F380015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 187 | 548 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300049577|Ga0501041_0127170|Ga0501041_0127170_779_1432 |
| Length | 217 |
| Sequence | MSTPTETVVIAGREVPMTGVGRRIVLVDNYDSFTYNLYQYLLMLGAEVEVVRNDEVSAAEIAERDADGIVLSPGPSSPEHAGITPDVIRLLGPTTPMLGVCLGHQAMGMVYGGDVIRAEPVHGKRSPVEHTGVGVFEGLPSPLEAGRYHSLAIARETLPEVLEVTAWSPDGLVMGVRHREHPVEGIQFHPESILTDDGAMMLSNWLRSVPMRERAPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 65 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 100 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 108 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 109 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 112 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 113 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 120 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 121 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 122 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 123 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 124 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 125 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 126 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 127 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 130 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 131 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 132 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 133 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 134 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 137 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 138 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 139 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 140 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 152 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 153 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 154 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 155 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 156 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 167 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 171 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 179 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 180 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 181 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 182 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 183 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 184 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 185 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 186 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 187 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.99 |
| Metatranscriptomes | 0.73 |
| Isolates | 3.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.28 |
| Nodule | 0 |
| Rhizoplane | 1.09 |
| Rhizosphere | 87.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501041_0127170 | 3300049577 | Bacteria | 1587 |
| 2 | Ga0070658_10000163 | 3300005327 | Bacteria | 57740 |
| 3 | Ga0070658_10055898 | 3300005327 | Bacteria | 3207 |
| 4 | Ga0070658_10477463 | 3300005327 | Bacteria | 1076 |
| 5 | Ga0070670_100010673 | 3300005331 | Bacteria | 7847 |
| 6 | Ga0070670_100035621 | 3300005331 | Bacteria | 4284 |
| 7 | Ga0068869_100017839 | 3300005334 | Bacteria | 4822 |
| 8 | Ga0070680_100099372 | 3300005336 | Bacteria | 2414 |
| 9 | Ga0070682_100010615 | 3300005337 | Bacteria | 5232 |
| 10 | Ga0068868_100013548 | 3300005338 | Bacteria | 5982 |
| 11 | Ga0068868_100503778 | 3300005338 | Bacteria | 1061 |
| 12 | Ga0070689_100058533 | 3300005340 | Bacteria | 2993 |
| 13 | Ga0070661_100021315 | 3300005344 | Bacteria | 4627 |
| 14 | Ga0070692_10129846 | 3300005345 | Bacteria | 1415 |
| 15 | Ga0070668_100015206 | 3300005347 | Bacteria | 5750 |
| 16 | Ga0070671_100000342 | 3300005355 | Bacteria | 32006 |
| 17 | Ga0070667_100164435 | 3300005367 | Bacteria | 1956 |
| 18 | Ga0070705_100877668 | 3300005440 | Bacteria | 720 |
| 19 | Ga0070662_100391370 | 3300005457 | Bacteria | 1146 |
| 20 | Ga0068867_100016113 | 3300005459 | Bacteria | 5308 |
| 21 | Ga0070685_10194594 | 3300005466 | Bacteria | 1314 |
| 22 | Ga0070679_100010443 | 3300005530 | Bacteria | 8808 |
| 23 | Ga0068853_100016284 | 3300005539 | Bacteria | 6117 |
| 24 | Ga0070665_100001392 | 3300005548 | Bacteria | 28477 |
| 25 | Ga0070665_100711750 | 3300005548 | Bacteria | 1017 |
| 26 | Ga0068855_100083116 | 3300005563 | Bacteria | 3709 |
| 27 | Ga0068856_101068538 | 3300005614 | Bacteria | 825 |
| 28 | Ga0070702_100043897 | 3300005615 | Bacteria | 2521 |
| 29 | Ga0068859_100000435 | 3300005617 | Bacteria | 41931 |
| 30 | Ga0068859_100025721 | 3300005617 | Bacteria | 5903 |
| 31 | Ga0068866_10002961 | 3300005718 | Bacteria | 7007 |
| 32 | Ga0068866_10239000 | 3300005718 | Bacteria | 1105 |
| 33 | Ga0068861_100014236 | 3300005719 | Bacteria | 5579 |
| 34 | Ga0068870_10062278 | 3300005840 | Bacteria | 2009 |
| 35 | Ga0068863_100006190 | 3300005841 | Bacteria | 11736 |
| 36 | Ga0068858_100009897 | 3300005842 | Bacteria | 9059 |
| 37 | Ga0068858_100017799 | 3300005842 | Bacteria | 6653 |
| 38 | Ga0068860_100044868 | 3300005843 | Bacteria | 4213 |
| 39 | Ga0068862_100022397 | 3300005844 | Bacteria | 5285 |
| 40 | Ga0075365_10566591 | 3300006038 | Bacteria | 803 |
| 41 | Ga0075364_10027989 | 3300006051 | Bacteria | 3605 |
| 42 | Ga0075366_10028968 | 3300006195 | Bacteria | 3251 |
| 43 | Ga0075366_10403306 | 3300006195 | Bacteria | 841 |
| 44 | Ga0068871_100482665 | 3300006358 | Bacteria | 1115 |
| 45 | Ga0068871_101031565 | 3300006358 | Bacteria | 767 |
| 46 | Ga0068865_100018205 | 3300006881 | Bacteria | 4531 |
| 47 | Ga0068865_100143136 | 3300006881 | Bacteria | 1805 |
| 48 | Ga0097620_100000435 | 3300006931 | Bacteria | 41931 |
| 49 | Ga0097620_100025717 | 3300006931 | Bacteria | 5903 |
| 50 | Ga0105251_10006610 | 3300009011 | Bacteria | 7347 |
| 51 | Ga0105244_10011132 | 3300009036 | Bacteria | 5416 |
| 52 | Ga0105244_10032957 | 3300009036 | Bacteria | 2737 |
| 53 | Ga0105244_10146965 | 3300009036 | Bacteria | 1131 |
| 54 | Ga0105240_10001013 | 3300009093 | Bacteria | 50083 |
| 55 | Ga0105240_10393569 | 3300009093 | Bacteria | 1562 |
| 56 | Ga0105245_10368841 | 3300009098 | Bacteria | 1427 |
| 57 | Ga0105247_10119900 | 3300009101 | Bacteria | 1703 |
| 58 | Ga0114129_10502697 | 3300009147 | Bacteria | 1583 |
| 59 | Ga0105243_10026144 | 3300009148 | Bacteria | 4466 |
| 60 | Ga0105241_10180463 | 3300009174 | Bacteria | 1751 |
| 61 | Ga0105242_10037362 | 3300009176 | Bacteria | 3901 |
| 62 | Ga0105242_10154664 | 3300009176 | Bacteria | 2002 |
| 63 | Ga0105248_10027931 | 3300009177 | Bacteria | 6283 |
| 64 | Ga0105248_10241471 | 3300009177 | Bacteria | 2034 |
| 65 | Ga0105248_10705296 | 3300009177 | Bacteria | 1139 |
| 66 | Ga0105237_10000006 | 3300009545 | Bacteria | 380316 |
| 67 | Ga0105237_10580727 | 3300009545 | Bacteria | 1128 |
| 68 | Ga0105238_10012863 | 3300009551 | Bacteria | 8444 |
| 69 | Ga0105238_10083783 | 3300009551 | Bacteria | 3178 |
| 70 | Ga0105249_10105289 | 3300009553 | Bacteria | 2659 |
| 71 | Ga0105239_10234743 | 3300010375 | Bacteria | 2058 |
| 72 | Ga0105239_10776697 | 3300010375 | Bacteria | 1097 |
| 73 | Ga0157371_10264337 | 3300013102 | Bacteria | 1241 |
| 74 | Ga0157370_10000361 | 3300013104 | Bacteria | 57539 |
| 75 | Ga0157370_10905715 | 3300013104 | Bacteria | 800 |
| 76 | Ga0157369_10050555 | 3300013105 | Bacteria | 4501 |
| 77 | Ga0157369_10079096 | 3300013105 | Bacteria | 3522 |
| 78 | Ga0157374_10775816 | 3300013296 | Bacteria | 974 |
| 79 | Ga0157378_10019484 | 3300013297 | Bacteria | 5965 |
| 80 | Ga0157378_10217819 | 3300013297 | Bacteria | 1813 |
| 81 | Ga0157372_10004747 | 3300013307 | Bacteria | 14428 |
| 82 | Ga0157372_10012779 | 3300013307 | Bacteria | 8945 |
| 83 | Ga0157372_10198382 | 3300013307 | Bacteria | 2324 |
| 84 | Ga0157375_10141608 | 3300013308 | Bacteria | 2532 |
| 85 | Ga0163163_10014023 | 3300014325 | Bacteria | 7354 |
| 86 | Ga0157380_10436486 | 3300014326 | Bacteria | 1253 |
| 87 | Ga0157380_12011754 | 3300014326 | Bacteria | 640 |
| 88 | Ga0157377_10007354 | 3300014745 | Bacteria | 5315 |
| 89 | Ga0157379_10007773 | 3300014968 | Bacteria | 9288 |
| 90 | Ga0157379_10086566 | 3300014968 | Bacteria | 2810 |
| 91 | Ga0157379_10584096 | 3300014968 | Bacteria | 1042 |
| 92 | Ga0157376_10378698 | 3300014969 | Bacteria | 1362 |
| 93 | Ga0213872_10000115 | 3300021361 | Bacteria | 74334 |
| 94 | Ga0209566_100116 | 3300025225 | Bacteria | 107510 |
| 95 | Ga0209566_100205 | 3300025225 | Bacteria | 61044 |
| 96 | Ga0209437_100941 | 3300025233 | Bacteria | 10890 |
| 97 | Ga0207656_10110064 | 3300025321 | Bacteria | 1272 |
| 98 | Ga0207655_1003927 | 3300025728 | Bacteria | 10784 |
| 99 | Ga0207713_1013006 | 3300025735 | Bacteria | 4416 |
| 100 | Ga0207705_10137898 | 3300025909 | Bacteria | 1820 |
| 101 | Ga0207654_10280018 | 3300025911 | Bacteria | 1128 |
| 102 | Ga0207695_10015662 | 3300025913 | Bacteria | 8918 |
| 103 | Ga0207671_10000070 | 3300025914 | Bacteria | 160216 |
| 104 | Ga0207671_10478598 | 3300025914 | Bacteria | 992 |
| 105 | Ga0207660_10067559 | 3300025917 | Bacteria | 2589 |
| 106 | Ga0207649_10015271 | 3300025920 | Bacteria | 4315 |
| 107 | Ga0207652_10000635 | 3300025921 | Bacteria | 34754 |
| 108 | Ga0207694_10012027 | 3300025924 | Bacteria | 6525 |
| 109 | Ga0207650_10006523 | 3300025925 | Bacteria | 7955 |
| 110 | Ga0207706_10000524 | 3300025933 | Bacteria | 40739 |
| 111 | Ga0207704_10143200 | 3300025938 | Bacteria | 1675 |
| 112 | Ga0207667_10543416 | 3300025949 | Bacteria | 1175 |
| 113 | Ga0207712_10000583 | 3300025961 | Bacteria | 29470 |
| 114 | Ga0207668_10009769 | 3300025972 | Bacteria | 5763 |
| 115 | Ga0207677_10493940 | 3300026023 | Bacteria | 1057 |
| 116 | Ga0207703_10001755 | 3300026035 | Bacteria | 19387 |
| 117 | Ga0207703_10053649 | 3300026035 | Bacteria | 3277 |
| 118 | Ga0207703_10454655 | 3300026035 | Bacteria | 1197 |
| 119 | Ga0207639_10000149 | 3300026041 | Bacteria | 52591 |
| 120 | Ga0207639_10008625 | 3300026041 | Bacteria | 6996 |
| 121 | Ga0207641_10012230 | 3300026088 | Bacteria | 7043 |
| 122 | Ga0207674_10108886 | 3300026116 | Bacteria | 2747 |
| 123 | Ga0207698_10703618 | 3300026142 | Bacteria | 1006 |
| 124 | Ga0207698_10849338 | 3300026142 | Bacteria | 918 |
| 125 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 126 | Ga0268264_10052179 | 3300028381 | Bacteria | 3409 |
| 127 | Ga0265319_1050354 | 3300028563 | Bacteria | 1376 |
| 128 | Ga0265318_10002055 | 3300028577 | Bacteria | 11057 |
| 129 | Ga0265338_10051183 | 3300028800 | Bacteria | 3722 |
| 130 | Ga0265330_10003312 | 3300031235 | Bacteria | 8470 |
| 131 | Ga0265330_10005656 | 3300031235 | Bacteria | 6215 |
| 132 | Ga0265332_10000463 | 3300031238 | Bacteria | 28370 |
| 133 | Ga0265328_10001177 | 3300031239 | Bacteria | 12096 |
| 134 | Ga0265320_10000003 | 3300031240 | Bacteria | 410153 |
| 135 | Ga0265320_10140651 | 3300031240 | Bacteria | 1093 |
| 136 | Ga0265325_10000401 | 3300031241 | Bacteria | 30694 |
| 137 | Ga0265329_10002088 | 3300031242 | Bacteria | 9293 |
| 138 | Ga0265340_10014743 | 3300031247 | Bacteria | 4075 |
| 139 | Ga0265331_10000042 | 3300031250 | Bacteria | 191733 |
| 140 | Ga0265331_10036704 | 3300031250 | Bacteria | 2405 |
| 141 | Ga0265316_10000689 | 3300031344 | Bacteria | 37558 |
| 142 | Ga0265316_10004683 | 3300031344 | Bacteria | 13552 |
| 143 | Ga0265316_10117048 | 3300031344 | Bacteria | 2015 |
| 144 | Ga0265313_10000248 | 3300031595 | Bacteria | 58684 |
| 145 | Ga0265313_10003604 | 3300031595 | Bacteria | 12448 |
| 146 | Ga0265314_10000049 | 3300031711 | Bacteria | 191749 |
| 147 | Ga0265342_10001782 | 3300031712 | Bacteria | 19613 |
| 148 | Ga0265342_10034477 | 3300031712 | Bacteria | 3105 |
| 149 | Ga0316576_10046023 | 3300031727 | Bacteria | 3157 |
| 150 | Ga0316576_10116198 | 3300031727 | Bacteria | 2008 |
| 151 | Ga0316577_10061601 | 3300031733 | Bacteria | 2094 |
| 152 | Ga0373932_0111431 | 3300035112 | Bacteria | 902 |
| 153 | Ga0373942_0049895 | 3300035207 | Bacteria | 1170 |
| 154 | Ga0316574_0319136 | 3300035398 | Bacteria | 986 |
| 155 | Ga0316582_0050633 | 3300036647 | Bacteria | 2632 |
| 156 | Ga0316584_0125382 | 3300036712 | Bacteria | 1918 |
| 157 | Ga0373925_0213323 | 3300037068 | Bacteria | 1538 |
| 158 | Ga0395899_0000080 | 3300037312 | Bacteria | 171568 |
| 159 | Ga0395899_0010774 | 3300037312 | Bacteria | 7008 |
| 160 | Ga0395900_0000087 | 3300037418 | Bacteria | 171568 |
| 161 | Ga0395900_0000411 | 3300037418 | Bacteria | 61659 |
| 162 | Ga0395900_0009539 | 3300037418 | Bacteria | 9950 |
| 163 | Ga0395900_0065445 | 3300037418 | Bacteria | 3734 |
| 164 | Ga0395898_0000679 | 3300037466 | Bacteria | 61481 |
| 165 | Ga0395898_0026193 | 3300037466 | Bacteria | 5869 |
| 166 | Ga0395901_0001988 | 3300038443 | Bacteria | 21038 |
| 167 | Ga0400487_51885 | 3300039110 | Bacteria | 77480 |
| 168 | Ga0436361_0215157 | 3300039447 | Bacteria | 166868 |
| 169 | Ga0439439_0030841 | 3300041406 | Bacteria | 1364 |
| 170 | Ga0439439_0105633 | 3300041406 | Bacteria | 777 |
| 171 | Ga0439433_0070308 | 3300041999 | Bacteria | 842 |
| 172 | Ga0439449_0000011 | 3300042007 | Bacteria | 57369 |
| 173 | Ga0439449_0006283 | 3300042007 | Bacteria | 4542 |
| 174 | Ga0439457_003456 | 3300042014 | Bacteria | 4298 |
| 175 | Ga0439457_049148 | 3300042014 | Bacteria | 945 |
| 176 | Ga0439462_0001752 | 3300042015 | Bacteria | 4908 |
| 177 | Ga0439462_0004781 | 3300042015 | Bacteria | 3320 |
| 178 | Ga0450923_006448 | 3300042125 | Bacteria | 1947 |
| 179 | Ga0450918_021327 | 3300042531 | Bacteria | 1132 |
| 180 | Ga0451577_0002176 | 3300042876 | Bacteria | 23929 |
| 181 | Ga0451577_0025349 | 3300042876 | Bacteria | 5381 |
| 182 | Ga0451577_0478334 | 3300042876 | Bacteria | 1131 |
| 183 | Ga0466969_0000361 | 3300044656 | Bacteria | 24953 |
| 184 | Ga0466969_0164888 | 3300044656 | Bacteria | 1017 |
| 185 | Ga0466973_0175396 | 3300044659 | Bacteria | 1644 |
| 186 | Ga0453683_0001186 | 3300044673 | Bacteria | 23518 |
| 187 | Ga0466965_0021290 | 3300044683 | Bacteria | 3119 |
| 188 | Ga0466966_0000058 | 3300044684 | Bacteria | 81196 |
| 189 | Ga0466966_0197300 | 3300044684 | Bacteria | 1218 |
| 190 | Ga0466961_0000224 | 3300044693 | Bacteria | 38254 |
| 191 | Ga0466961_0001006 | 3300044693 | Bacteria | 17408 |
| 192 | Ga0466961_0014062 | 3300044693 | Bacteria | 5133 |
| 193 | Ga0466961_0050752 | 3300044693 | Bacteria | 2649 |
| 194 | Ga0453684_0000078 | 3300044712 | Bacteria | 428794 |
| 195 | Ga0453684_0004951 | 3300044712 | Bacteria | 27140 |
| 196 | Ga0466971_0021760 | 3300044719 | Bacteria | 2853 |
| 197 | Ga0466968_0072962 | 3300044735 | Bacteria | 1497 |
| 198 | Ga0466970_0075082 | 3300044765 | Bacteria | 1820 |
| 199 | Ga0466957_0022895 | 3300044842 | Bacteria | 3688 |
| 200 | Ga0466959_0007304 | 3300045049 | Bacteria | 7745 |
| 201 | Ga0466959_0045124 | 3300045049 | Bacteria | 3246 |
| 202 | Ga0466959_0061396 | 3300045049 | Bacteria | 2732 |
| 203 | Ga0466959_0117771 | 3300045049 | Bacteria | 1890 |
| 204 | Ga0451576_0000938 | 3300045051 | Bacteria | 54971 |
| 205 | Ga0451576_0002517 | 3300045051 | Bacteria | 27167 |
| 206 | Ga0451576_0453473 | 3300045051 | Bacteria | 1346 |
| 207 | Ga0466958_0000928 | 3300045836 | Bacteria | 13208 |
| 208 | Ga0466958_0031534 | 3300045836 | Bacteria | 3150 |
| 209 | Ga0495627_095098 | 3300046453 | Bacteria | 854 |
| 210 | Ga0495654_0185994 | 3300046530 | Bacteria | 897 |
| 211 | Ga0495621_0191630 | 3300046539 | Bacteria | 820 |
| 212 | Ga0495636_0162520 | 3300047318 | Bacteria | 1007 |
| 213 | Ga0495626_0037300 | 3300048091 | Bacteria | 2311 |
| 214 | Ga0496104_0296886 | 3300048907 | Bacteria | 1528 |
| 215 | Ga0496108_0056534 | 3300048911 | Bacteria | 3297 |
| 216 | Ga0496109_0515871 | 3300048912 | Bacteria | 1128 |
| 217 | Ga0496116_0002371 | 3300048919 | Bacteria | 19898 |
| 218 | Ga0496116_0005418 | 3300048919 | Bacteria | 11859 |
| 219 | Ga0496116_0065790 | 3300048919 | Bacteria | 2323 |
| 220 | Ga0496116_0140624 | 3300048919 | Bacteria | 1359 |
| 221 | Ga0496121_0084363 | 3300048924 | Bacteria | 2505 |
| 222 | Ga0496121_0141596 | 3300048924 | Bacteria | 1783 |
| 223 | Ga0496121_0261745 | 3300048924 | Bacteria | 1194 |
| 224 | Ga0496121_0565112 | 3300048924 | Bacteria | 709 |
| 225 | Ga0496122_0039950 | 3300048925 | Bacteria | 3736 |
| 226 | Ga0496122_0154598 | 3300048925 | Bacteria | 1410 |
| 227 | Ga0496124_0000211 | 3300048927 | Bacteria | 113824 |
| 228 | Ga0496124_0172252 | 3300048927 | Bacteria | 1674 |
| 229 | Ga0496124_0215233 | 3300048927 | Bacteria | 1450 |
| 230 | Ga0496125_0007811 | 3300048928 | Bacteria | 11306 |
| 231 | Ga0496125_0014091 | 3300048928 | Bacteria | 7810 |
| 232 | Ga0496125_0041575 | 3300048928 | Bacteria | 3928 |
| 233 | Ga0496125_0267354 | 3300048928 | Bacteria | 1068 |
| 234 | Ga0501305_041633 | 3300049161 | Bacteria | 749 |
| 235 | Ga0501034_0001835 | 3300049571 | Bacteria | 26959 |
| 236 | Ga0501040_0000006 | 3300049576 | Bacteria | 97170 |
| 237 | Ga0501040_0034002 | 3300049576 | Bacteria | 3455 |
| 238 | Ga0501040_0138186 | 3300049576 | Bacteria | 1716 |
| 239 | Ga0501040_0340617 | 3300049576 | Bacteria | 1073 |
| 240 | Ga0501042_0000196 | 3300049578 | Bacteria | 28694 |
| 241 | Ga0501042_0003131 | 3300049578 | Bacteria | 10307 |
| 242 | Ga0501043_0380771 | 3300049579 | Bacteria | 1068 |
| 243 | Ga0501067_0000315 | 3300049583 | Bacteria | 26634 |
| 244 | Ga0501069_0000832 | 3300049585 | Bacteria | 14587 |
| 245 | Ga0501070_0001767 | 3300049586 | Bacteria | 19121 |
| 246 | Ga0501072_0000612 | 3300049588 | Bacteria | 25699 |
| 247 | Ga0501072_0026766 | 3300049588 | Bacteria | 4498 |
| 248 | Ga0501072_0265058 | 3300049588 | Bacteria | 1367 |
| 249 | Ga0501073_0045218 | 3300049589 | Bacteria | 3101 |
| 250 | Ga0501208_006886 | 3300049655 | Bacteria | 1469 |
| 251 | Ga0501080_0001362 | 3300049742 | Bacteria | 20427 |
| 252 | Ga0501080_0766862 | 3300049742 | Bacteria | 847 |
| 253 | Ga0501081_0016638 | 3300049743 | Bacteria | 4863 |
| 254 | Ga0501083_0001185 | 3300049744 | Bacteria | 17609 |
| 255 | Ga0501279_017871 | 3300049775 | Bacteria | 995 |
| 256 | Ga0501035_0173783 | 3300049822 | Bacteria | 1860 |
| 257 | Ga0501045_0437417 | 3300049824 | Bacteria | 973 |
| 258 | nmdc:mga0yw44_150366_c1 | 3300050492 | Bacteria | 1518 |
| 259 | nmdc:mga0k408_454974_c1 | 3300050493 | Bacteria | 760 |
| 260 | nmdc:mga05p37_494801_c1 | 3300050507 | Bacteria | 1405 |
| 261 | nmdc:mga0a205_181451_c1 | 3300050515 | Bacteria | 1999 |
| 262 | Ga0587076_075249 | 3300059645 | Bacteria | 709 |
| 263 | Ga0466962_0001925 | 3300061719 | Bacteria | 9769 |
| 264 | Ga0466962_0028493 | 3300061719 | Bacteria | 2675 |
| 265 | Ga0466962_0145545 | 3300061719 | Bacteria | 1149 |
| 266 | 2510283147 | 2510065053 | Bacteria | 5005518 |
| 267 | 2510293812 | 2510065055 | Bacteria | 5037935 |
| 268 | 2510310573 | 2510065058 | Bacteria | 5005894 |
| 269 | 2574430142 | 2574179768 | Bacteria | 4907129 |
| 270 | 2808973006 | 2808606384 | Bacteria | 8474373 |
| 271 | 2809007828 | 2808606390 | Bacteria | 8476311 |
| 272 | 2809016523 | 2808606391 | Bacteria | 8308166 |
| 273 | 2980185343 | 2980182181 | Bacteria | 9454109 |
| 274 | 8057632219 | 8057632132 | Bacteria | 4726859 |
| 275 | Ga0501041_0127170 | |||
| 276 | Ga0070658_10000163 | |||
| 277 | Ga0070658_10055898 | |||
| 278 | Ga0070658_10477463 | |||
| 279 | Ga0070670_100010673 | |||
| 280 | Ga0070670_100035621 | |||
| 281 | Ga0068869_100017839 | |||
| 282 | Ga0070680_100099372 | |||
| 283 | Ga0070682_100010615 | |||
| 284 | Ga0068868_100013548 | |||
| 285 | Ga0068868_100503778 | |||
| 286 | Ga0070689_100058533 | |||
| 287 | Ga0070661_100021315 | |||
| 288 | Ga0070692_10129846 | |||
| 289 | Ga0070668_100015206 | |||
| 290 | Ga0070671_100000342 | |||
| 291 | Ga0070667_100164435 | |||
| 292 | Ga0070705_100877668 | |||
| 293 | Ga0070662_100391370 | |||
| 294 | Ga0068867_100016113 | |||
| 295 | Ga0070685_10194594 | |||
| 296 | Ga0070679_100010443 | |||
| 297 | Ga0068853_100016284 | |||
| 298 | Ga0070665_100001392 | |||
| 299 | Ga0070665_100711750 | |||
| 300 | Ga0068855_100083116 | |||
| 301 | Ga0068856_101068538 | |||
| 302 | Ga0070702_100043897 | |||
| 303 | Ga0068859_100000435 | |||
| 304 | Ga0068859_100025721 | |||
| 305 | Ga0068866_10002961 | |||
| 306 | Ga0068866_10239000 | |||
| 307 | Ga0068861_100014236 | |||
| 308 | Ga0068870_10062278 | |||
| 309 | Ga0068863_100006190 | |||
| 310 | Ga0068858_100009897 | |||
| 311 | Ga0068858_100017799 | |||
| 312 | Ga0068860_100044868 | |||
| 313 | Ga0068862_100022397 | |||
| 314 | Ga0075365_10566591 | |||
| 315 | Ga0075364_10027989 | |||
| 316 | Ga0075366_10028968 | |||
| 317 | Ga0075366_10403306 | |||
| 318 | Ga0068871_100482665 | |||
| 319 | Ga0068871_101031565 | |||
| 320 | Ga0068865_100018205 | |||
| 321 | Ga0068865_100143136 | |||
| 322 | Ga0097620_100000435 | |||
| 323 | Ga0097620_100025717 | |||
| 324 | Ga0105251_10006610 | |||
| 325 | Ga0105244_10011132 | |||
| 326 | Ga0105244_10032957 | |||
| 327 | Ga0105244_10146965 | |||
| 328 | Ga0105240_10001013 | |||
| 329 | Ga0105240_10393569 | |||
| 330 | Ga0105245_10368841 | |||
| 331 | Ga0105247_10119900 | |||
| 332 | Ga0114129_10502697 | |||
| 333 | Ga0105243_10026144 | |||
| 334 | Ga0105241_10180463 | |||
| 335 | Ga0105242_10037362 | |||
| 336 | Ga0105242_10154664 | |||
| 337 | Ga0105248_10027931 | |||
| 338 | Ga0105248_10241471 | |||
| 339 | Ga0105248_10705296 | |||
| 340 | Ga0105237_10000006 | |||
| 341 | Ga0105237_10580727 | |||
| 342 | Ga0105238_10012863 | |||
| 343 | Ga0105238_10083783 | |||
| 344 | Ga0105249_10105289 | |||
| 345 | Ga0105239_10234743 | |||
| 346 | Ga0105239_10776697 | |||
| 347 | Ga0157371_10264337 | |||
| 348 | Ga0157370_10000361 | |||
| 349 | Ga0157370_10905715 | |||
| 350 | Ga0157369_10050555 | |||
| 351 | Ga0157369_10079096 | |||
| 352 | Ga0157374_10775816 | |||
| 353 | Ga0157378_10019484 | |||
| 354 | Ga0157378_10217819 | |||
| 355 | Ga0157372_10004747 | |||
| 356 | Ga0157372_10012779 | |||
| 357 | Ga0157372_10198382 | |||
| 358 | Ga0157375_10141608 | |||
| 359 | Ga0163163_10014023 | |||
| 360 | Ga0157380_10436486 | |||
| 361 | Ga0157380_12011754 | |||
| 362 | Ga0157377_10007354 | |||
| 363 | Ga0157379_10007773 | |||
| 364 | Ga0157379_10086566 | |||
| 365 | Ga0157379_10584096 | |||
| 366 | Ga0157376_10378698 | |||
| 367 | Ga0213872_10000115 | |||
| 368 | Ga0209566_100116 | |||
| 369 | Ga0209566_100205 | |||
| 370 | Ga0209437_100941 | |||
| 371 | Ga0207656_10110064 | |||
| 372 | Ga0207655_1003927 | |||
| 373 | Ga0207713_1013006 | |||
| 374 | Ga0207705_10137898 | |||
| 375 | Ga0207654_10280018 | |||
| 376 | Ga0207695_10015662 | |||
| 377 | Ga0207671_10000070 | |||
| 378 | Ga0207671_10478598 | |||
| 379 | Ga0207660_10067559 | |||
| 380 | Ga0207649_10015271 | |||
| 381 | Ga0207652_10000635 | |||
| 382 | Ga0207694_10012027 | |||
| 383 | Ga0207650_10006523 | |||
| 384 | Ga0207706_10000524 | |||
| 385 | Ga0207704_10143200 | |||
| 386 | Ga0207667_10543416 | |||
| 387 | Ga0207712_10000583 | |||
| 388 | Ga0207668_10009769 | |||
| 389 | Ga0207677_10493940 | |||
| 390 | Ga0207703_10001755 | |||
| 391 | Ga0207703_10053649 | |||
| 392 | Ga0207703_10454655 | |||
| 393 | Ga0207639_10000149 | |||
| 394 | Ga0207639_10008625 | |||
| 395 | Ga0207641_10012230 | |||
| 396 | Ga0207674_10108886 | |||
| 397 | Ga0207698_10703618 | |||
| 398 | Ga0207698_10849338 | |||
| 399 | Ga0268266_10000008 | |||
| 400 | Ga0268264_10052179 | |||
| 401 | Ga0265319_1050354 | |||
| 402 | Ga0265318_10002055 | |||
| 403 | Ga0265338_10051183 | |||
| 404 | Ga0265330_10003312 | |||
| 405 | Ga0265330_10005656 | |||
| 406 | Ga0265332_10000463 | |||
| 407 | Ga0265328_10001177 | |||
| 408 | Ga0265320_10000003 | |||
| 409 | Ga0265320_10140651 | |||
| 410 | Ga0265325_10000401 | |||
| 411 | Ga0265329_10002088 | |||
| 412 | Ga0265340_10014743 | |||
| 413 | Ga0265331_10000042 | |||
| 414 | Ga0265331_10036704 | |||
| 415 | Ga0265316_10000689 | |||
| 416 | Ga0265316_10004683 | |||
| 417 | Ga0265316_10117048 | |||
| 418 | Ga0265313_10000248 | |||
| 419 | Ga0265313_10003604 | |||
| 420 | Ga0265314_10000049 | |||
| 421 | Ga0265342_10001782 | |||
| 422 | Ga0265342_10034477 | |||
| 423 | Ga0316576_10046023 | |||
| 424 | Ga0316576_10116198 | |||
| 425 | Ga0316577_10061601 | |||
| 426 | Ga0373932_0111431 | |||
| 427 | Ga0373942_0049895 | |||
| 428 | Ga0316574_0319136 | |||
| 429 | Ga0316582_0050633 | |||
| 430 | Ga0316584_0125382 | |||
| 431 | Ga0373925_0213323 | |||
| 432 | Ga0395899_0000080 | |||
| 433 | Ga0395899_0010774 | |||
| 434 | Ga0395900_0000087 | |||
| 435 | Ga0395900_0000411 | |||
| 436 | Ga0395900_0009539 | |||
| 437 | Ga0395900_0065445 | |||
| 438 | Ga0395898_0000679 | |||
| 439 | Ga0395898_0026193 | |||
| 440 | Ga0395901_0001988 | |||
| 441 | Ga0400487_51885 | |||
| 442 | Ga0436361_0215157 | |||
| 443 | Ga0439439_0030841 | |||
| 444 | Ga0439439_0105633 | |||
| 445 | Ga0439433_0070308 | |||
| 446 | Ga0439449_0000011 | |||
| 447 | Ga0439449_0006283 | |||
| 448 | Ga0439457_003456 | |||
| 449 | Ga0439457_049148 | |||
| 450 | Ga0439462_0001752 | |||
| 451 | Ga0439462_0004781 | |||
| 452 | Ga0450923_006448 | |||
| 453 | Ga0450918_021327 | |||
| 454 | Ga0451577_0002176 | |||
| 455 | Ga0451577_0025349 | |||
| 456 | Ga0451577_0478334 | |||
| 457 | Ga0466969_0000361 | |||
| 458 | Ga0466969_0164888 | |||
| 459 | Ga0466973_0175396 | |||
| 460 | Ga0453683_0001186 | |||
| 461 | Ga0466965_0021290 | |||
| 462 | Ga0466966_0000058 | |||
| 463 | Ga0466966_0197300 | |||
| 464 | Ga0466961_0000224 | |||
| 465 | Ga0466961_0001006 | |||
| 466 | Ga0466961_0014062 | |||
| 467 | Ga0466961_0050752 | |||
| 468 | Ga0453684_0000078 | |||
| 469 | Ga0453684_0004951 | |||
| 470 | Ga0466971_0021760 | |||
| 471 | Ga0466968_0072962 | |||
| 472 | Ga0466970_0075082 | |||
| 473 | Ga0466957_0022895 | |||
| 474 | Ga0466959_0007304 | |||
| 475 | Ga0466959_0045124 | |||
| 476 | Ga0466959_0061396 | |||
| 477 | Ga0466959_0117771 | |||
| 478 | Ga0451576_0000938 | |||
| 479 | Ga0451576_0002517 | |||
| 480 | Ga0451576_0453473 | |||
| 481 | Ga0466958_0000928 | |||
| 482 | Ga0466958_0031534 | |||
| 483 | Ga0495627_095098 | |||
| 484 | Ga0495654_0185994 | |||
| 485 | Ga0495621_0191630 | |||
| 486 | Ga0495636_0162520 | |||
| 487 | Ga0495626_0037300 | |||
| 488 | Ga0496104_0296886 | |||
| 489 | Ga0496108_0056534 | |||
| 490 | Ga0496109_0515871 | |||
| 491 | Ga0496116_0002371 | |||
| 492 | Ga0496116_0005418 | |||
| 493 | Ga0496116_0065790 | |||
| 494 | Ga0496116_0140624 | |||
| 495 | Ga0496121_0084363 | |||
| 496 | Ga0496121_0141596 | |||
| 497 | Ga0496121_0261745 | |||
| 498 | Ga0496121_0565112 | |||
| 499 | Ga0496122_0039950 | |||
| 500 | Ga0496122_0154598 | |||
| 501 | Ga0496124_0000211 | |||
| 502 | Ga0496124_0172252 | |||
| 503 | Ga0496124_0215233 | |||
| 504 | Ga0496125_0007811 | |||
| 505 | Ga0496125_0014091 | |||
| 506 | Ga0496125_0041575 | |||
| 507 | Ga0496125_0267354 | |||
| 508 | Ga0501305_041633 | |||
| 509 | Ga0501034_0001835 | |||
| 510 | Ga0501040_0000006 | |||
| 511 | Ga0501040_0034002 | |||
| 512 | Ga0501040_0138186 | |||
| 513 | Ga0501040_0340617 | |||
| 514 | Ga0501042_0000196 | |||
| 515 | Ga0501042_0003131 | |||
| 516 | Ga0501043_0380771 | |||
| 517 | Ga0501067_0000315 | |||
| 518 | Ga0501069_0000832 | |||
| 519 | Ga0501070_0001767 | |||
| 520 | Ga0501072_0000612 | |||
| 521 | Ga0501072_0026766 | |||
| 522 | Ga0501072_0265058 | |||
| 523 | Ga0501073_0045218 | |||
| 524 | Ga0501208_006886 | |||
| 525 | Ga0501080_0001362 | |||
| 526 | Ga0501080_0766862 | |||
| 527 | Ga0501081_0016638 | |||
| 528 | Ga0501083_0001185 | |||
| 529 | Ga0501279_017871 | |||
| 530 | Ga0501035_0173783 | |||
| 531 | Ga0501045_0437417 | |||
| 532 | nmdc:mga0yw44_150366_c1 | |||
| 533 | nmdc:mga0k408_454974_c1 | |||
| 534 | nmdc:mga05p37_494801_c1 | |||
| 535 | nmdc:mga0a205_181451_c1 | |||
| 536 | Ga0587076_075249 | |||
| 537 | Ga0466962_0001925 | |||
| 538 | Ga0466962_0028493 | |||
| 539 | Ga0466962_0145545 | |||
| 540 | 2510283147 | |||
| 541 | 2510293812 | |||
| 542 | 2510310573 | |||
| 543 | 2574430142 | |||
| 544 | 2808973006 | |||
| 545 | 2809007828 | |||
| 546 | 2809016523 | |||
| 547 | 2980185343 | |||
| 548 | 8057632219 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hx6-assembly1.cif.gz_A | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae | 0.954 | 2 | 188 |
| 8hx7-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.9464 | 2 | 188 |
| 1qdl-assembly1.cif.gz_B-2 | the crystal structure of anthranilate synthase from sulfolobus solfataricus | 0.9431 | 2 | 191 |
| 8hx8-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate | 0.9425 | 2 | 189 |
| 1i1q-assembly1.cif.gz_B | structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium | 0.9292 | 2 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9947 | 1 | 191 | 3.40.50.880 |
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9894 | 1 | 191 | 3.40.50.880 |
| af_Q2G099_1_189_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9721 | 1 | 191 | 3.40.50.880 |
| af_Q2G099_1_189_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9621 | 1 | 191 | 3.40.50.880 |
| af_K7L2D7_74_267_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9617 | 2 | 189 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2YPT6-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 0.9985 | 1 | 189 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-A0A4U1H1Y7-F1-model_v4 | deleted | 0.9984 | 2 | 189 |
|
| AF-A0A2S5L9G7-F1-model_v4 | Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) | 0.9982 | 1 | 189 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-A0A259CX94-F1-model_v4 | Anthranilate/aminodeoxychorismate synthase component II | 0.9978 | 1 | 189 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-A0A5C7X5A9-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 0.9978 | 1 | 189 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |