F379836

General Info

Members Datasets Scaffolds Average Seq Length
274 134 272 356

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10001671|Ga0316575_100016713
Length 356
Sequence LSKKILILPGDGIGPEIVAEAVKVLACLRDDYGLDLDIYEALVGGAAHDTHGHPLPEETLRLAHECDAVLLGAVGGPKWEPLHISLRPEKGLLGLRSELGLFANLRPAILYQQLADASTLKTDVVAGLDILIVRELTGGIYFGQPRGVETLPSGERLVYTESEIERICRVAFDIARKRDSRVCSVDKANVLECTELWREVATRVGQDYPDVALSHMYVDNAAMQLVRAPKQFDVMVTTNMFGDILSDCAAMLTGSIGMLPSASLNAEEKGMYEPIHGSAPDIAGKGIANPLATILSVSMMLRYSLDAPEHAERIERAVSAVLDQGLRTADIASAGTETVGTARMGDAVVAAIRGGG

Samples

Sample ID Description Type Environment
1 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
2 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
81 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
82 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
83 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
100 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
101 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
102 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
103 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
104 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
130 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
131 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
133 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.32
Metatranscriptomes 10.95
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 0
Rhizoplane 1.46
Rhizosphere 82.85
Stem 0
Stem Tuber 0
Unclassified 10.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10055570 3300003322 Bacteria 3628
2 Ga0070670_100000004 3300005331 Bacteria 392110
3 Ga0070670_100004099 3300005331 Bacteria 12172
4 Ga0068869_100001687 3300005334 Bacteria 13186
5 Ga0070666_10175806 3300005335 Bacteria 1501
6 Ga0070668_100000598 3300005347 Bacteria 24180
7 Ga0070668_100001724 3300005347 Bacteria 15891
8 Ga0070668_100009890 3300005347 Bacteria 7064
9 Ga0070669_100049017 3300005353 Bacteria 3084
10 Ga0070674_100012709 3300005356 Bacteria 5177
11 Ga0070667_100000105 3300005367 Bacteria 106633
12 Ga0070667_100013717 3300005367 Bacteria 6697
13 Ga0070700_100107854 3300005441 Bacteria 1846
14 Ga0068867_100110917 3300005459 Bacteria 2108
15 Ga0068853_100001464 3300005539 Bacteria 17125
16 Ga0070672_100224102 3300005543 Bacteria 1578
17 Ga0070695_100083546 3300005545 Bacteria 2116
18 Ga0070665_100000784 3300005548 Bacteria 41804
19 Ga0068857_100011768 3300005577 Bacteria 7609
20 Ga0068852_100269598 3300005616 Bacteria 1638
21 Ga0068864_100000106 3300005618 Bacteria 81202
22 Ga0068864_100000965 3300005618 Bacteria 24138
23 Ga0068864_100002543 3300005618 Bacteria 15058
24 Ga0068864_100061790 3300005618 Bacteria 3244
25 Ga0068863_100000079 3300005841 Bacteria 107383
26 Ga0068863_100001463 3300005841 Bacteria 23428
27 Ga0068863_100009999 3300005841 Bacteria 9234
28 Ga0068858_100000006 3300005842 Bacteria 256011
29 Ga0068858_100008921 3300005842 Bacteria 9613
30 Ga0068858_100021158 3300005842 Bacteria 6074
31 Ga0068860_100000077 3300005843 Bacteria 171297
32 Ga0068860_100005662 3300005843 Bacteria 12618
33 Ga0068862_100000457 3300005844 Bacteria 44218
34 Ga0068862_100035794 3300005844 Bacteria 4207
35 Ga0075368_10032271 3300006042 Bacteria 2033
36 Ga0075367_10029598 3300006178 Bacteria 3134
37 Ga0075366_10028340 3300006195 Bacteria 3287
38 Ga0097621_100003209 3300006237 Bacteria 11233
39 Ga0075370_10014454 3300006353 Bacteria 4211
40 Ga0068871_100004593 3300006358 Bacteria 9631
41 Ga0075434_100115026 3300006871 Bacteria 2703
42 Ga0105245_10132628 3300009098 Bacteria 2338
43 Ga0105248_10002412 3300009177 Bacteria 20747
44 Ga0105248_10042535 3300009177 Bacteria 5095
45 Ga0157373_10006299 3300013100 Bacteria 8869
46 Ga0157370_10220023 3300013104 Bacteria 1759
47 Ga0157369_10311125 3300013105 Bacteria 1638
48 Ga0157378_10041480 3300013297 Bacteria 4082
49 Ga0157375_10036287 3300013308 Bacteria 4714
50 Ga0163163_10027372 3300014325 Bacteria 5460
51 Ga0163163_10243413 3300014325 Bacteria 1849
52 Ga0157379_10011876 3300014968 Bacteria 7609
53 Ga0157379_10016512 3300014968 Bacteria 6494
54 Ga0157379_10038936 3300014968 Bacteria 4241
55 Ga0213872_10000255 3300021361 Bacteria 46488
56 Ga0213872_10085761 3300021361 Bacteria 1411
57 Ga0207645_10116185 3300025907 Bacteria 1735
58 Ga0207695_10026563 3300025913 Bacteria 6462
59 Ga0207660_10163061 3300025917 Bacteria 1721
60 Ga0207681_10113552 3300025923 Bacteria 1975
61 Ga0207650_10000033 3300025925 Bacteria 226809
62 Ga0207650_10005813 3300025925 Bacteria 8417
63 Ga0207687_10177320 3300025927 Bacteria 1648
64 Ga0207690_10001874 3300025932 Bacteria 12896
65 Ga0207704_10035500 3300025938 Bacteria 2858
66 Ga0207691_10135758 3300025940 Bacteria 2169
67 Ga0207711_10007165 3300025941 Bacteria 9347
68 Ga0207711_10028100 3300025941 Bacteria 4730
69 Ga0207689_10000354 3300025942 Bacteria 42996
70 Ga0207679_10047112 3300025945 Bacteria 3130
71 Ga0207679_10177958 3300025945 Bacteria 1757
72 Ga0207667_10029046 3300025949 Bacteria 6001
73 Ga0207651_10003368 3300025960 Bacteria 7844
74 Ga0207712_10169883 3300025961 Bacteria 1703
75 Ga0207668_10000004 3300025972 Bacteria 201204
76 Ga0207668_10000703 3300025972 Bacteria 20500
77 Ga0207658_10000607 3300025986 Bacteria 31806
78 Ga0207658_10014187 3300025986 Bacteria 5457
79 Ga0207703_10001558 3300026035 Bacteria 20778
80 Ga0207703_10001666 3300026035 Bacteria 19971
81 Ga0207703_10010295 3300026035 Bacteria 7324
82 Ga0207703_10087658 3300026035 Bacteria 2610
83 Ga0207678_10272504 3300026067 Bacteria 1452
84 Ga0207708_10145105 3300026075 Bacteria 1864
85 Ga0207641_10000003 3300026088 Bacteria 496984
86 Ga0207641_10001940 3300026088 Bacteria 19858
87 Ga0207648_10182963 3300026089 Bacteria 1855
88 Ga0207676_10000084 3300026095 Bacteria 90543
89 Ga0207676_10000830 3300026095 Bacteria 24132
90 Ga0207676_10046808 3300026095 Bacteria 3349
91 Ga0207674_10019180 3300026116 Bacteria 7416
92 Ga0207675_100010505 3300026118 Bacteria 8675
93 Ga0268266_10002069 3300028379 Bacteria 22223
94 Ga0268265_10001071 3300028380 Bacteria 24378
95 Ga0268265_10025899 3300028380 Bacteria 4169
96 Ga0268264_10000032 3300028381 Bacteria 408337
97 Ga0268264_10002307 3300028381 Bacteria 16875
98 Ga0307517_10077474 3300028786 Bacteria 2888
99 Ga0265338_10016438 3300028800 Bacteria 8054
100 Ga0265340_10031426 3300031247 Bacteria 2655
101 Ga0265327_10002374 3300031251 Bacteria 20045
102 Ga0265316_10032119 3300031344 Bacteria 4287
103 Ga0316575_10001671 3300031665 Bacteria 7255
104 Ga0316575_10008971 3300031665 Bacteria 3653
105 Ga0316575_10014942 3300031665 Bacteria 2922
106 Ga0316575_10023231 3300031665 Bacteria 2396
107 Ga0316575_10065867 3300031665 Bacteria 1451
108 Ga0316579_10000074 3300031691 Bacteria 25074
109 Ga0316579_10001514 3300031691 Bacteria 8449
110 Ga0316579_10001869 3300031691 Bacteria 7807
111 Ga0316579_10003584 3300031691 Bacteria 6088
112 Ga0316579_10005872 3300031691 Bacteria 4977
113 Ga0265314_10023005 3300031711 Bacteria 4763
114 Ga0265314_10122684 3300031711 Bacteria 1633
115 Ga0316576_10000087 3300031727 Bacteria 32443
116 Ga0316576_10011865 3300031727 Bacteria 5732
117 Ga0316576_10011968 3300031727 Bacteria 5709
118 Ga0316576_10024710 3300031727 Bacteria 4197
119 Ga0316576_10025135 3300031727 Bacteria 4166
120 Ga0316576_10039469 3300031727 Bacteria 3389
121 Ga0316576_10060922 3300031727 Bacteria 2765
122 Ga0316576_10068695 3300031727 Bacteria 2611
123 Ga0316576_10121668 3300031727 Bacteria 1960
124 Ga0316576_10174544 3300031727 Bacteria 1622
125 Ga0316576_10186110 3300031727 Bacteria 1566
126 Ga0316578_10000713 3300031728 Bacteria 12038
127 Ga0316578_10005148 3300031728 Bacteria 6299
128 Ga0316578_10014985 3300031728 Bacteria 4157
129 Ga0316578_10041969 3300031728 Bacteria 2650
130 Ga0316578_10052117 3300031728 Bacteria 2397
131 Ga0316578_10059838 3300031728 Bacteria 2241
132 Ga0316577_10000133 3300031733 Bacteria 21962
133 Ga0316577_10005347 3300031733 Bacteria 6727
134 Ga0316577_10009713 3300031733 Bacteria 5179
135 Ga0316577_10065426 3300031733 Bacteria 2029
136 Ga0316583_10000574 3300032133 Bacteria 11174
137 Ga0316583_10006097 3300032133 Bacteria 4336
138 Ga0316583_10009256 3300032133 Bacteria 3550
139 Ga0316585_10000495 3300032137 Bacteria 9327
140 Ga0316585_10002613 3300032137 Bacteria 4877
141 Ga0316585_10003921 3300032137 Bacteria 4117
142 Ga0316580_10000107 3300032139 Bacteria 15287
143 Ga0316580_10007905 3300032139 Bacteria 3177
144 Ga0316580_10012290 3300032139 Bacteria 2607
145 Ga0316580_10038507 3300032139 Bacteria 1478
146 Ga0316580_10041748 3300032139 Bacteria 1416
147 Ga0316593_10000220 3300032168 Bacteria 9046
148 Ga0316593_10000225 3300032168 Bacteria 8998
149 Ga0316593_10000282 3300032168 Bacteria 8557
150 Ga0316593_10000549 3300032168 Bacteria 7015
151 Ga0316593_10001211 3300032168 Bacteria 5546
152 Ga0316593_10001350 3300032168 Bacteria 5358
153 Ga0316593_10002523 3300032168 Bacteria 4365
154 Ga0316593_10002539 3300032168 Bacteria 4355
155 Ga0316593_10008062 3300032168 Bacteria 2922
156 Ga0316593_10008832 3300032168 Bacteria 2826
157 Ga0316593_10018490 3300032168 Bacteria 2142
158 Ga0316592_1001708 3300033524 Bacteria 3638
159 Ga0316592_1009853 3300033524 Bacteria 1918
160 Ga0316586_1000087 3300033527 Bacteria 6641
161 Ga0316586_1000921 3300033527 Bacteria 3119
162 Ga0316586_1013471 3300033527 Bacteria 1280
163 Ga0316588_1000842 3300033528 Bacteria 4629
164 Ga0316588_1007656 3300033528 Bacteria 2199
165 Ga0316587_1000274 3300033529 Bacteria 4713
166 Ga0316587_1000488 3300033529 Bacteria 4022
167 Ga0316596_1001239 3300033541 Bacteria 5046
168 Ga0316596_1001404 3300033541 Bacteria 4841
169 Ga0316596_1001575 3300033541 Bacteria 4656
170 Ga0316596_1002799 3300033541 Bacteria 3767
171 Ga0316596_1002805 3300033541 Bacteria 3762
172 Ga0316596_1004314 3300033541 Bacteria 3182
173 Ga0316596_1004462 3300033541 Bacteria 3143
174 Ga0316596_1034251 3300033541 Bacteria 1326
175 Ga0316596_1035618 3300033541 Bacteria 1301
176 Ga0316596_1042767 3300033541 Bacteria 1192
177 Ga0316574_0003177 3300035398 Bacteria 8410
178 Ga0316574_0007008 3300035398 Bacteria 6142
179 Ga0316574_0014818 3300035398 Bacteria 4513
180 Ga0316574_0022183 3300035398 Bacteria 3779
181 Ga0316574_0036203 3300035398 Bacteria 3020
182 Ga0316574_0056359 3300035398 Bacteria 2458
183 Ga0316574_0114408 3300035398 Bacteria 1730
184 Ga0316582_0000848 3300036647 Bacteria 12445
185 Ga0316582_0008519 3300036647 Bacteria 5519
186 Ga0316582_0016932 3300036647 Bacteria 4204
187 Ga0316582_0018507 3300036647 Bacteria 4055
188 Ga0316582_0021751 3300036647 Bacteria 3796
189 Ga0316582_0034801 3300036647 Bacteria 3105
190 Ga0316582_0050116 3300036647 Bacteria 2643
191 Ga0316582_0098486 3300036647 Bacteria 1934
192 Ga0316584_0000524 3300036712 Bacteria 20424
193 Ga0316584_0002549 3300036712 Bacteria 11564
194 Ga0316584_0003592 3300036712 Bacteria 10131
195 Ga0316584_0020560 3300036712 Bacteria 4787
196 Ga0316584_0023983 3300036712 Bacteria 4460
197 Ga0316584_0036812 3300036712 Bacteria 3632
198 Ga0316584_0037737 3300036712 Bacteria 3591
199 Ga0316584_0051542 3300036712 Bacteria 3077
200 Ga0395899_0000190 3300037312 Bacteria 90356
201 Ga0395900_0000002 3300037418 Bacteria 671103
202 Ga0395900_0045719 3300037418 Bacteria 4509
203 Ga0395898_0053806 3300037466 Bacteria 3930
204 Ga0395898_0131939 3300037466 Bacteria 2392
205 Ga0395905_0008108 3300037471 Bacteria 10376
206 Ga0395905_0020588 3300037471 Bacteria 6246
207 Ga0316581_0002020 3300037588 Bacteria 4761
208 Ga0436364_0254948 3300037853 Bacteria 1143
209 Ga0395901_0000013 3300038443 Bacteria 375733
210 Ga0395901_0116010 3300038443 Bacteria 2813
211 Ga0400484_08605 3300038725 Bacteria 9704
212 Ga0400484_30885 3300038725 Bacteria 4265
213 Ga0400484_39316 3300038725 Bacteria 39081
214 Ga0400484_43922 3300038725 Bacteria 19793
215 Ga0400490_52669 3300038726 Bacteria 57174
216 Ga0400491_03802 3300038727 Bacteria 9394
217 Ga0400491_19509 3300038727 Bacteria 3551
218 Ga0400488_11709 3300038741 Bacteria 2745
219 Ga0400488_17990 3300038741 Bacteria 4160
220 Ga0400488_53715 3300038741 Bacteria 10433
221 Ga0400488_58485 3300038741 Bacteria 2815
222 Ga0400488_63364 3300038741 Bacteria 2781
223 Ga0400483_047511 3300039062 Bacteria 8737
224 Ga0400483_100739 3300039062 Bacteria 13980
225 Ga0400483_130807 3300039062 Bacteria 8278
226 Ga0400483_212840 3300039062 Bacteria 1537
227 Ga0400483_237044 3300039062 Bacteria 19668
228 Ga0400483_259285 3300039062 Bacteria 1060
229 Ga0400483_266345 3300039062 Bacteria 3151
230 Ga0400483_289224 3300039062 Bacteria 44357
231 Ga0400487_01301 3300039110 Bacteria 43520
232 Ga0400487_10987 3300039110 Bacteria 10109
233 Ga0400487_43990 3300039110 Bacteria 1630
234 Ga0400487_60213 3300039110 Bacteria 4341
235 Ga0436361_0241912 3300039447 Bacteria 7874
236 Ga0436361_0662680 3300039447 Bacteria 39242
237 Ga0466961_0001945 3300044693 Bacteria 12870
238 Ga0453684_0162692 3300044712 Bacteria 2638
239 Ga0466959_0027065 3300045049 Bacteria 4253
240 Ga0451576_0000929 3300045051 Bacteria 55238
241 Ga0451576_0272631 3300045051 Bacteria 1769
242 Ga0496102_0057120 3300048905 Bacteria 3562
243 Ga0496103_0019714 3300048906 Bacteria 4048
244 Ga0496103_0068738 3300048906 Bacteria 2214
245 Ga0496113_0067503 3300048916 Bacteria 2712
246 Ga0501033_0002370 3300049570 Bacteria 16053
247 Ga0501033_0092322 3300049570 Bacteria 2214
248 Ga0501034_0004671 3300049571 Bacteria 15164
249 Ga0501037_0009706 3300049573 Bacteria 7064
250 Ga0501038_0001732 3300049574 Bacteria 20307
251 Ga0501043_0004555 3300049579 Bacteria 11257
252 Ga0501047_0025099 3300049581 Bacteria 5725
253 Ga0501047_0483250 3300049581 Bacteria 1066
254 Ga0501073_0010392 3300049589 Bacteria 6828
255 Ga0501074_0010249 3300049590 Bacteria 6802
256 Ga0501080_0011081 3300049742 Bacteria 8250
257 Ga0501035_0003145 3300049822 Bacteria 15857
258 Ga0501044_0002284 3300049823 Bacteria 21834
259 Ga0501044_0005108 3300049823 Bacteria 14635
260 Ga0501044_0142063 3300049823 Bacteria 2389
261 nmdc:mga00v17_1583_c1 3300050491 Bacteria 11891
262 nmdc:mga0k408_24316_c1 3300050493 Bacteria 3423
263 nmdc:mga06z11_65147_c1 3300050494 Bacteria 1912
264 nmdc:mga07m45_3161_c1 3300050496 Bacteria 7901
265 nmdc:mga07m45_46719_c1 3300050496 Bacteria 2433
266 nmdc:mga0n895_243311_c1 3300050512 Bacteria 1826
267 nmdc:mga0sz30_19064_c1 3300050516 Bacteria 2751
268 Ga0500635_0000051 3300053080 Bacteria 76510
269 Ga0500603_009122 3300053150 Bacteria 2215
270 Ga0500636_0011772 3300053177 Bacteria 5122
271 Ga0500637_0003033 3300053178 Bacteria 7632
272 Ga0501082_0040616 3300060353 Bacteria 4012

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10175806 Ga0070666_101758062 338
2 3300006871 Ga0075434_100115026 Ga0075434_1001150264 338
3 3300009177 Ga0105248_10002412 Ga0105248_100024126 338
4 3300050512 nmdc:mga0n895_243311_c1 nmdc:mga0n895_243311_c1_484_1551 338
5 3300032168 Ga0316593_10000549 Ga0316593_100005493 340
6 3300039062 Ga0400483_259285 Ga0400483_259285_18_1043 340
7 3300049581 Ga0501047_0483250 Ga0501047_0483250_29_1054 340
8 3300031733 Ga0316577_10065426 Ga0316577_100654262 342
9 3300036647 Ga0316582_0016932 Ga0316582_0016932_633_1718 342
10 3300005331 Ga0070670_100000004 Ga0070670_10000000490 346
11 3300005347 Ga0070668_100000598 Ga0070668_10000059821 346
12 3300005347 Ga0070668_100009890 Ga0070668_1000098903 346
13 3300005367 Ga0070667_100000105 Ga0070667_10000010547 346
14 3300005548 Ga0070665_100000784 Ga0070665_1000007849 346
15 3300005616 Ga0068852_100269598 Ga0068852_1002695982 346
16 3300005618 Ga0068864_100000106 Ga0068864_10000010617 346
17 3300005618 Ga0068864_100000965 Ga0068864_10000096511 346
18 3300005618 Ga0068864_100061790 Ga0068864_1000617904 346
19 3300005841 Ga0068863_100000079 Ga0068863_10000007972 346
20 3300005841 Ga0068863_100001463 Ga0068863_10000146311 346
21 3300005842 Ga0068858_100000006 Ga0068858_10000000671 346
22 3300005842 Ga0068858_100008921 Ga0068858_1000089218 346
23 3300005843 Ga0068860_100000077 Ga0068860_10000007790 346
24 3300005844 Ga0068862_100000457 Ga0068862_10000045733 346
25 3300006042 Ga0075368_10032271 Ga0075368_100322712 346
26 3300006178 Ga0075367_10029598 Ga0075367_100295982 346
27 3300006195 Ga0075366_10028340 Ga0075366_100283403 346
28 3300006353 Ga0075370_10014454 Ga0075370_100144544 346
29 3300009177 Ga0105248_10042535 Ga0105248_100425354 346
30 3300013104 Ga0157370_10220023 Ga0157370_102200232 346
31 3300013105 Ga0157369_10311125 Ga0157369_103111252 346
32 3300014325 Ga0163163_10243413 Ga0163163_102434132 346
33 3300014968 Ga0157379_10038936 Ga0157379_100389364 346
34 3300025913 Ga0207695_10026563 Ga0207695_100265633 346
35 3300025917 Ga0207660_10163061 Ga0207660_101630612 346
36 3300025923 Ga0207681_10113552 Ga0207681_101135521 346
37 3300025925 Ga0207650_10000033 Ga0207650_10000033184 346
38 3300025941 Ga0207711_10007165 Ga0207711_100071654 346
39 3300025949 Ga0207667_10029046 Ga0207667_100290462 346
40 3300025972 Ga0207668_10000004 Ga0207668_10000004124 346
41 3300025972 Ga0207668_10000703 Ga0207668_1000070312 346
42 3300025986 Ga0207658_10000607 Ga0207658_1000060733 346
43 3300026035 Ga0207703_10001558 Ga0207703_1000155820 346
44 3300026035 Ga0207703_10001666 Ga0207703_1000166619 346
45 3300026088 Ga0207641_10000003 Ga0207641_10000003375 346
46 3300026088 Ga0207641_10001940 Ga0207641_1000194014 346
47 3300026095 Ga0207676_10000084 Ga0207676_1000008428 346
48 3300026095 Ga0207676_10000830 Ga0207676_1000083011 346
49 3300026095 Ga0207676_10046808 Ga0207676_100468083 346
50 3300028379 Ga0268266_10002069 Ga0268266_1000206914 346
51 3300028380 Ga0268265_10001071 Ga0268265_100010719 346
52 3300028381 Ga0268264_10000032 Ga0268264_10000032325 346
53 3300028786 Ga0307517_10077474 Ga0307517_100774744 346
54 3300032168 Ga0316593_10018490 Ga0316593_100184902 346
55 3300037312 Ga0395899_0000190 Ga0395899_0000190_22374_23426 346
56 3300037418 Ga0395900_0000002 Ga0395900_0000002_407582_408634 346
57 3300037418 Ga0395900_0045719 Ga0395900_0045719_2301_3353 346
58 3300037466 Ga0395898_0053806 Ga0395898_0053806_418_1470 346
59 3300037466 Ga0395898_0131939 Ga0395898_0131939_426_1478 346
60 3300037471 Ga0395905_0008108 Ga0395905_0008108_7167_8219 346
61 3300037471 Ga0395905_0020588 Ga0395905_0020588_2166_3218 346
62 3300037853 Ga0436364_0254948 Ga0436364_0254948_17_1069 346
63 3300038443 Ga0395901_0000013 Ga0395901_0000013_295151_296203 346
64 3300038443 Ga0395901_0116010 Ga0395901_0116010_1348_2400 346
65 3300048905 Ga0496102_0057120 Ga0496102_0057120_1390_2442 346
66 3300048906 Ga0496103_0068738 Ga0496103_0068738_1126_2178 346
67 3300049570 Ga0501033_0092322 Ga0501033_0092322_59_1111 346
68 3300049823 Ga0501044_0005108 Ga0501044_0005108_6495_7547 346
69 3300050491 nmdc:mga00v17_1583_c1 nmdc:mga00v17_1583_c1_5720_6772 346
70 3300050493 nmdc:mga0k408_24316_c1 nmdc:mga0k408_24316_c1_580_1632 346
71 3300050494 nmdc:mga06z11_65147_c1 nmdc:mga06z11_65147_c1_602_1654 346
72 3300050496 nmdc:mga07m45_3161_c1 nmdc:mga07m45_3161_c1_4240_5292 346
73 3300050496 nmdc:mga07m45_46719_c1 nmdc:mga07m45_46719_c1_1030_2082 346
74 3300050516 nmdc:mga0sz30_19064_c1 nmdc:mga0sz30_19064_c1_445_1497 346
75 3300053080 Ga0500635_0000051 Ga0500635_0000051_13754_14806 346
76 3300053150 Ga0500603_009122 Ga0500603_009122_588_1640 346
77 3300053177 Ga0500636_0011772 Ga0500636_0011772_1608_2660 346
78 3300053178 Ga0500637_0003033 Ga0500637_0003033_1562_2614 346
79 3300013100 Ga0157373_10006299 Ga0157373_100062994 347
80 3300025932 Ga0207690_10001874 Ga0207690_100018749 347
81 3300025945 Ga0207679_10177958 Ga0207679_101779581 347
82 3300031344 Ga0265316_10032119 Ga0265316_100321191 351
83 3300031665 Ga0316575_10001671 Ga0316575_100016713 351
84 3300031691 Ga0316579_10003584 Ga0316579_100035843 351
85 3300031727 Ga0316576_10011865 Ga0316576_100118653 351
86 3300031728 Ga0316578_10041969 Ga0316578_100419692 351
87 3300031733 Ga0316577_10009713 Ga0316577_100097131 351
88 3300032133 Ga0316583_10006097 Ga0316583_100060973 351
89 3300032137 Ga0316585_10003921 Ga0316585_100039213 351
90 3300032139 Ga0316580_10012290 Ga0316580_100122902 351
91 3300033524 Ga0316592_1001708 Ga0316592_10017082 351
92 3300033527 Ga0316586_1000087 Ga0316586_10000874 351
93 3300033528 Ga0316588_1000842 Ga0316588_10008422 351
94 3300033529 Ga0316587_1000274 Ga0316587_10002743 351
95 3300033541 Ga0316596_1002805 Ga0316596_10028053 351
96 3300033541 Ga0316596_1034251 Ga0316596_10342511 351
97 3300035398 Ga0316574_0007008 Ga0316574_0007008_2654_3739 351
98 3300035398 Ga0316574_0014818 Ga0316574_0014818_3445_4500 351
99 3300036647 Ga0316582_0050116 Ga0316582_0050116_578_1663 351
100 3300036712 Ga0316584_0020560 Ga0316584_0020560_585_1670 351
101 3300028800 Ga0265338_10016438 Ga0265338_100164388 352
102 3300031247 Ga0265340_10031426 Ga0265340_100314262 352
103 3300031251 Ga0265327_10002374 Ga0265327_1000237412 352
104 3300035398 Ga0316574_0003177 Ga0316574_0003177_6019_7080 352
105 3300049823 Ga0501044_0142063 Ga0501044_0142063_489_1562 352
106 3300021361 Ga0213872_10000255 Ga0213872_1000025527 354
107 3300021361 Ga0213872_10085761 Ga0213872_100857612 354
108 3300031727 Ga0316576_10011968 Ga0316576_100119683 354
109 3300031727 Ga0316576_10060922 Ga0316576_100609225 354
110 3300031733 Ga0316577_10000133 Ga0316577_1000013310 354
111 3300032139 Ga0316580_10041748 Ga0316580_100417482 354
112 3300032168 Ga0316593_10000220 Ga0316593_100002203 354
113 3300033541 Ga0316596_1042767 Ga0316596_10427671 354
114 3300035398 Ga0316574_0022183 Ga0316574_0022183_979_2049 354
115 3300035398 Ga0316574_0036203 Ga0316574_0036203_1415_2485 354
116 3300035398 Ga0316574_0114408 Ga0316574_0114408_80_1153 354
117 3300036647 Ga0316582_0034801 Ga0316582_0034801_1099_2175 354
118 3300036712 Ga0316584_0023983 Ga0316584_0023983_245_1318 354
119 3300036712 Ga0316584_0051542 Ga0316584_0051542_232_1308 354
120 3300038741 Ga0400488_11709 Ga0400488_11709_1331_2404 354
121 3300039062 Ga0400483_100739 Ga0400483_100739_3720_4793 354
122 3300039062 Ga0400483_130807 Ga0400483_130807_6620_7693 354
123 3300039062 Ga0400483_237044 Ga0400483_237044_15781_16854 354
124 3300039447 Ga0436361_0241912 Ga0436361_0241912_2151_3215 354
125 3300039447 Ga0436361_0662680 Ga0436361_0662680_11359_12423 354
126 iso_pu_bacteria 2894510363 2894511515 354
127 iso_pu_bacteria 2989392574 2989393255 354
128 3300031691 Ga0316579_10000074 Ga0316579_100000742 355
129 3300031711 Ga0265314_10122684 Ga0265314_101226842 355
130 3300031727 Ga0316576_10000087 Ga0316576_1000008724 355
131 3300031727 Ga0316576_10039469 Ga0316576_100394692 355
132 3300031733 Ga0316577_10005347 Ga0316577_100053472 355
133 3300032137 Ga0316585_10002613 Ga0316585_100026132 355
134 3300032139 Ga0316580_10000107 Ga0316580_1000010713 355
135 3300032168 Ga0316593_10001350 Ga0316593_100013503 355
136 3300032168 Ga0316593_10002523 Ga0316593_100025233 355
137 3300032168 Ga0316593_10002539 Ga0316593_100025392 355
138 3300033524 Ga0316592_1009853 Ga0316592_10098532 355
139 3300033541 Ga0316596_1001404 Ga0316596_10014042 355
140 3300033541 Ga0316596_1002799 Ga0316596_10027992 355
141 3300035398 Ga0316574_0056359 Ga0316574_0056359_27_1103 355
142 3300036647 Ga0316582_0021751 Ga0316582_0021751_51_1127 355
143 3300036647 Ga0316582_0098486 Ga0316582_0098486_812_1888 355
144 3300036712 Ga0316584_0000524 Ga0316584_0000524_17636_18712 355
145 3300036712 Ga0316584_0002549 Ga0316584_0002549_3512_4588 355
146 3300038725 Ga0400484_08605 Ga0400484_08605_5544_6620 355
147 3300038725 Ga0400484_39316 Ga0400484_39316_6123_7199 355
148 3300038725 Ga0400484_43922 Ga0400484_43922_9625_10701 355
149 3300038726 Ga0400490_52669 Ga0400490_52669_9698_10774 355
150 3300038727 Ga0400491_03802 Ga0400491_03802_6322_7398 355
151 3300038727 Ga0400491_19509 Ga0400491_19509_2156_3232 355
152 3300038741 Ga0400488_17990 Ga0400488_17990_2442_3518 355
153 3300038741 Ga0400488_53715 Ga0400488_53715_8988_10064 355
154 3300038741 Ga0400488_58485 Ga0400488_58485_1448_2524 355
155 3300038741 Ga0400488_63364 Ga0400488_63364_35_1111 355
156 3300039062 Ga0400483_047511 Ga0400483_047511_1996_3072 355
157 3300039062 Ga0400483_266345 Ga0400483_266345_438_1514 355
158 3300039062 Ga0400483_289224 Ga0400483_289224_28844_29920 355
159 3300039110 Ga0400487_10987 Ga0400487_10987_8262_9338 355
160 3300039110 Ga0400487_43990 Ga0400487_43990_442_1518 355
161 3300039110 Ga0400487_60213 Ga0400487_60213_3250_4326 355
162 3300049570 Ga0501033_0002370 Ga0501033_0002370_653_1729 355
163 3300049571 Ga0501034_0004671 Ga0501034_0004671_2022_3098 355
164 3300049573 Ga0501037_0009706 Ga0501037_0009706_4320_5396 355
165 3300049574 Ga0501038_0001732 Ga0501038_0001732_7617_8693 355
166 3300049579 Ga0501043_0004555 Ga0501043_0004555_15_1091 355
167 3300049581 Ga0501047_0025099 Ga0501047_0025099_1880_2956 355
168 3300049589 Ga0501073_0010392 Ga0501073_0010392_4390_5466 355
169 3300049590 Ga0501074_0010249 Ga0501074_0010249_3444_4520 355
170 3300049742 Ga0501080_0011081 Ga0501080_0011081_2784_3860 355
171 3300049822 Ga0501035_0003145 Ga0501035_0003145_9375_10451 355
172 3300049823 Ga0501044_0002284 Ga0501044_0002284_11245_12321 355
173 3300060353 Ga0501082_0040616 Ga0501082_0040616_1510_2586 355
174 3300003322 rootL2_10055570 rootL2_100555706 356
175 3300005331 Ga0070670_100004099 Ga0070670_1000040994 356
176 3300005334 Ga0068869_100001687 Ga0068869_1000016874 356
177 3300005347 Ga0070668_100001724 Ga0070668_10000172414 356
178 3300005353 Ga0070669_100049017 Ga0070669_1000490174 356
179 3300005356 Ga0070674_100012709 Ga0070674_1000127094 356
180 3300005367 Ga0070667_100013717 Ga0070667_1000137175 356
181 3300005441 Ga0070700_100107854 Ga0070700_1001078542 356
182 3300005459 Ga0068867_100110917 Ga0068867_1001109172 356
183 3300005539 Ga0068853_100001464 Ga0068853_1000014648 356
184 3300005543 Ga0070672_100224102 Ga0070672_1002241022 356
185 3300005545 Ga0070695_100083546 Ga0070695_1000835462 356
186 3300005577 Ga0068857_100011768 Ga0068857_1000117685 356
187 3300005618 Ga0068864_100002543 Ga0068864_10000254313 356
188 3300005841 Ga0068863_100009999 Ga0068863_1000099994 356
189 3300005842 Ga0068858_100021158 Ga0068858_1000211582 356
190 3300005843 Ga0068860_100005662 Ga0068860_1000056624 356
191 3300005844 Ga0068862_100035794 Ga0068862_1000357943 356
192 3300006237 Ga0097621_100003209 Ga0097621_1000032094 356
193 3300006358 Ga0068871_100004593 Ga0068871_1000045933 356
194 3300009098 Ga0105245_10132628 Ga0105245_101326281 356
195 3300013297 Ga0157378_10041480 Ga0157378_100414804 356
196 3300013308 Ga0157375_10036287 Ga0157375_100362875 356
197 3300014325 Ga0163163_10027372 Ga0163163_100273726 356
198 3300014968 Ga0157379_10011876 Ga0157379_100118767 356
199 3300014968 Ga0157379_10016512 Ga0157379_100165122 356
200 3300025907 Ga0207645_10116185 Ga0207645_101161852 356
201 3300025925 Ga0207650_10005813 Ga0207650_100058137 356
202 3300025927 Ga0207687_10177320 Ga0207687_101773201 356
203 3300025938 Ga0207704_10035500 Ga0207704_100355003 356
204 3300025940 Ga0207691_10135758 Ga0207691_101357582 356
205 3300025941 Ga0207711_10028100 Ga0207711_100281002 356
206 3300025942 Ga0207689_10000354 Ga0207689_100003544 356
207 3300025945 Ga0207679_10047112 Ga0207679_100471124 356
208 3300025960 Ga0207651_10003368 Ga0207651_100033686 356
209 3300025961 Ga0207712_10169883 Ga0207712_101698832 356
210 3300025986 Ga0207658_10014187 Ga0207658_100141873 356
211 3300026035 Ga0207703_10010295 Ga0207703_100102951 356
212 3300026035 Ga0207703_10087658 Ga0207703_100876582 356
213 3300026067 Ga0207678_10272504 Ga0207678_102725042 356
214 3300026075 Ga0207708_10145105 Ga0207708_101451052 356
215 3300026089 Ga0207648_10182963 Ga0207648_101829632 356
216 3300026116 Ga0207674_10019180 Ga0207674_100191804 356
217 3300026118 Ga0207675_100010505 Ga0207675_1000105053 356
218 3300028380 Ga0268265_10025899 Ga0268265_100258994 356
219 3300028381 Ga0268264_10002307 Ga0268264_1000230711 356
220 3300031665 Ga0316575_10008971 Ga0316575_100089712 356
221 3300031665 Ga0316575_10014942 Ga0316575_100149423 356
222 3300031665 Ga0316575_10023231 Ga0316575_100232312 356
223 3300031665 Ga0316575_10065867 Ga0316575_100658672 356
224 3300031691 Ga0316579_10001514 Ga0316579_100015144 356
225 3300031691 Ga0316579_10001869 Ga0316579_100018693 356
226 3300031691 Ga0316579_10005872 Ga0316579_100058725 356
227 3300031711 Ga0265314_10023005 Ga0265314_100230052 356
228 3300031727 Ga0316576_10024710 Ga0316576_100247102 356
229 3300031727 Ga0316576_10025135 Ga0316576_100251353 356
230 3300031727 Ga0316576_10068695 Ga0316576_100686953 356
231 3300031727 Ga0316576_10121668 Ga0316576_101216682 356
232 3300031727 Ga0316576_10174544 Ga0316576_101745442 356
233 3300031727 Ga0316576_10186110 Ga0316576_101861101 356
234 3300031728 Ga0316578_10000713 Ga0316578_100007136 356
235 3300031728 Ga0316578_10005148 Ga0316578_100051483 356
236 3300031728 Ga0316578_10014985 Ga0316578_100149852 356
237 3300031728 Ga0316578_10052117 Ga0316578_100521171 356
238 3300031728 Ga0316578_10059838 Ga0316578_100598382 356
239 3300032133 Ga0316583_10000574 Ga0316583_100005743 356
240 3300032133 Ga0316583_10009256 Ga0316583_100092562 356
241 3300032137 Ga0316585_10000495 Ga0316585_100004953 356
242 3300032139 Ga0316580_10007905 Ga0316580_100079053 356
243 3300032139 Ga0316580_10038507 Ga0316580_100385072 356
244 3300032168 Ga0316593_10000225 Ga0316593_100002253 356
245 3300032168 Ga0316593_10000282 Ga0316593_100002823 356
246 3300032168 Ga0316593_10001211 Ga0316593_100012113 356
247 3300032168 Ga0316593_10008062 Ga0316593_100080622 356
248 3300032168 Ga0316593_10008832 Ga0316593_100088322 356
249 3300033527 Ga0316586_1000921 Ga0316586_10009213 356
250 3300033527 Ga0316586_1013471 Ga0316586_10134711 356
251 3300033528 Ga0316588_1007656 Ga0316588_10076562 356
252 3300033529 Ga0316587_1000488 Ga0316587_10004883 356
253 3300033541 Ga0316596_1001239 Ga0316596_10012393 356
254 3300033541 Ga0316596_1001575 Ga0316596_10015752 356
255 3300033541 Ga0316596_1004314 Ga0316596_10043143 356
256 3300033541 Ga0316596_1004462 Ga0316596_10044621 356
257 3300033541 Ga0316596_1035618 Ga0316596_10356181 356
258 3300036647 Ga0316582_0000848 Ga0316582_0000848_9066_10145 356
259 3300036647 Ga0316582_0008519 Ga0316582_0008519_521_1609 356
260 3300036647 Ga0316582_0018507 Ga0316582_0018507_2879_3961 356
261 3300036712 Ga0316584_0003592 Ga0316584_0003592_8837_9916 356
262 3300036712 Ga0316584_0036812 Ga0316584_0036812_560_1639 356
263 3300036712 Ga0316584_0037737 Ga0316584_0037737_2067_3146 356
264 3300037588 Ga0316581_0002020 Ga0316581_0002020_1714_2793 356
265 3300038725 Ga0400484_30885 Ga0400484_30885_972_2051 356
266 3300039062 Ga0400483_212840 Ga0400483_212840_170_1249 356
267 3300039110 Ga0400487_01301 Ga0400487_01301_12000_13079 356
268 3300044693 Ga0466961_0001945 Ga0466961_0001945_553_1623 356
269 3300044712 Ga0453684_0162692 Ga0453684_0162692_888_1976 356
270 3300045049 Ga0466959_0027065 Ga0466959_0027065_593_1663 356
271 3300045051 Ga0451576_0000929 Ga0451576_0000929_5413_6504 356
272 3300045051 Ga0451576_0272631 Ga0451576_0272631_359_1429 356
273 3300048906 Ga0496103_0019714 Ga0496103_0019714_2431_3504 356
274 3300048916 Ga0496113_0067503 Ga0496113_0067503_468_1541 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

4

348

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j34-assembly2.cif.gz_D isopropylmalate dehydrogenase k232m mutant 0.9756 2 356
3r8w-assembly2.cif.gz_D structure of 3-isopropylmalate dehydrogenase isoform 2 from arabidopsis thaliana at 2.2 angstrom resolution 0.9725 2 354
1gc8-assembly1.cif.gz_B the crystal structure of thermus thermophilus 3-isopropylmalate dehydrogenase mutated at 172th from ala to phe 0.9702 1 354
5j34-assembly2.cif.gz_D isopropylmalate dehydrogenase k232m mutant 0.9702 2 356
1dr0-assembly1.cif.gz_B structure of modified 3-isopropylmalate dehydrogenase at the c-terminus, hd708 0.9699 1 356
ID Description Score Start End Superfamily
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9369 1 355 3.40.718.10
1x0lB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9207 2 355 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.914 2 353 3.40.718.10
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9139 1 355 3.40.718.10
1x0lB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9071 2 355 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A3M2U952-F1-model_v4 Isopropylmalate dehydrogenase-like domain-containing protein 0.9981 262 355 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-A0A351KSQ8-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9911 247 356 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-K1TTI4-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9898 158 353 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287
AF-A0A352SCX0-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) 0.9893 188 353 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287
AF-A0A7C3GWX1-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) 0.9876 233 355 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287

Feature Viewer

pLDDT pTM Quality
93.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map