F380015

General Info

Members Datasets Scaffolds Average Seq Length
274 187 548 197

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0127170|Ga0501041_0127170_779_1432
Length 217
Sequence MSTPTETVVIAGREVPMTGVGRRIVLVDNYDSFTYNLYQYLLMLGAEVEVVRNDEVSAAEIAERDADGIVLSPGPSSPEHAGITPDVIRLLGPTTPMLGVCLGHQAMGMVYGGDVIRAEPVHGKRSPVEHTGVGVFEGLPSPLEAGRYHSLAIARETLPEVLEVTAWSPDGLVMGVRHREHPVEGIQFHPESILTDDGAMMLSNWLRSVPMRERAPA

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
127 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
180 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
181 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
182 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
183 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
184 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
185 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
186 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
187 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.99
Metatranscriptomes 0.73
Isolates 3.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.28
Nodule 0
Rhizoplane 1.09
Rhizosphere 87.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0127170 3300049577 Bacteria 1587
2 Ga0070658_10000163 3300005327 Bacteria 57740
3 Ga0070658_10055898 3300005327 Bacteria 3207
4 Ga0070658_10477463 3300005327 Bacteria 1076
5 Ga0070670_100010673 3300005331 Bacteria 7847
6 Ga0070670_100035621 3300005331 Bacteria 4284
7 Ga0068869_100017839 3300005334 Bacteria 4822
8 Ga0070680_100099372 3300005336 Bacteria 2414
9 Ga0070682_100010615 3300005337 Bacteria 5232
10 Ga0068868_100013548 3300005338 Bacteria 5982
11 Ga0068868_100503778 3300005338 Bacteria 1061
12 Ga0070689_100058533 3300005340 Bacteria 2993
13 Ga0070661_100021315 3300005344 Bacteria 4627
14 Ga0070692_10129846 3300005345 Bacteria 1415
15 Ga0070668_100015206 3300005347 Bacteria 5750
16 Ga0070671_100000342 3300005355 Bacteria 32006
17 Ga0070667_100164435 3300005367 Bacteria 1956
18 Ga0070705_100877668 3300005440 Bacteria 720
19 Ga0070662_100391370 3300005457 Bacteria 1146
20 Ga0068867_100016113 3300005459 Bacteria 5308
21 Ga0070685_10194594 3300005466 Bacteria 1314
22 Ga0070679_100010443 3300005530 Bacteria 8808
23 Ga0068853_100016284 3300005539 Bacteria 6117
24 Ga0070665_100001392 3300005548 Bacteria 28477
25 Ga0070665_100711750 3300005548 Bacteria 1017
26 Ga0068855_100083116 3300005563 Bacteria 3709
27 Ga0068856_101068538 3300005614 Bacteria 825
28 Ga0070702_100043897 3300005615 Bacteria 2521
29 Ga0068859_100000435 3300005617 Bacteria 41931
30 Ga0068859_100025721 3300005617 Bacteria 5903
31 Ga0068866_10002961 3300005718 Bacteria 7007
32 Ga0068866_10239000 3300005718 Bacteria 1105
33 Ga0068861_100014236 3300005719 Bacteria 5579
34 Ga0068870_10062278 3300005840 Bacteria 2009
35 Ga0068863_100006190 3300005841 Bacteria 11736
36 Ga0068858_100009897 3300005842 Bacteria 9059
37 Ga0068858_100017799 3300005842 Bacteria 6653
38 Ga0068860_100044868 3300005843 Bacteria 4213
39 Ga0068862_100022397 3300005844 Bacteria 5285
40 Ga0075365_10566591 3300006038 Bacteria 803
41 Ga0075364_10027989 3300006051 Bacteria 3605
42 Ga0075366_10028968 3300006195 Bacteria 3251
43 Ga0075366_10403306 3300006195 Bacteria 841
44 Ga0068871_100482665 3300006358 Bacteria 1115
45 Ga0068871_101031565 3300006358 Bacteria 767
46 Ga0068865_100018205 3300006881 Bacteria 4531
47 Ga0068865_100143136 3300006881 Bacteria 1805
48 Ga0097620_100000435 3300006931 Bacteria 41931
49 Ga0097620_100025717 3300006931 Bacteria 5903
50 Ga0105251_10006610 3300009011 Bacteria 7347
51 Ga0105244_10011132 3300009036 Bacteria 5416
52 Ga0105244_10032957 3300009036 Bacteria 2737
53 Ga0105244_10146965 3300009036 Bacteria 1131
54 Ga0105240_10001013 3300009093 Bacteria 50083
55 Ga0105240_10393569 3300009093 Bacteria 1562
56 Ga0105245_10368841 3300009098 Bacteria 1427
57 Ga0105247_10119900 3300009101 Bacteria 1703
58 Ga0114129_10502697 3300009147 Bacteria 1583
59 Ga0105243_10026144 3300009148 Bacteria 4466
60 Ga0105241_10180463 3300009174 Bacteria 1751
61 Ga0105242_10037362 3300009176 Bacteria 3901
62 Ga0105242_10154664 3300009176 Bacteria 2002
63 Ga0105248_10027931 3300009177 Bacteria 6283
64 Ga0105248_10241471 3300009177 Bacteria 2034
65 Ga0105248_10705296 3300009177 Bacteria 1139
66 Ga0105237_10000006 3300009545 Bacteria 380316
67 Ga0105237_10580727 3300009545 Bacteria 1128
68 Ga0105238_10012863 3300009551 Bacteria 8444
69 Ga0105238_10083783 3300009551 Bacteria 3178
70 Ga0105249_10105289 3300009553 Bacteria 2659
71 Ga0105239_10234743 3300010375 Bacteria 2058
72 Ga0105239_10776697 3300010375 Bacteria 1097
73 Ga0157371_10264337 3300013102 Bacteria 1241
74 Ga0157370_10000361 3300013104 Bacteria 57539
75 Ga0157370_10905715 3300013104 Bacteria 800
76 Ga0157369_10050555 3300013105 Bacteria 4501
77 Ga0157369_10079096 3300013105 Bacteria 3522
78 Ga0157374_10775816 3300013296 Bacteria 974
79 Ga0157378_10019484 3300013297 Bacteria 5965
80 Ga0157378_10217819 3300013297 Bacteria 1813
81 Ga0157372_10004747 3300013307 Bacteria 14428
82 Ga0157372_10012779 3300013307 Bacteria 8945
83 Ga0157372_10198382 3300013307 Bacteria 2324
84 Ga0157375_10141608 3300013308 Bacteria 2532
85 Ga0163163_10014023 3300014325 Bacteria 7354
86 Ga0157380_10436486 3300014326 Bacteria 1253
87 Ga0157380_12011754 3300014326 Bacteria 640
88 Ga0157377_10007354 3300014745 Bacteria 5315
89 Ga0157379_10007773 3300014968 Bacteria 9288
90 Ga0157379_10086566 3300014968 Bacteria 2810
91 Ga0157379_10584096 3300014968 Bacteria 1042
92 Ga0157376_10378698 3300014969 Bacteria 1362
93 Ga0213872_10000115 3300021361 Bacteria 74334
94 Ga0209566_100116 3300025225 Bacteria 107510
95 Ga0209566_100205 3300025225 Bacteria 61044
96 Ga0209437_100941 3300025233 Bacteria 10890
97 Ga0207656_10110064 3300025321 Bacteria 1272
98 Ga0207655_1003927 3300025728 Bacteria 10784
99 Ga0207713_1013006 3300025735 Bacteria 4416
100 Ga0207705_10137898 3300025909 Bacteria 1820
101 Ga0207654_10280018 3300025911 Bacteria 1128
102 Ga0207695_10015662 3300025913 Bacteria 8918
103 Ga0207671_10000070 3300025914 Bacteria 160216
104 Ga0207671_10478598 3300025914 Bacteria 992
105 Ga0207660_10067559 3300025917 Bacteria 2589
106 Ga0207649_10015271 3300025920 Bacteria 4315
107 Ga0207652_10000635 3300025921 Bacteria 34754
108 Ga0207694_10012027 3300025924 Bacteria 6525
109 Ga0207650_10006523 3300025925 Bacteria 7955
110 Ga0207706_10000524 3300025933 Bacteria 40739
111 Ga0207704_10143200 3300025938 Bacteria 1675
112 Ga0207667_10543416 3300025949 Bacteria 1175
113 Ga0207712_10000583 3300025961 Bacteria 29470
114 Ga0207668_10009769 3300025972 Bacteria 5763
115 Ga0207677_10493940 3300026023 Bacteria 1057
116 Ga0207703_10001755 3300026035 Bacteria 19387
117 Ga0207703_10053649 3300026035 Bacteria 3277
118 Ga0207703_10454655 3300026035 Bacteria 1197
119 Ga0207639_10000149 3300026041 Bacteria 52591
120 Ga0207639_10008625 3300026041 Bacteria 6996
121 Ga0207641_10012230 3300026088 Bacteria 7043
122 Ga0207674_10108886 3300026116 Bacteria 2747
123 Ga0207698_10703618 3300026142 Bacteria 1006
124 Ga0207698_10849338 3300026142 Bacteria 918
125 Ga0268266_10000008 3300028379 Bacteria 1161875
126 Ga0268264_10052179 3300028381 Bacteria 3409
127 Ga0265319_1050354 3300028563 Bacteria 1376
128 Ga0265318_10002055 3300028577 Bacteria 11057
129 Ga0265338_10051183 3300028800 Bacteria 3722
130 Ga0265330_10003312 3300031235 Bacteria 8470
131 Ga0265330_10005656 3300031235 Bacteria 6215
132 Ga0265332_10000463 3300031238 Bacteria 28370
133 Ga0265328_10001177 3300031239 Bacteria 12096
134 Ga0265320_10000003 3300031240 Bacteria 410153
135 Ga0265320_10140651 3300031240 Bacteria 1093
136 Ga0265325_10000401 3300031241 Bacteria 30694
137 Ga0265329_10002088 3300031242 Bacteria 9293
138 Ga0265340_10014743 3300031247 Bacteria 4075
139 Ga0265331_10000042 3300031250 Bacteria 191733
140 Ga0265331_10036704 3300031250 Bacteria 2405
141 Ga0265316_10000689 3300031344 Bacteria 37558
142 Ga0265316_10004683 3300031344 Bacteria 13552
143 Ga0265316_10117048 3300031344 Bacteria 2015
144 Ga0265313_10000248 3300031595 Bacteria 58684
145 Ga0265313_10003604 3300031595 Bacteria 12448
146 Ga0265314_10000049 3300031711 Bacteria 191749
147 Ga0265342_10001782 3300031712 Bacteria 19613
148 Ga0265342_10034477 3300031712 Bacteria 3105
149 Ga0316576_10046023 3300031727 Bacteria 3157
150 Ga0316576_10116198 3300031727 Bacteria 2008
151 Ga0316577_10061601 3300031733 Bacteria 2094
152 Ga0373932_0111431 3300035112 Bacteria 902
153 Ga0373942_0049895 3300035207 Bacteria 1170
154 Ga0316574_0319136 3300035398 Bacteria 986
155 Ga0316582_0050633 3300036647 Bacteria 2632
156 Ga0316584_0125382 3300036712 Bacteria 1918
157 Ga0373925_0213323 3300037068 Bacteria 1538
158 Ga0395899_0000080 3300037312 Bacteria 171568
159 Ga0395899_0010774 3300037312 Bacteria 7008
160 Ga0395900_0000087 3300037418 Bacteria 171568
161 Ga0395900_0000411 3300037418 Bacteria 61659
162 Ga0395900_0009539 3300037418 Bacteria 9950
163 Ga0395900_0065445 3300037418 Bacteria 3734
164 Ga0395898_0000679 3300037466 Bacteria 61481
165 Ga0395898_0026193 3300037466 Bacteria 5869
166 Ga0395901_0001988 3300038443 Bacteria 21038
167 Ga0400487_51885 3300039110 Bacteria 77480
168 Ga0436361_0215157 3300039447 Bacteria 166868
169 Ga0439439_0030841 3300041406 Bacteria 1364
170 Ga0439439_0105633 3300041406 Bacteria 777
171 Ga0439433_0070308 3300041999 Bacteria 842
172 Ga0439449_0000011 3300042007 Bacteria 57369
173 Ga0439449_0006283 3300042007 Bacteria 4542
174 Ga0439457_003456 3300042014 Bacteria 4298
175 Ga0439457_049148 3300042014 Bacteria 945
176 Ga0439462_0001752 3300042015 Bacteria 4908
177 Ga0439462_0004781 3300042015 Bacteria 3320
178 Ga0450923_006448 3300042125 Bacteria 1947
179 Ga0450918_021327 3300042531 Bacteria 1132
180 Ga0451577_0002176 3300042876 Bacteria 23929
181 Ga0451577_0025349 3300042876 Bacteria 5381
182 Ga0451577_0478334 3300042876 Bacteria 1131
183 Ga0466969_0000361 3300044656 Bacteria 24953
184 Ga0466969_0164888 3300044656 Bacteria 1017
185 Ga0466973_0175396 3300044659 Bacteria 1644
186 Ga0453683_0001186 3300044673 Bacteria 23518
187 Ga0466965_0021290 3300044683 Bacteria 3119
188 Ga0466966_0000058 3300044684 Bacteria 81196
189 Ga0466966_0197300 3300044684 Bacteria 1218
190 Ga0466961_0000224 3300044693 Bacteria 38254
191 Ga0466961_0001006 3300044693 Bacteria 17408
192 Ga0466961_0014062 3300044693 Bacteria 5133
193 Ga0466961_0050752 3300044693 Bacteria 2649
194 Ga0453684_0000078 3300044712 Bacteria 428794
195 Ga0453684_0004951 3300044712 Bacteria 27140
196 Ga0466971_0021760 3300044719 Bacteria 2853
197 Ga0466968_0072962 3300044735 Bacteria 1497
198 Ga0466970_0075082 3300044765 Bacteria 1820
199 Ga0466957_0022895 3300044842 Bacteria 3688
200 Ga0466959_0007304 3300045049 Bacteria 7745
201 Ga0466959_0045124 3300045049 Bacteria 3246
202 Ga0466959_0061396 3300045049 Bacteria 2732
203 Ga0466959_0117771 3300045049 Bacteria 1890
204 Ga0451576_0000938 3300045051 Bacteria 54971
205 Ga0451576_0002517 3300045051 Bacteria 27167
206 Ga0451576_0453473 3300045051 Bacteria 1346
207 Ga0466958_0000928 3300045836 Bacteria 13208
208 Ga0466958_0031534 3300045836 Bacteria 3150
209 Ga0495627_095098 3300046453 Bacteria 854
210 Ga0495654_0185994 3300046530 Bacteria 897
211 Ga0495621_0191630 3300046539 Bacteria 820
212 Ga0495636_0162520 3300047318 Bacteria 1007
213 Ga0495626_0037300 3300048091 Bacteria 2311
214 Ga0496104_0296886 3300048907 Bacteria 1528
215 Ga0496108_0056534 3300048911 Bacteria 3297
216 Ga0496109_0515871 3300048912 Bacteria 1128
217 Ga0496116_0002371 3300048919 Bacteria 19898
218 Ga0496116_0005418 3300048919 Bacteria 11859
219 Ga0496116_0065790 3300048919 Bacteria 2323
220 Ga0496116_0140624 3300048919 Bacteria 1359
221 Ga0496121_0084363 3300048924 Bacteria 2505
222 Ga0496121_0141596 3300048924 Bacteria 1783
223 Ga0496121_0261745 3300048924 Bacteria 1194
224 Ga0496121_0565112 3300048924 Bacteria 709
225 Ga0496122_0039950 3300048925 Bacteria 3736
226 Ga0496122_0154598 3300048925 Bacteria 1410
227 Ga0496124_0000211 3300048927 Bacteria 113824
228 Ga0496124_0172252 3300048927 Bacteria 1674
229 Ga0496124_0215233 3300048927 Bacteria 1450
230 Ga0496125_0007811 3300048928 Bacteria 11306
231 Ga0496125_0014091 3300048928 Bacteria 7810
232 Ga0496125_0041575 3300048928 Bacteria 3928
233 Ga0496125_0267354 3300048928 Bacteria 1068
234 Ga0501305_041633 3300049161 Bacteria 749
235 Ga0501034_0001835 3300049571 Bacteria 26959
236 Ga0501040_0000006 3300049576 Bacteria 97170
237 Ga0501040_0034002 3300049576 Bacteria 3455
238 Ga0501040_0138186 3300049576 Bacteria 1716
239 Ga0501040_0340617 3300049576 Bacteria 1073
240 Ga0501042_0000196 3300049578 Bacteria 28694
241 Ga0501042_0003131 3300049578 Bacteria 10307
242 Ga0501043_0380771 3300049579 Bacteria 1068
243 Ga0501067_0000315 3300049583 Bacteria 26634
244 Ga0501069_0000832 3300049585 Bacteria 14587
245 Ga0501070_0001767 3300049586 Bacteria 19121
246 Ga0501072_0000612 3300049588 Bacteria 25699
247 Ga0501072_0026766 3300049588 Bacteria 4498
248 Ga0501072_0265058 3300049588 Bacteria 1367
249 Ga0501073_0045218 3300049589 Bacteria 3101
250 Ga0501208_006886 3300049655 Bacteria 1469
251 Ga0501080_0001362 3300049742 Bacteria 20427
252 Ga0501080_0766862 3300049742 Bacteria 847
253 Ga0501081_0016638 3300049743 Bacteria 4863
254 Ga0501083_0001185 3300049744 Bacteria 17609
255 Ga0501279_017871 3300049775 Bacteria 995
256 Ga0501035_0173783 3300049822 Bacteria 1860
257 Ga0501045_0437417 3300049824 Bacteria 973
258 nmdc:mga0yw44_150366_c1 3300050492 Bacteria 1518
259 nmdc:mga0k408_454974_c1 3300050493 Bacteria 760
260 nmdc:mga05p37_494801_c1 3300050507 Bacteria 1405
261 nmdc:mga0a205_181451_c1 3300050515 Bacteria 1999
262 Ga0587076_075249 3300059645 Bacteria 709
263 Ga0466962_0001925 3300061719 Bacteria 9769
264 Ga0466962_0028493 3300061719 Bacteria 2675
265 Ga0466962_0145545 3300061719 Bacteria 1149
266 2510283147 2510065053 Bacteria 5005518
267 2510293812 2510065055 Bacteria 5037935
268 2510310573 2510065058 Bacteria 5005894
269 2574430142 2574179768 Bacteria 4907129
270 2808973006 2808606384 Bacteria 8474373
271 2809007828 2808606390 Bacteria 8476311
272 2809016523 2808606391 Bacteria 8308166
273 2980185343 2980182181 Bacteria 9454109
274 8057632219 8057632132 Bacteria 4726859
275 Ga0501041_0127170
276 Ga0070658_10000163
277 Ga0070658_10055898
278 Ga0070658_10477463
279 Ga0070670_100010673
280 Ga0070670_100035621
281 Ga0068869_100017839
282 Ga0070680_100099372
283 Ga0070682_100010615
284 Ga0068868_100013548
285 Ga0068868_100503778
286 Ga0070689_100058533
287 Ga0070661_100021315
288 Ga0070692_10129846
289 Ga0070668_100015206
290 Ga0070671_100000342
291 Ga0070667_100164435
292 Ga0070705_100877668
293 Ga0070662_100391370
294 Ga0068867_100016113
295 Ga0070685_10194594
296 Ga0070679_100010443
297 Ga0068853_100016284
298 Ga0070665_100001392
299 Ga0070665_100711750
300 Ga0068855_100083116
301 Ga0068856_101068538
302 Ga0070702_100043897
303 Ga0068859_100000435
304 Ga0068859_100025721
305 Ga0068866_10002961
306 Ga0068866_10239000
307 Ga0068861_100014236
308 Ga0068870_10062278
309 Ga0068863_100006190
310 Ga0068858_100009897
311 Ga0068858_100017799
312 Ga0068860_100044868
313 Ga0068862_100022397
314 Ga0075365_10566591
315 Ga0075364_10027989
316 Ga0075366_10028968
317 Ga0075366_10403306
318 Ga0068871_100482665
319 Ga0068871_101031565
320 Ga0068865_100018205
321 Ga0068865_100143136
322 Ga0097620_100000435
323 Ga0097620_100025717
324 Ga0105251_10006610
325 Ga0105244_10011132
326 Ga0105244_10032957
327 Ga0105244_10146965
328 Ga0105240_10001013
329 Ga0105240_10393569
330 Ga0105245_10368841
331 Ga0105247_10119900
332 Ga0114129_10502697
333 Ga0105243_10026144
334 Ga0105241_10180463
335 Ga0105242_10037362
336 Ga0105242_10154664
337 Ga0105248_10027931
338 Ga0105248_10241471
339 Ga0105248_10705296
340 Ga0105237_10000006
341 Ga0105237_10580727
342 Ga0105238_10012863
343 Ga0105238_10083783
344 Ga0105249_10105289
345 Ga0105239_10234743
346 Ga0105239_10776697
347 Ga0157371_10264337
348 Ga0157370_10000361
349 Ga0157370_10905715
350 Ga0157369_10050555
351 Ga0157369_10079096
352 Ga0157374_10775816
353 Ga0157378_10019484
354 Ga0157378_10217819
355 Ga0157372_10004747
356 Ga0157372_10012779
357 Ga0157372_10198382
358 Ga0157375_10141608
359 Ga0163163_10014023
360 Ga0157380_10436486
361 Ga0157380_12011754
362 Ga0157377_10007354
363 Ga0157379_10007773
364 Ga0157379_10086566
365 Ga0157379_10584096
366 Ga0157376_10378698
367 Ga0213872_10000115
368 Ga0209566_100116
369 Ga0209566_100205
370 Ga0209437_100941
371 Ga0207656_10110064
372 Ga0207655_1003927
373 Ga0207713_1013006
374 Ga0207705_10137898
375 Ga0207654_10280018
376 Ga0207695_10015662
377 Ga0207671_10000070
378 Ga0207671_10478598
379 Ga0207660_10067559
380 Ga0207649_10015271
381 Ga0207652_10000635
382 Ga0207694_10012027
383 Ga0207650_10006523
384 Ga0207706_10000524
385 Ga0207704_10143200
386 Ga0207667_10543416
387 Ga0207712_10000583
388 Ga0207668_10009769
389 Ga0207677_10493940
390 Ga0207703_10001755
391 Ga0207703_10053649
392 Ga0207703_10454655
393 Ga0207639_10000149
394 Ga0207639_10008625
395 Ga0207641_10012230
396 Ga0207674_10108886
397 Ga0207698_10703618
398 Ga0207698_10849338
399 Ga0268266_10000008
400 Ga0268264_10052179
401 Ga0265319_1050354
402 Ga0265318_10002055
403 Ga0265338_10051183
404 Ga0265330_10003312
405 Ga0265330_10005656
406 Ga0265332_10000463
407 Ga0265328_10001177
408 Ga0265320_10000003
409 Ga0265320_10140651
410 Ga0265325_10000401
411 Ga0265329_10002088
412 Ga0265340_10014743
413 Ga0265331_10000042
414 Ga0265331_10036704
415 Ga0265316_10000689
416 Ga0265316_10004683
417 Ga0265316_10117048
418 Ga0265313_10000248
419 Ga0265313_10003604
420 Ga0265314_10000049
421 Ga0265342_10001782
422 Ga0265342_10034477
423 Ga0316576_10046023
424 Ga0316576_10116198
425 Ga0316577_10061601
426 Ga0373932_0111431
427 Ga0373942_0049895
428 Ga0316574_0319136
429 Ga0316582_0050633
430 Ga0316584_0125382
431 Ga0373925_0213323
432 Ga0395899_0000080
433 Ga0395899_0010774
434 Ga0395900_0000087
435 Ga0395900_0000411
436 Ga0395900_0009539
437 Ga0395900_0065445
438 Ga0395898_0000679
439 Ga0395898_0026193
440 Ga0395901_0001988
441 Ga0400487_51885
442 Ga0436361_0215157
443 Ga0439439_0030841
444 Ga0439439_0105633
445 Ga0439433_0070308
446 Ga0439449_0000011
447 Ga0439449_0006283
448 Ga0439457_003456
449 Ga0439457_049148
450 Ga0439462_0001752
451 Ga0439462_0004781
452 Ga0450923_006448
453 Ga0450918_021327
454 Ga0451577_0002176
455 Ga0451577_0025349
456 Ga0451577_0478334
457 Ga0466969_0000361
458 Ga0466969_0164888
459 Ga0466973_0175396
460 Ga0453683_0001186
461 Ga0466965_0021290
462 Ga0466966_0000058
463 Ga0466966_0197300
464 Ga0466961_0000224
465 Ga0466961_0001006
466 Ga0466961_0014062
467 Ga0466961_0050752
468 Ga0453684_0000078
469 Ga0453684_0004951
470 Ga0466971_0021760
471 Ga0466968_0072962
472 Ga0466970_0075082
473 Ga0466957_0022895
474 Ga0466959_0007304
475 Ga0466959_0045124
476 Ga0466959_0061396
477 Ga0466959_0117771
478 Ga0451576_0000938
479 Ga0451576_0002517
480 Ga0451576_0453473
481 Ga0466958_0000928
482 Ga0466958_0031534
483 Ga0495627_095098
484 Ga0495654_0185994
485 Ga0495621_0191630
486 Ga0495636_0162520
487 Ga0495626_0037300
488 Ga0496104_0296886
489 Ga0496108_0056534
490 Ga0496109_0515871
491 Ga0496116_0002371
492 Ga0496116_0005418
493 Ga0496116_0065790
494 Ga0496116_0140624
495 Ga0496121_0084363
496 Ga0496121_0141596
497 Ga0496121_0261745
498 Ga0496121_0565112
499 Ga0496122_0039950
500 Ga0496122_0154598
501 Ga0496124_0000211
502 Ga0496124_0172252
503 Ga0496124_0215233
504 Ga0496125_0007811
505 Ga0496125_0014091
506 Ga0496125_0041575
507 Ga0496125_0267354
508 Ga0501305_041633
509 Ga0501034_0001835
510 Ga0501040_0000006
511 Ga0501040_0034002
512 Ga0501040_0138186
513 Ga0501040_0340617
514 Ga0501042_0000196
515 Ga0501042_0003131
516 Ga0501043_0380771
517 Ga0501067_0000315
518 Ga0501069_0000832
519 Ga0501070_0001767
520 Ga0501072_0000612
521 Ga0501072_0026766
522 Ga0501072_0265058
523 Ga0501073_0045218
524 Ga0501208_006886
525 Ga0501080_0001362
526 Ga0501080_0766862
527 Ga0501081_0016638
528 Ga0501083_0001185
529 Ga0501279_017871
530 Ga0501035_0173783
531 Ga0501045_0437417
532 nmdc:mga0yw44_150366_c1
533 nmdc:mga0k408_454974_c1
534 nmdc:mga05p37_494801_c1
535 nmdc:mga0a205_181451_c1
536 Ga0587076_075249
537 Ga0466962_0001925
538 Ga0466962_0028493
539 Ga0466962_0145545
540 2510283147
541 2510293812
542 2510310573
543 2574430142
544 2808973006
545 2809007828
546 2809016523
547 2980185343
548 8057632219

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

25

209

0.95

PF07722

Peptidase_C26

Peptidase C26

87

191

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.954 2 188
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9464 2 188
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9431 2 191
8hx8-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate 0.9425 2 189
1i1q-assembly1.cif.gz_B structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium 0.9292 2 195
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9947 1 191 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9894 1 191 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9721 1 191 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9621 1 191 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9617 2 189 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7C2YPT6-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9985 1 189 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A4U1H1Y7-F1-model_v4 deleted 0.9984 2 189
AF-A0A2S5L9G7-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9982 1 189 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A259CX94-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II 0.9978 1 189 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A5C7X5A9-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9978 1 189 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Map