F379979

General Info

Members Datasets Scaffolds Average Seq Length
274 139 548 120

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0400767|Ga0495686_0400767_347_703
Length 118
Sequence MAEIFHGQCHCGQVKLSAPKPEYLTECNCSMCTKGGALWAYYPGESLSISGETSRYVRADLTEPFLTTHFCPVCGIRTHWTPLTDPPHERMGINTRLFGEEMREGVELRFCDGASWPL

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
118 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
119 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
135 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 1.09
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0400767 3300047472 Bacteria 736
2 JGI24737J22298_10006991 3300001990 Bacteria 3825
3 Ga0070658_10077574 3300005327 Bacteria 2726
4 Ga0070658_11909519 3300005327 Bacteria 513
5 Ga0070676_10014928 3300005328 Bacteria 4275
6 Ga0070676_10122535 3300005328 Bacteria 1634
7 Ga0070676_11270064 3300005328 Bacteria 561
8 Ga0070670_100031888 3300005331 Bacteria 4537
9 Ga0070670_100120105 3300005331 Bacteria 2267
10 Ga0070666_10168394 3300005335 Bacteria 1534
11 Ga0070682_101908934 3300005337 Bacteria 520
12 Ga0068868_100220831 3300005338 Bacteria 1586
13 Ga0070661_100535653 3300005344 Bacteria 941
14 Ga0070661_100886069 3300005344 Bacteria 736
15 Ga0070668_100011926 3300005347 Bacteria 6471
16 Ga0070668_101000625 3300005347 Bacteria 751
17 Ga0070669_100038980 3300005353 Bacteria 3451
18 Ga0070669_100665632 3300005353 Bacteria 877
19 Ga0070675_100058526 3300005354 Bacteria 3179
20 Ga0070674_100059205 3300005356 Bacteria 2666
21 Ga0070674_100354876 3300005356 Bacteria 1185
22 Ga0070673_100049675 3300005364 Bacteria 3276
23 Ga0070673_100057345 3300005364 Bacteria 3077
24 Ga0070659_100003157 3300005366 Bacteria 11739
25 Ga0070659_100017466 3300005366 Bacteria 5402
26 Ga0070667_100030303 3300005367 Bacteria 4511
27 Ga0070667_100062082 3300005367 Bacteria 3165
28 Ga0070667_100191933 3300005367 Bacteria 1810
29 Ga0070667_100261289 3300005367 Bacteria 1550
30 Ga0070714_100021159 3300005435 Bacteria 5319
31 Ga0070700_100799832 3300005441 Unclassified 759
32 Ga0070694_100089591 3300005444 Bacteria 2156
33 Ga0070678_100012412 3300005456 Bacteria 5293
34 Ga0070662_100425904 3300005457 Bacteria 1098
35 Ga0070681_10442863 3300005458 Bacteria 1211
36 Ga0068867_100038370 3300005459 Bacteria 3487
37 Ga0070685_10361756 3300005466 Bacteria 995
38 Ga0070679_100570535 3300005530 Bacteria 1075
39 Ga0070695_100367048 3300005545 Bacteria 1083
40 Ga0070696_100035319 3300005546 Bacteria 3441
41 Ga0070696_101947751 3300005546 Unclassified 509
42 Ga0070693_100244491 3300005547 Bacteria 1187
43 Ga0070665_100011456 3300005548 Bacteria 8964
44 Ga0070665_100046405 3300005548 Bacteria 4365
45 Ga0068855_100847506 3300005563 Bacteria 969
46 Ga0070664_100095858 3300005564 Bacteria 2574
47 Ga0070664_100205015 3300005564 Bacteria 1761
48 Ga0068854_100202069 3300005578 Bacteria 1563
49 Ga0068854_102269763 3300005578 Bacteria 503
50 Ga0068856_100949041 3300005614 Bacteria 879
51 Ga0068859_100743794 3300005617 Bacteria 1070
52 Ga0068866_10507961 3300005718 Bacteria 799
53 Ga0068861_100155281 3300005719 Bacteria 1882
54 Ga0068870_10054517 3300005840 Bacteria 2127
55 Ga0068863_100093438 3300005841 Bacteria 2854
56 Ga0068860_100180454 3300005843 Bacteria 2040
57 Ga0068862_100012981 3300005844 Bacteria 6890
58 Ga0068862_100035214 3300005844 Bacteria 4237
59 Ga0075364_10212213 3300006051 Bacteria 1313
60 Ga0068871_100391782 3300006358 Bacteria 1236
61 Ga0075428_100187961 3300006844 Bacteria 2234
62 Ga0075429_100674231 3300006880 Bacteria 906
63 Ga0068865_100062114 3300006881 Bacteria 2621
64 Ga0068865_100262540 3300006881 Bacteria 1368
65 Ga0068865_102109928 3300006881 Bacteria 512
66 Ga0097620_100743686 3300006931 Bacteria 1070
67 Ga0111539_11676162 3300009094 Bacteria 737
68 Ga0114129_10434386 3300009147 Bacteria 1725
69 Ga0105242_10988670 3300009176 Bacteria 848
70 Ga0105248_10400539 3300009177 Bacteria 1545
71 Ga0105249_10555686 3300009553 Bacteria 1199
72 Ga0157371_10269086 3300013102 Unclassified 1229
73 Ga0157369_12000355 3300013105 Bacteria 588
74 Ga0157374_10021370 3300013296 Bacteria 5757
75 Ga0163162_10042956 3300013306 Bacteria 4525
76 Ga0157375_10021405 3300013308 Bacteria 5928
77 Ga0157375_10198417 3300013308 Bacteria 2162
78 Ga0157375_11152410 3300013308 Bacteria 908
79 Ga0157375_12099432 3300013308 Bacteria 672
80 Ga0157376_10487498 3300014969 Bacteria 1209
81 Ga0207697_10018251 3300025315 Bacteria 2878
82 Ga0207697_10027564 3300025315 Bacteria 2322
83 Ga0207656_10582878 3300025321 Bacteria 571
84 Ga0207688_10227864 3300025901 Bacteria 1124
85 Ga0207647_10014652 3300025904 Bacteria 5402
86 Ga0207645_10030785 3300025907 Bacteria 3458
87 Ga0207645_10032965 3300025907 Bacteria 3330
88 Ga0207705_10049653 3300025909 Bacteria 3020
89 Ga0207657_11217588 3300025919 Unclassified 572
90 Ga0207649_10692563 3300025920 Bacteria 790
91 Ga0207652_10513321 3300025921 Bacteria 1078
92 Ga0207681_10013608 3300025923 Bacteria 5037
93 Ga0207681_10044200 3300025923 Bacteria 2985
94 Ga0207650_10372564 3300025925 Bacteria 1178
95 Ga0207650_10568740 3300025925 Bacteria 951
96 Ga0207659_10072063 3300025926 Bacteria 2525
97 Ga0207664_10015416 3300025929 Bacteria 5547
98 Ga0207690_10023437 3300025932 Bacteria 3851
99 Ga0207690_10045513 3300025932 Bacteria 2900
100 Ga0207706_10738663 3300025933 Bacteria 839
101 Ga0207669_10024269 3300025937 Bacteria 3256
102 Ga0207669_10028102 3300025937 Bacteria 3090
103 Ga0207669_10119212 3300025937 Bacteria 1787
104 Ga0207704_10466252 3300025938 Bacteria 1011
105 Ga0207704_10585575 3300025938 Bacteria 911
106 Ga0207704_10767029 3300025938 Bacteria 803
107 Ga0207691_10099402 3300025940 Bacteria 2598
108 Ga0207679_10035063 3300025945 Bacteria 3547
109 Ga0207679_10981090 3300025945 Unclassified 774
110 Ga0207651_10008394 3300025960 Bacteria 5576
111 Ga0207651_10031463 3300025960 Bacteria 3392
112 Ga0207668_10000080 3300025972 Bacteria 72198
113 Ga0207668_10113162 3300025972 Bacteria 2040
114 Ga0207668_10812460 3300025972 Bacteria 828
115 Ga0207640_10089944 3300025981 Bacteria 2123
116 Ga0207640_10182479 3300025981 Bacteria 1575
117 Ga0207658_10003101 3300025986 Bacteria 11895
118 Ga0207658_10053347 3300025986 Bacteria 2987
119 Ga0207658_10156194 3300025986 Bacteria 1864
120 Ga0207658_10237092 3300025986 Bacteria 1543
121 Ga0207658_10620903 3300025986 Bacteria 972
122 Ga0207677_10267520 3300026023 Bacteria 1397
123 Ga0207703_10374734 3300026035 Bacteria 1315
124 Ga0207639_11589985 3300026041 Unclassified 613
125 Ga0207708_10941311 3300026075 Bacteria 749
126 Ga0207702_10191862 3300026078 Bacteria 1888
127 Ga0207641_10093805 3300026088 Bacteria 2631
128 Ga0207648_10028253 3300026089 Bacteria 4974
129 Ga0207683_10007755 3300026121 Bacteria 9187
130 Ga0207698_10643170 3300026142 Bacteria 1050
131 Ga0209983_1020927 3300027665 Bacteria 1366
132 Ga0209971_1012360 3300027682 Bacteria 2020
133 Ga0209974_10042612 3300027876 Bacteria 1511
134 Ga0268266_10026779 3300028379 Bacteria 4906
135 Ga0268266_10099532 3300028379 Bacteria 2559
136 Ga0268265_10006869 3300028380 Bacteria 7701
137 Ga0268265_10019311 3300028380 Bacteria 4734
138 Ga0268265_10023472 3300028380 Bacteria 4348
139 Ga0268264_11046984 3300028381 Bacteria 823
140 Ga0307513_10292380 3300031456 Bacteria 1400
141 Ga0307408_100021830 3300031548 Bacteria 4339
142 Ga0307408_100466353 3300031548 Bacteria 1099
143 Ga0307408_100629901 3300031548 Bacteria 956
144 Ga0307408_100733774 3300031548 Bacteria 891
145 Ga0307408_101186925 3300031548 Bacteria 711
146 Ga0307405_10031169 3300031731 Bacteria 3135
147 Ga0307405_10051039 3300031731 Bacteria 2565
148 Ga0307405_10057714 3300031731 Bacteria 2440
149 Ga0307405_10095176 3300031731 Bacteria 1982
150 Ga0307405_10108998 3300031731 Bacteria 1872
151 Ga0307405_10120185 3300031731 Bacteria 1796
152 Ga0307413_10020509 3300031824 Bacteria 3517
153 Ga0307413_10032577 3300031824 Bacteria 2956
154 Ga0307413_10105819 3300031824 Bacteria 1871
155 Ga0307413_10175459 3300031824 Bacteria 1522
156 Ga0307413_10187254 3300031824 Bacteria 1482
157 Ga0307413_10215765 3300031824 Bacteria 1397
158 Ga0307413_10279861 3300031824 Bacteria 1254
159 Ga0307413_10287810 3300031824 Bacteria 1239
160 Ga0307413_10542843 3300031824 Bacteria 941
161 Ga0307413_11298771 3300031824 Bacteria 636
162 Ga0307410_10012530 3300031852 Bacteria 4911
163 Ga0307410_10020738 3300031852 Bacteria 4028
164 Ga0307410_10024713 3300031852 Bacteria 3758
165 Ga0307410_10054269 3300031852 Bacteria 2716
166 Ga0307410_10188324 3300031852 Bacteria 1567
167 Ga0307410_10201036 3300031852 Bacteria 1521
168 Ga0307410_10469055 3300031852 Bacteria 1030
169 Ga0307410_11719526 3300031852 Bacteria 556
170 Ga0307406_10001811 3300031901 Bacteria 11673
171 Ga0307406_10029359 3300031901 Bacteria 3330
172 Ga0307406_10070938 3300031901 Bacteria 2282
173 Ga0307406_10175546 3300031901 Bacteria 1555
174 Ga0307406_10203921 3300031901 Bacteria 1458
175 Ga0307406_10372302 3300031901 Bacteria 1123
176 Ga0307406_10508383 3300031901 Bacteria 978
177 Ga0307407_10023049 3300031903 Bacteria 3242
178 Ga0307407_10078922 3300031903 Bacteria 1985
179 Ga0307407_10159809 3300031903 Bacteria 1473
180 Ga0307407_10371409 3300031903 Bacteria 1018
181 Ga0307407_10783097 3300031903 Bacteria 724
182 Ga0307412_10009763 3300031911 Bacteria 5510
183 Ga0307412_10043110 3300031911 Bacteria 2936
184 Ga0307412_10079670 3300031911 Bacteria 2260
185 Ga0307412_10143307 3300031911 Bacteria 1753
186 Ga0307412_10887530 3300031911 Bacteria 780
187 Ga0307412_10972352 3300031911 Bacteria 748
188 Ga0307412_11145547 3300031911 Bacteria 694
189 Ga0307409_100017970 3300031995 Bacteria 4733
190 Ga0307409_100135509 3300031995 Bacteria 2112
191 Ga0307409_100290171 3300031995 Bacteria 1517
192 Ga0307409_100501724 3300031995 Bacteria 1182
193 Ga0307409_101385099 3300031995 Bacteria 729
194 Ga0307416_100013122 3300032002 Bacteria 5619
195 Ga0307416_100023586 3300032002 Bacteria 4469
196 Ga0307416_100025286 3300032002 Bacteria 4350
197 Ga0307416_100146825 3300032002 Bacteria 2155
198 Ga0307416_100305256 3300032002 Bacteria 1584
199 Ga0307416_100400979 3300032002 Bacteria 1409
200 Ga0307416_100663274 3300032002 Bacteria 1129
201 Ga0307416_101127545 3300032002 Bacteria 889
202 Ga0307414_10001774 3300032004 Bacteria 11174
203 Ga0307414_10006344 3300032004 Bacteria 6587
204 Ga0307414_10022848 3300032004 Bacteria 3954
205 Ga0307414_10027506 3300032004 Bacteria 3676
206 Ga0307414_10149378 3300032004 Bacteria 1841
207 Ga0307414_10280339 3300032004 Bacteria 1400
208 Ga0307414_10360803 3300032004 Bacteria 1250
209 Ga0307414_10441387 3300032004 Bacteria 1139
210 Ga0307414_10469466 3300032004 Bacteria 1107
211 Ga0307414_10477873 3300032004 Bacteria 1098
212 Ga0307414_10946897 3300032004 Bacteria 791
213 Ga0307411_10005055 3300032005 Bacteria 6422
214 Ga0307411_10008335 3300032005 Bacteria 5361
215 Ga0307411_10025092 3300032005 Bacteria 3565
216 Ga0307411_10034343 3300032005 Bacteria 3155
217 Ga0307411_10044589 3300032005 Bacteria 2846
218 Ga0307411_10079950 3300032005 Bacteria 2246
219 Ga0307411_10247376 3300032005 Bacteria 1400
220 Ga0307411_10532550 3300032005 Bacteria 999
221 Ga0307411_10627661 3300032005 Bacteria 927
222 Ga0307411_10864140 3300032005 Unclassified 801
223 Ga0307415_100002565 3300032126 Bacteria 9081
224 Ga0307415_100011506 3300032126 Bacteria 5068
225 Ga0307415_100017645 3300032126 Bacteria 4284
226 Ga0307415_100110075 3300032126 Bacteria 2042
227 Ga0307415_100118900 3300032126 Bacteria 1977
228 Ga0307415_100666811 3300032126 Bacteria 934
229 Ga0307415_102101259 3300032126 Unclassified 551
230 Ga0395899_0170437 3300037312 Bacteria 1533
231 Ga0395899_0293107 3300037312 Bacteria 1103
232 Ga0395900_0001678 3300037418 Bacteria 25788
233 Ga0395900_0066047 3300037418 Bacteria 3717
234 Ga0395900_0499274 3300037418 Bacteria 1167
235 Ga0395898_0406372 3300037466 Bacteria 1298
236 Ga0395898_1350178 3300037466 Bacteria 641
237 Ga0395905_0000083 3300037471 Bacteria 158407
238 Ga0395905_0007011 3300037471 Bacteria 11267
239 Ga0395905_0031809 3300037471 Bacteria 4965
240 Ga0395905_0038262 3300037471 Bacteria 4501
241 Ga0395905_0061046 3300037471 Bacteria 3525
242 Ga0395905_0275001 3300037471 Bacteria 1570
243 Ga0395905_1144095 3300037471 Unclassified 682
244 Ga0395901_0014876 3300038443 Bacteria 7905
245 Ga0395901_0303086 3300038443 Bacteria 1656
246 Ga0439437_048665 3300042000 Unclassified 560
247 Ga0439445_0001650 3300042004 Bacteria 4888
248 Ga0439432_062407 3300042006 Bacteria 1147
249 Ga0439455_0093833 3300042012 Bacteria 825
250 Ga0450914_004695 3300042118 Bacteria 1123
251 Ga0450892_016927 3300042130 Bacteria 690
252 Ga0439458_0013953 3300042157 Bacteria 1811
253 Ga0439464_0037908 3300042439 Bacteria 1368
254 Ga0439464_0067765 3300042439 Bacteria 1052
255 Ga0466967_0240796 3300045976 Bacteria 1726
256 Ga0495584_0674336 3300046491 Unclassified 527
257 Ga0495585_0396106 3300046492 Bacteria 665
258 Ga0495585_0547214 3300046492 Bacteria 547
259 Ga0495663_0034969 3300046525 Bacteria 1507
260 Ga0495625_0250788 3300046660 Bacteria 1149
261 Ga0495659_0138072 3300046664 Bacteria 971
262 Ga0495669_0205540 3300046684 Unclassified 942
263 Ga0495670_0784386 3300046691 Bacteria 520
264 Ga0495636_0220312 3300047318 Bacteria 871
265 Ga0496107_0081005 3300048910 Bacteria 2368
266 Ga0496112_0120801 3300048915 Bacteria 2590
267 Ga0496114_0000109 3300048917 Bacteria 59733
268 Ga0501235_016888 3300049669 Bacteria 1614
269 Ga0501259_104289 3300049688 Unclassified 654
270 nmdc:mga00v17_359561_c1 3300050491 Bacteria 946
271 nmdc:mga05p37_667292_c1 3300050507 Bacteria 1161
272 nmdc:mga09592_236255_c1 3300050508 Bacteria 1583
273 nmdc:mga09592_643478_c1 3300050508 Bacteria 906
274 nmdc:mga08y16_223360_c1 3300050511 Bacteria 1949
275 Ga0495686_0400767
276 JGI24737J22298_10006991
277 Ga0070658_10077574
278 Ga0070658_11909519
279 Ga0070676_10014928
280 Ga0070676_10122535
281 Ga0070676_11270064
282 Ga0070670_100031888
283 Ga0070670_100120105
284 Ga0070666_10168394
285 Ga0070682_101908934
286 Ga0068868_100220831
287 Ga0070661_100535653
288 Ga0070661_100886069
289 Ga0070668_100011926
290 Ga0070668_101000625
291 Ga0070669_100038980
292 Ga0070669_100665632
293 Ga0070675_100058526
294 Ga0070674_100059205
295 Ga0070674_100354876
296 Ga0070673_100049675
297 Ga0070673_100057345
298 Ga0070659_100003157
299 Ga0070659_100017466
300 Ga0070667_100030303
301 Ga0070667_100062082
302 Ga0070667_100191933
303 Ga0070667_100261289
304 Ga0070714_100021159
305 Ga0070700_100799832
306 Ga0070694_100089591
307 Ga0070678_100012412
308 Ga0070662_100425904
309 Ga0070681_10442863
310 Ga0068867_100038370
311 Ga0070685_10361756
312 Ga0070679_100570535
313 Ga0070695_100367048
314 Ga0070696_100035319
315 Ga0070696_101947751
316 Ga0070693_100244491
317 Ga0070665_100011456
318 Ga0070665_100046405
319 Ga0068855_100847506
320 Ga0070664_100095858
321 Ga0070664_100205015
322 Ga0068854_100202069
323 Ga0068854_102269763
324 Ga0068856_100949041
325 Ga0068859_100743794
326 Ga0068866_10507961
327 Ga0068861_100155281
328 Ga0068870_10054517
329 Ga0068863_100093438
330 Ga0068860_100180454
331 Ga0068862_100012981
332 Ga0068862_100035214
333 Ga0075364_10212213
334 Ga0068871_100391782
335 Ga0075428_100187961
336 Ga0075429_100674231
337 Ga0068865_100062114
338 Ga0068865_100262540
339 Ga0068865_102109928
340 Ga0097620_100743686
341 Ga0111539_11676162
342 Ga0114129_10434386
343 Ga0105242_10988670
344 Ga0105248_10400539
345 Ga0105249_10555686
346 Ga0157371_10269086
347 Ga0157369_12000355
348 Ga0157374_10021370
349 Ga0163162_10042956
350 Ga0157375_10021405
351 Ga0157375_10198417
352 Ga0157375_11152410
353 Ga0157375_12099432
354 Ga0157376_10487498
355 Ga0207697_10018251
356 Ga0207697_10027564
357 Ga0207656_10582878
358 Ga0207688_10227864
359 Ga0207647_10014652
360 Ga0207645_10030785
361 Ga0207645_10032965
362 Ga0207705_10049653
363 Ga0207657_11217588
364 Ga0207649_10692563
365 Ga0207652_10513321
366 Ga0207681_10013608
367 Ga0207681_10044200
368 Ga0207650_10372564
369 Ga0207650_10568740
370 Ga0207659_10072063
371 Ga0207664_10015416
372 Ga0207690_10023437
373 Ga0207690_10045513
374 Ga0207706_10738663
375 Ga0207669_10024269
376 Ga0207669_10028102
377 Ga0207669_10119212
378 Ga0207704_10466252
379 Ga0207704_10585575
380 Ga0207704_10767029
381 Ga0207691_10099402
382 Ga0207679_10035063
383 Ga0207679_10981090
384 Ga0207651_10008394
385 Ga0207651_10031463
386 Ga0207668_10000080
387 Ga0207668_10113162
388 Ga0207668_10812460
389 Ga0207640_10089944
390 Ga0207640_10182479
391 Ga0207658_10003101
392 Ga0207658_10053347
393 Ga0207658_10156194
394 Ga0207658_10237092
395 Ga0207658_10620903
396 Ga0207677_10267520
397 Ga0207703_10374734
398 Ga0207639_11589985
399 Ga0207708_10941311
400 Ga0207702_10191862
401 Ga0207641_10093805
402 Ga0207648_10028253
403 Ga0207683_10007755
404 Ga0207698_10643170
405 Ga0209983_1020927
406 Ga0209971_1012360
407 Ga0209974_10042612
408 Ga0268266_10026779
409 Ga0268266_10099532
410 Ga0268265_10006869
411 Ga0268265_10019311
412 Ga0268265_10023472
413 Ga0268264_11046984
414 Ga0307513_10292380
415 Ga0307408_100021830
416 Ga0307408_100466353
417 Ga0307408_100629901
418 Ga0307408_100733774
419 Ga0307408_101186925
420 Ga0307405_10031169
421 Ga0307405_10051039
422 Ga0307405_10057714
423 Ga0307405_10095176
424 Ga0307405_10108998
425 Ga0307405_10120185
426 Ga0307413_10020509
427 Ga0307413_10032577
428 Ga0307413_10105819
429 Ga0307413_10175459
430 Ga0307413_10187254
431 Ga0307413_10215765
432 Ga0307413_10279861
433 Ga0307413_10287810
434 Ga0307413_10542843
435 Ga0307413_11298771
436 Ga0307410_10012530
437 Ga0307410_10020738
438 Ga0307410_10024713
439 Ga0307410_10054269
440 Ga0307410_10188324
441 Ga0307410_10201036
442 Ga0307410_10469055
443 Ga0307410_11719526
444 Ga0307406_10001811
445 Ga0307406_10029359
446 Ga0307406_10070938
447 Ga0307406_10175546
448 Ga0307406_10203921
449 Ga0307406_10372302
450 Ga0307406_10508383
451 Ga0307407_10023049
452 Ga0307407_10078922
453 Ga0307407_10159809
454 Ga0307407_10371409
455 Ga0307407_10783097
456 Ga0307412_10009763
457 Ga0307412_10043110
458 Ga0307412_10079670
459 Ga0307412_10143307
460 Ga0307412_10887530
461 Ga0307412_10972352
462 Ga0307412_11145547
463 Ga0307409_100017970
464 Ga0307409_100135509
465 Ga0307409_100290171
466 Ga0307409_100501724
467 Ga0307409_101385099
468 Ga0307416_100013122
469 Ga0307416_100023586
470 Ga0307416_100025286
471 Ga0307416_100146825
472 Ga0307416_100305256
473 Ga0307416_100400979
474 Ga0307416_100663274
475 Ga0307416_101127545
476 Ga0307414_10001774
477 Ga0307414_10006344
478 Ga0307414_10022848
479 Ga0307414_10027506
480 Ga0307414_10149378
481 Ga0307414_10280339
482 Ga0307414_10360803
483 Ga0307414_10441387
484 Ga0307414_10469466
485 Ga0307414_10477873
486 Ga0307414_10946897
487 Ga0307411_10005055
488 Ga0307411_10008335
489 Ga0307411_10025092
490 Ga0307411_10034343
491 Ga0307411_10044589
492 Ga0307411_10079950
493 Ga0307411_10247376
494 Ga0307411_10532550
495 Ga0307411_10627661
496 Ga0307411_10864140
497 Ga0307415_100002565
498 Ga0307415_100011506
499 Ga0307415_100017645
500 Ga0307415_100110075
501 Ga0307415_100118900
502 Ga0307415_100666811
503 Ga0307415_102101259
504 Ga0395899_0170437
505 Ga0395899_0293107
506 Ga0395900_0001678
507 Ga0395900_0066047
508 Ga0395900_0499274
509 Ga0395898_0406372
510 Ga0395898_1350178
511 Ga0395905_0000083
512 Ga0395905_0007011
513 Ga0395905_0031809
514 Ga0395905_0038262
515 Ga0395905_0061046
516 Ga0395905_0275001
517 Ga0395905_1144095
518 Ga0395901_0014876
519 Ga0395901_0303086
520 Ga0439437_048665
521 Ga0439445_0001650
522 Ga0439432_062407
523 Ga0439455_0093833
524 Ga0450914_004695
525 Ga0450892_016927
526 Ga0439458_0013953
527 Ga0439464_0037908
528 Ga0439464_0067765
529 Ga0466967_0240796
530 Ga0495584_0674336
531 Ga0495585_0396106
532 Ga0495585_0547214
533 Ga0495663_0034969
534 Ga0495625_0250788
535 Ga0495659_0138072
536 Ga0495669_0205540
537 Ga0495670_0784386
538 Ga0495636_0220312
539 Ga0496107_0081005
540 Ga0496112_0120801
541 Ga0496114_0000109
542 Ga0501235_016888
543 Ga0501259_104289
544 nmdc:mga00v17_359561_c1
545 nmdc:mga05p37_667292_c1
546 nmdc:mga09592_236255_c1
547 nmdc:mga09592_643478_c1
548 nmdc:mga08y16_223360_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7951 6 103
7jz6-assembly1.cif.gz_D the cryo-em structure of the catalase-peroxidase from escherichia coli 0.7678 53 86
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7654 7 110
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7341 7 110
4x7r-assembly1.cif.gz_A crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp 0.7067 56 88
ID Description Score Start End Superfamily
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8221 9 121 2.170.150.70
af_Q4DVG2_30_117_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8207 6 20 3.30.1310.10
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8179 7 116 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7997 9 119 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.783 8 102 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A7G9SEP6-F1-model_v4 GFA family protein 0.9618 7 119 GO:0016846
GO:0046872
AF-A0A7W0CVL9-F1-model_v4 GFA family protein 0.9595 18 119 GO:0016846
GO:0046872
AF-A0A6I4T1G7-F1-model_v4 Aldehyde-activating protein 0.9594 7 118 GO:0016846
GO:0046872
AF-A0A7G9SEP6-F1-model_v4 GFA family protein 0.9536 7 119 GO:0016846
GO:0046872
AF-A0A258FZC3-F1-model_v4 CENP-V/GFA domain-containing protein 0.9514 5 121 GO:0016846
GO:0046872

Map