nmdc:mga06z11_5344_c1 3300050494 Bacteria 5144
242 Ga0495601_0002955 3300053077 Bacteria 9662
243 Ga0495601_0111450 3300053077 Bacteria 1772
244 Ga0495619_0244711 3300053085 Bacteria 1243
245 Ga0500640_042896 3300053095 Bacteria 1986
246 Ga0500553_091119 3300053101 Bacteria 1341
247 Ga0500560_000561 3300053107 Bacteria 5331
248 Ga0500559_0048718 3300053136 Bacteria 1865
249 Ga0500600_0113776 3300053149 Bacteria 1406
250 Ga0501084_0000487 3300054114 Bacteria 30390
251 Ga0466962_0000181 3300061719 Bacteria 26153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034818 Ga0373950_0008073 Ga0373950_0008073_776_1630 270
2 3300047321 Ga0495676_0144606 Ga0495676_0144606_587_1615 275
3 3300025901 Ga0207688_10007930 Ga0207688_100079305 281
4 3300046689 Ga0495613_0111251 Ga0495613_0111251_15_980 285
5 3300046492 Ga0495585_0016638 Ga0495585_0016638_3177_4205 287
6 3300046526 Ga0495666_0006655 Ga0495666_0006655_2311_3339 287
7 3300046557 Ga0495622_0000459 Ga0495622_0000459_23093_24121 287
8 3300046810 Ga0495660_0128642 Ga0495660_0128642_162_1190 287
9 3300047443 Ga0495687_009846 Ga0495687_009846_3207_4235 287
10 3300047447 Ga0495685_000634 Ga0495685_000634_6406_7434 287
11 3300050494 nmdc:mga06z11_5344_c1 nmdc:mga06z11_5344_c1_1876_2841 292
12 3300026142 Ga0207698_10351918 Ga0207698_103519182 297
13 3300028794 Ga0307515_10255360 Ga0307515_102553602 304
14 3300046519 Ga0495632_0019820 Ga0495632_0019820_2097_3053 304
15 3300046516 Ga0495628_0018756 Ga0495628_0018756_1324_2352 306
16 3300046533 Ga0495640_0000238 Ga0495640_0000238_23327_24355 306
17 3300046675 Ga0495657_0002420 Ga0495657_0002420_13490_14518 306
18 3300046689 Ga0495613_0003309 Ga0495613_0003309_2343_3371 306
19 3300047317 Ga0495604_0029435 Ga0495604_0029435_1817_2845 306
20 3300031730 Ga0307516_10118615 Ga0307516_101186152 309
21 3300006178 Ga0075367_10002899 Ga0075367_100028992 313
22 3300049570 Ga0501033_0032437 Ga0501033_0032437_2803_3837 314
23 3300049580 Ga0501046_0003679 Ga0501046_0003679_10240_11283 314
24 3300049822 Ga0501035_0047117 Ga0501035_0047117_70_1113 314
25 3300049823 Ga0501044_0000279 Ga0501044_0000279_17652_18695 314
26 3300046473 Ga0495582_0233040 Ga0495582_0233040_36_1028 317
27 3300005616 Ga0068852_100312471 Ga0068852_1003124712 319
28 3300013308 Ga0157375_10002239 Ga0157375_100022392 319
29 3300014325 Ga0163163_10062854 Ga0163163_100628542 319
30 3300017792 Ga0163161_10228244 Ga0163161_102282442 319
31 3300048905 Ga0496102_0177010 Ga0496102_0177010_624_1673 319
32 3300048912 Ga0496109_0004610 Ga0496109_0004610_4085_5134 319
33 3300048914 Ga0496111_0007833 Ga0496111_0007833_5168_6217 319
34 3300048915 Ga0496112_0001887 Ga0496112_0001887_2888_3937 319
35 3300048917 Ga0496114_0003337 Ga0496114_0003337_8977_10026 319
36 3300009098 Ga0105245_10037456 Ga0105245_100374565 321
37 3300048913 Ga0496110_0033376 Ga0496110_0033376_1326_2372 321
38 3300026142 Ga0207698_10495896 Ga0207698_104958961 322
39 3300003323 rootH1_10011831 rootH1_100118315 323
40 3300005329 Ga0070683_100082768 Ga0070683_1000827682 323
41 3300044656 Ga0466969_0058616 Ga0466969_0058616_15_1082 323
42 3300044683 Ga0466965_0055222 Ga0466965_0055222_218_1285 323
43 3300044684 Ga0466966_0015759 Ga0466966_0015759_2028_3095 323
44 3300044693 Ga0466961_0004757 Ga0466961_0004757_1395_2462 323
45 3300044719 Ga0466971_0041902 Ga0466971_0041902_474_1541 323
46 3300045049 Ga0466959_0033514 Ga0466959_0033514_1344_2411 323
47 3300049579 Ga0501043_0000026 Ga0501043_0000026_148626_149663 325
48 3300049580 Ga0501046_0000019 Ga0501046_0000019_218624_219661 325
49 3300049581 Ga0501047_0000019 Ga0501047_0000019_187412_188449 325
50 3300049582 Ga0501048_0000025 Ga0501048_0000025_147_1184 325
51 3300049822 Ga0501035_0411767 Ga0501035_0411767_65_1102 325
52 3300049824 Ga0501045_0001681 Ga0501045_0001681_149_1186 325
53 iso_pu_bacteria 2919468124 2919470791 325
54 iso_pu_bacteria 8056829672 8056831338 325
55 iso_pu_bacteria 2811994917 2812477282 326
56 iso_pu_bacteria 2862507626 2862515943 326
57 3300005543 Ga0070672_100208540 Ga0070672_1002085402 327
58 3300025940 Ga0207691_10069083 Ga0207691_100690833 327
59 3300046794 Ga0495589_0036649 Ga0495589_0036649_438_1508 327
60 iso_pu_bacteria 2902810491 2902813620 327
61 iso_pu_bacteria 3006493962 3006498495 327
62 iso_pu_bacteria 8057568493 8057571371 327
63 iso_pu_bacteria 8008574985 8008575062 328
64 3300026116 Ga0207674_10256688 Ga0207674_102566882 331
65 3300031344 Ga0265316_10001369 Ga0265316_1000136917 331
66 3300053136 Ga0500559_0048718 Ga0500559_0048718_618_1658 331
67 3300005334 Ga0068869_100098852 Ga0068869_1000988522 332
68 3300005347 Ga0070668_100129188 Ga0070668_1001291882 332
69 3300005406 Ga0070703_10031812 Ga0070703_100318121 332
70 3300005458 Ga0070681_10000044 Ga0070681_1000004425 332
71 3300005458 Ga0070681_10408671 Ga0070681_104086711 332
72 3300005530 Ga0070679_100000022 Ga0070679_10000002253 332
73 3300005535 Ga0070684_100055197 Ga0070684_1000551974 332
74 3300006844 Ga0075428_100004412 Ga0075428_1000044128 332
75 3300013104 Ga0157370_10414325 Ga0157370_104143252 332
76 3300013105 Ga0157369_10009541 Ga0157369_100095412 332
77 3300013308 Ga0157375_10455173 Ga0157375_104551731 332
78 3300014497 Ga0182008_10004667 Ga0182008_100046677 332
79 3300015262 Ga0182007_10003186 Ga0182007_100031867 332
80 3300020082 Ga0206353_11485339 Ga0206353_114853391 332
81 3300025912 Ga0207707_10000041 Ga0207707_1000004177 332
82 3300025921 Ga0207652_10000033 Ga0207652_1000003338 332
83 3300030522 Ga0307512_10004092 Ga0307512_1000409216 332
84 3300030522 Ga0307512_10019201 Ga0307512_100192012 332
85 3300031456 Ga0307513_10011436 Ga0307513_1001143611 332
86 3300031548 Ga0307408_100045122 Ga0307408_1000451222 332
87 3300031616 Ga0307508_10079175 Ga0307508_100791751 332
88 3300031730 Ga0307516_10026224 Ga0307516_100262245 332
89 3300031730 Ga0307516_10027089 Ga0307516_100270892 332
90 3300031901 Ga0307406_10030973 Ga0307406_100309733 332
91 3300031903 Ga0307407_10015724 Ga0307407_100157242 332
92 3300032002 Ga0307416_100030429 Ga0307416_1000304293 332
93 3300032126 Ga0307415_100140780 Ga0307415_1001407802 332
94 3300035088 Ga0373940_0005345 Ga0373940_0005345_778_1818 332
95 3300035207 Ga0373942_0000136 Ga0373942_0000136_10507_11547 332
96 3300037312 Ga0395899_0205307 Ga0395899_0205307_302_1339 332
97 3300037418 Ga0395900_0044515 Ga0395900_0044515_1104_2141 332
98 3300037466 Ga0395898_0027838 Ga0395898_0027838_799_1836 332
99 3300037471 Ga0395905_0262005 Ga0395905_0262005_354_1391 332
100 3300038443 Ga0395901_0019474 Ga0395901_0019474_4799_5836 332
101 3300038443 Ga0395901_0243323 Ga0395901_0243323_808_1848 332
102 3300041404 Ga0439436_0021204 Ga0439436_0021204_604_1677 332
103 3300041512 Ga0451853_1814077 Ga0451853_1814077_599_1672 332
104 3300041999 Ga0439433_0009448 Ga0439433_0009448_101_1174 332
105 3300042007 Ga0439449_0015011 Ga0439449_0015011_1791_2864 332
106 3300042014 Ga0439457_001152 Ga0439457_001152_6777_7850 332
107 3300046455 Ga0495603_0000591 Ga0495603_0000591_12627_13703 332
108 3300046460 Ga0495638_0021137 Ga0495638_0021137_2955_4109 332
109 3300047320 Ga0495672_0012874 Ga0495672_0012874_990_2105 332
110 3300047320 Ga0495672_0024249 Ga0495672_0024249_1056_2138 332
111 3300047321 Ga0495676_0003304 Ga0495676_0003304_2214_3290 332
112 3300047447 Ga0495685_008336 Ga0495685_008336_2262_3338 332
113 3300048904 Ga0496101_0018806 Ga0496101_0018806_85_1146 332
114 3300048915 Ga0496112_0145193 Ga0496112_0145193_974_2035 332
115 3300048915 Ga0496112_0559541 Ga0496112_0559541_13_1053 332
116 3300048916 Ga0496113_0044887 Ga0496113_0044887_1183_2223 332
117 3300049585 Ga0501069_0001840 Ga0501069_0001840_3167_4207 332
118 3300049742 Ga0501080_0000484 Ga0501080_0000484_27384_28424 332
119 3300049824 Ga0501045_0099038 Ga0501045_0099038_927_2006 332
120 3300053085 Ga0495619_0244711 Ga0495619_0244711_171_1208 332
121 3300053149 Ga0500600_0113776 Ga0500600_0113776_237_1274 332
122 iso_pu_bacteria 8054609563 8054610814 332
123 3300003578 Ga0006562J51391_1070987 Ga0006562J51391_10709874 333
124 3300005614 Ga0068856_100152556 Ga0068856_1001525562 333
125 3300006846 Ga0075430_100000091 Ga0075430_10000009151 333
126 3300009553 Ga0105249_10273504 Ga0105249_102735042 333
127 3300013105 Ga0157369_10216747 Ga0157369_102167472 333
128 3300025981 Ga0207640_10304142 Ga0207640_103041421 333
129 3300031901 Ga0307406_10022721 Ga0307406_100227214 333
130 3300031911 Ga0307412_10081482 Ga0307412_100814822 333
131 3300031995 Ga0307409_100062092 Ga0307409_1000620923 333
132 3300042876 Ga0451577_0431662 Ga0451577_0431662_109_1152 333
133 3300044712 Ga0453684_0064048 Ga0453684_0064048_2105_3148 333
134 3300045051 Ga0451576_0122908 Ga0451576_0122908_1097_2140 333
135 3300046477 Ga0495664_0130340 Ga0495664_0130340_265_1335 333
136 3300046514 Ga0495618_0135360 Ga0495618_0135360_16_1056 333
137 3300046516 Ga0495628_0026031 Ga0495628_0026031_1807_2847 333
138 3300046642 Ga0495634_0146462 Ga0495634_0146462_343_1383 333
139 3300046679 Ga0495623_0038990 Ga0495623_0038990_837_1907 333
140 3300046680 Ga0495646_0017034 Ga0495646_0017034_3163_4233 333
141 3300047444 Ga0495675_0010713 Ga0495675_0010713_559_1602 333
142 3300048088 Ga0495602_0180732 Ga0495602_0180732_329_1399 333
143 3300048911 Ga0496108_0113032 Ga0496108_0113032_744_1787 333
144 3300048911 Ga0496108_0192537 Ga0496108_0192537_554_1597 333
145 3300053077 Ga0495601_0002955 Ga0495601_0002955_4127_5167 333
146 3300053077 Ga0495601_0111450 Ga0495601_0111450_652_1722 333
147 3300005327 Ga0070658_10263981 Ga0070658_102639812 334
148 3300048917 Ga0496114_0153504 Ga0496114_0153504_67_1227 334
149 3300005330 Ga0070690_100183373 Ga0070690_1001833731 335
150 3300005338 Ga0068868_100198909 Ga0068868_1001989092 335
151 3300005356 Ga0070674_100019826 Ga0070674_1000198263 335
152 3300009177 Ga0105248_10283054 Ga0105248_102830542 335
153 3300031251 Ga0265327_10004391 Ga0265327_1000439111 335
154 iso_pu_bacteria 2935390628 2935392970 336
155 3300049823 Ga0501044_0028336 Ga0501044_0028336_4798_5883 337
156 3300041404 Ga0439436_0008850 Ga0439436_0008850_358_1428 338
157 3300042014 Ga0439457_000888 Ga0439457_000888_7619_8689 338
158 3300049575 Ga0501039_0000294 Ga0501039_0000294_11274_12329 338
159 3300049576 Ga0501040_0100452 Ga0501040_0100452_519_1574 338
160 3300049578 Ga0501042_0020971 Ga0501042_0020971_2998_4053 338
161 3300049580 Ga0501046_0000596 Ga0501046_0000596_22931_23986 338
162 iso_pu_bacteria 2616644941 2616902764 338
163 iso_pu_bacteria 2643221678 2644440461 338
164 iso_pu_bacteria 2643221714 2644627861 338
165 iso_pu_bacteria 2784746763 2785339443 338
166 iso_pu_bacteria 2808606359 2808845929 338
167 iso_pu_bacteria 2811994879 2812361482 338
168 iso_pu_bacteria 2811994917 2812477087 338
169 iso_pu_bacteria 2852635781 2852641796 338
170 iso_pu_bacteria 2862574272 2862575553 338
171 iso_pu_bacteria 2919468124 2919470750 338
172 iso_pu_bacteria 2935390628 2935391282 338
173 iso_pu_bacteria 2997600082 2997600775 338
174 iso_pu_bacteria 3006486233 3006493301 338
175 iso_pu_bacteria 8008574985 8008575047 338
176 3300031730 Ga0307516_10031664 Ga0307516_100316642 339
177 3300046648 Ga0495611_0025194 Ga0495611_0025194_553_1620 339
178 3300028794 Ga0307515_10000683 Ga0307515_1000068361 340
179 3300030521 Ga0307511_10030405 Ga0307511_100304055 340
180 3300031507 Ga0307509_10010601 Ga0307509_100106016 340
181 3300031507 Ga0307509_10035705 Ga0307509_100357052 340
182 3300031616 Ga0307508_10020448 Ga0307508_100204485 340
183 3300031616 Ga0307508_10124784 Ga0307508_101247842 340
184 3300031730 Ga0307516_10061824 Ga0307516_100618243 340
185 3300031838 Ga0307518_10021538 Ga0307518_100215383 340
186 3300033179 Ga0307507_10027516 Ga0307507_100275164 340
187 3300033180 Ga0307510_10059629 Ga0307510_100596294 340
188 3300044656 Ga0466969_0008533 Ga0466969_0008533_3399_4466 340
189 3300044658 Ga0466972_0001518 Ga0466972_0001518_8831_9898 340
190 3300044683 Ga0466965_0000518 Ga0466965_0000518_7752_8819 340
191 3300044684 Ga0466966_0001516 Ga0466966_0001516_2028_3095 340
192 3300044693 Ga0466961_0000640 Ga0466961_0000640_12585_13652 340
193 3300044694 Ga0466963_0000047 Ga0466963_0000047_31188_32255 340
194 3300044706 Ga0466964_0001538 Ga0466964_0001538_6821_7888 340
195 3300044719 Ga0466971_0000233 Ga0466971_0000233_11798_12865 340
196 3300044765 Ga0466970_0000378 Ga0466970_0000378_14799_15866 340
197 3300044842 Ga0466957_0000319 Ga0466957_0000319_6991_8058 340
198 3300045049 Ga0466959_0004910 Ga0466959_0004910_4755_5822 340
199 3300045836 Ga0466958_0000122 Ga0466958_0000122_16003_17070 340
200 3300045976 Ga0466967_0000547 Ga0466967_0000547_16785_17852 340
201 3300046454 Ga0495592_0012143 Ga0495592_0012143_2836_3933 340
202 3300046459 Ga0495629_0001131 Ga0495629_0001131_695_1792 340
203 3300046459 Ga0495629_0027364 Ga0495629_0027364_1384_2481 340
204 3300046462 Ga0495651_0011481 Ga0495651_0011481_2604_3701 340
205 3300046477 Ga0495664_0008139 Ga0495664_0008139_3021_4118 340
206 3300046514 Ga0495618_0045595 Ga0495618_0045595_276_1373 340
207 3300046529 Ga0495652_0033876 Ga0495652_0033876_2450_3547 340
208 3300046533 Ga0495640_0172338 Ga0495640_0172338_28_1125 340
209 3300046536 Ga0495587_0007853 Ga0495587_0007853_3049_4146 340
210 3300046543 Ga0495645_0081671 Ga0495645_0081671_1043_2140 340
211 3300046642 Ga0495634_0004085 Ga0495634_0004085_2943_4040 340
212 3300046663 Ga0495635_0013220 Ga0495635_0013220_2968_4065 340
213 3300046674 Ga0495588_0000515 Ga0495588_0000515_1620_2717 340
214 3300046674 Ga0495588_0009873 Ga0495588_0009873_1620_2717 340
215 3300046675 Ga0495657_0006152 Ga0495657_0006152_2576_3673 340
216 3300046680 Ga0495646_0004549 Ga0495646_0004549_2576_3673 340
217 3300046683 Ga0495658_0030968 Ga0495658_0030968_1060_2157 340
218 3300046689 Ga0495613_0004702 Ga0495613_0004702_2588_3685 340
219 3300046809 Ga0495600_0021030 Ga0495600_0021030_1384_2481 340
220 3300047315 Ga0495581_0041728 Ga0495581_0041728_1511_2608 340
221 3300047317 Ga0495604_0015023 Ga0495604_0015023_2476_3573 340
222 3300047321 Ga0495676_0005153 Ga0495676_0005153_2604_3701 340
223 3300047443 Ga0495687_007869 Ga0495687_007869_1419_2516 340
224 3300047673 Ga0495593_0000705 Ga0495593_0000705_15443_16540 340
225 3300048088 Ga0495602_0030086 Ga0495602_0030086_2872_3969 340
226 3300048089 Ga0495614_0001537 Ga0495614_0001537_2745_3842 340
227 3300053095 Ga0500640_042896 Ga0500640_042896_131_1228 340
228 3300053101 Ga0500553_091119 Ga0500553_091119_68_1165 340
229 3300053107 Ga0500560_000561 Ga0500560_000561_615_1712 340
230 3300061719 Ga0466962_0000181 Ga0466962_0000181_3255_4322 340
231 3300031649 Ga0307514_10011371 Ga0307514_100113711 341
232 3300033180 Ga0307510_10001830 Ga0307510_1000183013 341
233 3300042002 Ga0439442_028160 Ga0439442_028160_68_1141 341
234 3300044658 Ga0466972_0004169 Ga0466972_0004169_2050_3120 341
235 3300044683 Ga0466965_0179941 Ga0466965_0179941_20_1090 341
236 3300046455 Ga0495603_0028704 Ga0495603_0028704_630_1697 341
237 3300046459 Ga0495629_0003011 Ga0495629_0003011_1730_2797 341
238 3300046499 Ga0495594_0013539 Ga0495594_0013539_1648_2715 341
239 3300047321 Ga0495676_0022048 Ga0495676_0022048_2621_3688 341
240 3300049568 Ga0501031_0056568 Ga0501031_0056568_1428_2507 341
241 3300049569 Ga0501032_0001463 Ga0501032_0001463_270_1334 341
242 3300049569 Ga0501032_0227346 Ga0501032_0227346_38_1117 341
243 3300049570 Ga0501033_0127671 Ga0501033_0127671_624_1703 341
244 3300049571 Ga0501034_0001245 Ga0501034_0001245_31602_32666 341
245 3300049571 Ga0501034_0375924 Ga0501034_0375924_191_1270 341
246 3300049572 Ga0501036_0000668 Ga0501036_0000668_19428_20492 341
247 3300049573 Ga0501037_0002303 Ga0501037_0002303_11249_12313 341
248 3300049574 Ga0501038_0102418 Ga0501038_0102418_1186_2250 341
249 3300049579 Ga0501043_0153355 Ga0501043_0153355_46_1125 341
250 3300049581 Ga0501047_0082574 Ga0501047_0082574_1951_3015 341
251 3300049581 Ga0501047_0193571 Ga0501047_0193571_784_1863 341
252 3300049582 Ga0501048_0000185 Ga0501048_0000185_11303_12367 341
253 3300049583 Ga0501067_0016386 Ga0501067_0016386_2213_3277 341
254 3300049586 Ga0501070_0004000 Ga0501070_0004000_11470_12534 341
255 3300049587 Ga0501071_0015688 Ga0501071_0015688_1903_2967 341
256 3300049589 Ga0501073_0025750 Ga0501073_0025750_1469_2533 341
257 3300049590 Ga0501074_0000257 Ga0501074_0000257_1403_2467 341
258 3300049742 Ga0501080_0002302 Ga0501080_0002302_15508_16572 341
259 3300049744 Ga0501083_0012890 Ga0501083_0012890_4136_5200 341
260 3300049822 Ga0501035_0036039 Ga0501035_0036039_170_1249 341
261 3300049822 Ga0501035_0268496 Ga0501035_0268496_74_1138 341
262 3300049823 Ga0501044_0098497 Ga0501044_0098497_888_1967 341
263 3300054114 Ga0501084_0000487 Ga0501084_0000487_3162_4226 341
264 3300003320 rootH2_10043795 rootH2_100437952 342
265 3300003323 rootH1_10024977 rootH1_100249777 342
266 3300037466 Ga0395898_0071638 Ga0395898_0071638_214_1284 342
267 3300038443 Ga0395901_0159264 Ga0395901_0159264_838_1908 342
268 3300046455 Ga0495603_0020825 Ga0495603_0020825_2004_3077 342
269 3300046459 Ga0495629_0002185 Ga0495629_0002185_7972_9045 342
270 3300046689 Ga0495613_0006632 Ga0495613_0006632_1457_2530 342
271 3300046794 Ga0495589_0001091 Ga0495589_0001091_12973_14049 342
272 3300047321 Ga0495676_0002748 Ga0495676_0002748_1172_2248 342
273 3300047321 Ga0495676_0004479 Ga0495676_0004479_3982_5055 342
274 3300048089 Ga0495614_0002389 Ga0495614_0002389_2971_4044 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

174

301

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

20

134

0.92

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

143

248

0.8

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

207

339

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yln-assembly2.cif.gz_D zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form 0.9263 1 337
5yln-assembly2.cif.gz_D zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form 0.9105 1 337
1jqb-assembly1.cif.gz_B alcohol dehydrogenase from clostridium beijerinckii: crystal structure of mutant with enhanced thermal stability 0.9016 1 331
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.9012 1 330
7xl5-assembly1.cif.gz_A-2 crystal structure of the h42t/a85g/i86a mutant of a nadp-dependent alcohol dehydrogenase 0.9002 2 330
ID Description Score Start End Superfamily
af_P77316_1_168_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9595 1 147 3.90.180.10
5ylnC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9587 1 337 3.90.180.10
5ylnC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9497 1 337 3.90.180.10
af_A0A1D8PNH7_1_185_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9342 1 157 3.90.180.10
af_O07737_1_152_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9303 1 150 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A3N1GDF8-F1-model_v4 Alcohol dehydrogenase-like protein 0.9909 1 132 GO:0008270
GO:0016491
AF-B8PPP3-F1-model_v4 deleted 0.9804 1 171
AF-A0A3N1GDF8-F1-model_v4 Alcohol dehydrogenase-like protein 0.9762 1 132 GO:0008270
GO:0016491
AF-A0A0D2DCS2-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9749 1 124 GO:0008270
GO:0016491
AF-B8PPP3-F1-model_v4 deleted 0.9747 1 171

Feature Viewer

pLDDT pTM Quality
88.41 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map