F379836
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 134 | 272 | 356 |
Family's Representative Sequence
| Representative Sequence | 3300031665|Ga0316575_10001671|Ga0316575_100016713 |
| Length | 356 |
| Sequence | LSKKILILPGDGIGPEIVAEAVKVLACLRDDYGLDLDIYEALVGGAAHDTHGHPLPEETLRLAHECDAVLLGAVGGPKWEPLHISLRPEKGLLGLRSELGLFANLRPAILYQQLADASTLKTDVVAGLDILIVRELTGGIYFGQPRGVETLPSGERLVYTESEIERICRVAFDIARKRDSRVCSVDKANVLECTELWREVATRVGQDYPDVALSHMYVDNAAMQLVRAPKQFDVMVTTNMFGDILSDCAAMLTGSIGMLPSASLNAEEKGMYEPIHGSAPDIAGKGIANPLATILSVSMMLRYSLDAPEHAERIERAVSAVLDQGLRTADIASAGTETVGTARMGDAVVAAIRGGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 2 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 14 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 19 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 20 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 21 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 25 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 26 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 27 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 29 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 30 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 41 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 70 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 71 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 72 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 73 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 75 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 76 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 78 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 79 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 80 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 81 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 82 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 83 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 90 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 91 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 92 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 93 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 94 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 95 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 96 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 97 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 100 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 101 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 102 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 103 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 104 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 105 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 106 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 107 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 108 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 109 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 110 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 111 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 112 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 113 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 125 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 126 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 127 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 128 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 130 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 131 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 132 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 133 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 134 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.32 |
| Metatranscriptomes | 10.95 |
| Isolates | 0.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.11 |
| Nodule | 0 |
| Rhizoplane | 1.46 |
| Rhizosphere | 82.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10055570 | 3300003322 | Bacteria | 3628 |
| 2 | Ga0070670_100000004 | 3300005331 | Bacteria | 392110 |
| 3 | Ga0070670_100004099 | 3300005331 | Bacteria | 12172 |
| 4 | Ga0068869_100001687 | 3300005334 | Bacteria | 13186 |
| 5 | Ga0070666_10175806 | 3300005335 | Bacteria | 1501 |
| 6 | Ga0070668_100000598 | 3300005347 | Bacteria | 24180 |
| 7 | Ga0070668_100001724 | 3300005347 | Bacteria | 15891 |
| 8 | Ga0070668_100009890 | 3300005347 | Bacteria | 7064 |
| 9 | Ga0070669_100049017 | 3300005353 | Bacteria | 3084 |
| 10 | Ga0070674_100012709 | 3300005356 | Bacteria | 5177 |
| 11 | Ga0070667_100000105 | 3300005367 | Bacteria | 106633 |
| 12 | Ga0070667_100013717 | 3300005367 | Bacteria | 6697 |
| 13 | Ga0070700_100107854 | 3300005441 | Bacteria | 1846 |
| 14 | Ga0068867_100110917 | 3300005459 | Bacteria | 2108 |
| 15 | Ga0068853_100001464 | 3300005539 | Bacteria | 17125 |
| 16 | Ga0070672_100224102 | 3300005543 | Bacteria | 1578 |
| 17 | Ga0070695_100083546 | 3300005545 | Bacteria | 2116 |
| 18 | Ga0070665_100000784 | 3300005548 | Bacteria | 41804 |
| 19 | Ga0068857_100011768 | 3300005577 | Bacteria | 7609 |
| 20 | Ga0068852_100269598 | 3300005616 | Bacteria | 1638 |
| 21 | Ga0068864_100000106 | 3300005618 | Bacteria | 81202 |
| 22 | Ga0068864_100000965 | 3300005618 | Bacteria | 24138 |
| 23 | Ga0068864_100002543 | 3300005618 | Bacteria | 15058 |
| 24 | Ga0068864_100061790 | 3300005618 | Bacteria | 3244 |
| 25 | Ga0068863_100000079 | 3300005841 | Bacteria | 107383 |
| 26 | Ga0068863_100001463 | 3300005841 | Bacteria | 23428 |
| 27 | Ga0068863_100009999 | 3300005841 | Bacteria | 9234 |
| 28 | Ga0068858_100000006 | 3300005842 | Bacteria | 256011 |
| 29 | Ga0068858_100008921 | 3300005842 | Bacteria | 9613 |
| 30 | Ga0068858_100021158 | 3300005842 | Bacteria | 6074 |
| 31 | Ga0068860_100000077 | 3300005843 | Bacteria | 171297 |
| 32 | Ga0068860_100005662 | 3300005843 | Bacteria | 12618 |
| 33 | Ga0068862_100000457 | 3300005844 | Bacteria | 44218 |
| 34 | Ga0068862_100035794 | 3300005844 | Bacteria | 4207 |
| 35 | Ga0075368_10032271 | 3300006042 | Bacteria | 2033 |
| 36 | Ga0075367_10029598 | 3300006178 | Bacteria | 3134 |
| 37 | Ga0075366_10028340 | 3300006195 | Bacteria | 3287 |
| 38 | Ga0097621_100003209 | 3300006237 | Bacteria | 11233 |
| 39 | Ga0075370_10014454 | 3300006353 | Bacteria | 4211 |
| 40 | Ga0068871_100004593 | 3300006358 | Bacteria | 9631 |
| 41 | Ga0075434_100115026 | 3300006871 | Bacteria | 2703 |
| 42 | Ga0105245_10132628 | 3300009098 | Bacteria | 2338 |
| 43 | Ga0105248_10002412 | 3300009177 | Bacteria | 20747 |
| 44 | Ga0105248_10042535 | 3300009177 | Bacteria | 5095 |
| 45 | Ga0157373_10006299 | 3300013100 | Bacteria | 8869 |
| 46 | Ga0157370_10220023 | 3300013104 | Bacteria | 1759 |
| 47 | Ga0157369_10311125 | 3300013105 | Bacteria | 1638 |
| 48 | Ga0157378_10041480 | 3300013297 | Bacteria | 4082 |
| 49 | Ga0157375_10036287 | 3300013308 | Bacteria | 4714 |
| 50 | Ga0163163_10027372 | 3300014325 | Bacteria | 5460 |
| 51 | Ga0163163_10243413 | 3300014325 | Bacteria | 1849 |
| 52 | Ga0157379_10011876 | 3300014968 | Bacteria | 7609 |
| 53 | Ga0157379_10016512 | 3300014968 | Bacteria | 6494 |
| 54 | Ga0157379_10038936 | 3300014968 | Bacteria | 4241 |
| 55 | Ga0213872_10000255 | 3300021361 | Bacteria | 46488 |
| 56 | Ga0213872_10085761 | 3300021361 | Bacteria | 1411 |
| 57 | Ga0207645_10116185 | 3300025907 | Bacteria | 1735 |
| 58 | Ga0207695_10026563 | 3300025913 | Bacteria | 6462 |
| 59 | Ga0207660_10163061 | 3300025917 | Bacteria | 1721 |
| 60 | Ga0207681_10113552 | 3300025923 | Bacteria | 1975 |
| 61 | Ga0207650_10000033 | 3300025925 | Bacteria | 226809 |
| 62 | Ga0207650_10005813 | 3300025925 | Bacteria | 8417 |
| 63 | Ga0207687_10177320 | 3300025927 | Bacteria | 1648 |
| 64 | Ga0207690_10001874 | 3300025932 | Bacteria | 12896 |
| 65 | Ga0207704_10035500 | 3300025938 | Bacteria | 2858 |
| 66 | Ga0207691_10135758 | 3300025940 | Bacteria | 2169 |
| 67 | Ga0207711_10007165 | 3300025941 | Bacteria | 9347 |
| 68 | Ga0207711_10028100 | 3300025941 | Bacteria | 4730 |
| 69 | Ga0207689_10000354 | 3300025942 | Bacteria | 42996 |
| 70 | Ga0207679_10047112 | 3300025945 | Bacteria | 3130 |
| 71 | Ga0207679_10177958 | 3300025945 | Bacteria | 1757 |
| 72 | Ga0207667_10029046 | 3300025949 | Bacteria | 6001 |
| 73 | Ga0207651_10003368 | 3300025960 | Bacteria | 7844 |
| 74 | Ga0207712_10169883 | 3300025961 | Bacteria | 1703 |
| 75 | Ga0207668_10000004 | 3300025972 | Bacteria | 201204 |
| 76 | Ga0207668_10000703 | 3300025972 | Bacteria | 20500 |
| 77 | Ga0207658_10000607 | 3300025986 | Bacteria | 31806 |
| 78 | Ga0207658_10014187 | 3300025986 | Bacteria | 5457 |
| 79 | Ga0207703_10001558 | 3300026035 | Bacteria | 20778 |
| 80 | Ga0207703_10001666 | 3300026035 | Bacteria | 19971 |
| 81 | Ga0207703_10010295 | 3300026035 | Bacteria | 7324 |
| 82 | Ga0207703_10087658 | 3300026035 | Bacteria | 2610 |
| 83 | Ga0207678_10272504 | 3300026067 | Bacteria | 1452 |
| 84 | Ga0207708_10145105 | 3300026075 | Bacteria | 1864 |
| 85 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 86 | Ga0207641_10001940 | 3300026088 | Bacteria | 19858 |
| 87 | Ga0207648_10182963 | 3300026089 | Bacteria | 1855 |
| 88 | Ga0207676_10000084 | 3300026095 | Bacteria | 90543 |
| 89 | Ga0207676_10000830 | 3300026095 | Bacteria | 24132 |
| 90 | Ga0207676_10046808 | 3300026095 | Bacteria | 3349 |
| 91 | Ga0207674_10019180 | 3300026116 | Bacteria | 7416 |
| 92 | Ga0207675_100010505 | 3300026118 | Bacteria | 8675 |
| 93 | Ga0268266_10002069 | 3300028379 | Bacteria | 22223 |
| 94 | Ga0268265_10001071 | 3300028380 | Bacteria | 24378 |
| 95 | Ga0268265_10025899 | 3300028380 | Bacteria | 4169 |
| 96 | Ga0268264_10000032 | 3300028381 | Bacteria | 408337 |
| 97 | Ga0268264_10002307 | 3300028381 | Bacteria | 16875 |
| 98 | Ga0307517_10077474 | 3300028786 | Bacteria | 2888 |
| 99 | Ga0265338_10016438 | 3300028800 | Bacteria | 8054 |
| 100 | Ga0265340_10031426 | 3300031247 | Bacteria | 2655 |
| 101 | Ga0265327_10002374 | 3300031251 | Bacteria | 20045 |
| 102 | Ga0265316_10032119 | 3300031344 | Bacteria | 4287 |
| 103 | Ga0316575_10001671 | 3300031665 | Bacteria | 7255 |
| 104 | Ga0316575_10008971 | 3300031665 | Bacteria | 3653 |
| 105 | Ga0316575_10014942 | 3300031665 | Bacteria | 2922 |
| 106 | Ga0316575_10023231 | 3300031665 | Bacteria | 2396 |
| 107 | Ga0316575_10065867 | 3300031665 | Bacteria | 1451 |
| 108 | Ga0316579_10000074 | 3300031691 | Bacteria | 25074 |
| 109 | Ga0316579_10001514 | 3300031691 | Bacteria | 8449 |
| 110 | Ga0316579_10001869 | 3300031691 | Bacteria | 7807 |
| 111 | Ga0316579_10003584 | 3300031691 | Bacteria | 6088 |
| 112 | Ga0316579_10005872 | 3300031691 | Bacteria | 4977 |
| 113 | Ga0265314_10023005 | 3300031711 | Bacteria | 4763 |
| 114 | Ga0265314_10122684 | 3300031711 | Bacteria | 1633 |
| 115 | Ga0316576_10000087 | 3300031727 | Bacteria | 32443 |
| 116 | Ga0316576_10011865 | 3300031727 | Bacteria | 5732 |
| 117 | Ga0316576_10011968 | 3300031727 | Bacteria | 5709 |
| 118 | Ga0316576_10024710 | 3300031727 | Bacteria | 4197 |
| 119 | Ga0316576_10025135 | 3300031727 | Bacteria | 4166 |
| 120 | Ga0316576_10039469 | 3300031727 | Bacteria | 3389 |
| 121 | Ga0316576_10060922 | 3300031727 | Bacteria | 2765 |
| 122 | Ga0316576_10068695 | 3300031727 | Bacteria | 2611 |
| 123 | Ga0316576_10121668 | 3300031727 | Bacteria | 1960 |
| 124 | Ga0316576_10174544 | 3300031727 | Bacteria | 1622 |
| 125 | Ga0316576_10186110 | 3300031727 | Bacteria | 1566 |
| 126 | Ga0316578_10000713 | 3300031728 | Bacteria | 12038 |
| 127 | Ga0316578_10005148 | 3300031728 | Bacteria | 6299 |
| 128 | Ga0316578_10014985 | 3300031728 | Bacteria | 4157 |
| 129 | Ga0316578_10041969 | 3300031728 | Bacteria | 2650 |
| 130 | Ga0316578_10052117 | 3300031728 | Bacteria | 2397 |
| 131 | Ga0316578_10059838 | 3300031728 | Bacteria | 2241 |
| 132 | Ga0316577_10000133 | 3300031733 | Bacteria | 21962 |
| 133 | Ga0316577_10005347 | 3300031733 | Bacteria | 6727 |
| 134 | Ga0316577_10009713 | 3300031733 | Bacteria | 5179 |
| 135 | Ga0316577_10065426 | 3300031733 | Bacteria | 2029 |
| 136 | Ga0316583_10000574 | 3300032133 | Bacteria | 11174 |
| 137 | Ga0316583_10006097 | 3300032133 | Bacteria | 4336 |
| 138 | Ga0316583_10009256 | 3300032133 | Bacteria | 3550 |
| 139 | Ga0316585_10000495 | 3300032137 | Bacteria | 9327 |
| 140 | Ga0316585_10002613 | 3300032137 | Bacteria | 4877 |
| 141 | Ga0316585_10003921 | 3300032137 | Bacteria | 4117 |
| 142 | Ga0316580_10000107 | 3300032139 | Bacteria | 15287 |
| 143 | Ga0316580_10007905 | 3300032139 | Bacteria | 3177 |
| 144 | Ga0316580_10012290 | 3300032139 | Bacteria | 2607 |
| 145 | Ga0316580_10038507 | 3300032139 | Bacteria | 1478 |
| 146 | Ga0316580_10041748 | 3300032139 | Bacteria | 1416 |
| 147 | Ga0316593_10000220 | 3300032168 | Bacteria | 9046 |
| 148 | Ga0316593_10000225 | 3300032168 | Bacteria | 8998 |
| 149 | Ga0316593_10000282 | 3300032168 | Bacteria | 8557 |
| 150 | Ga0316593_10000549 | 3300032168 | Bacteria | 7015 |
| 151 | Ga0316593_10001211 | 3300032168 | Bacteria | 5546 |
| 152 | Ga0316593_10001350 | 3300032168 | Bacteria | 5358 |
| 153 | Ga0316593_10002523 | 3300032168 | Bacteria | 4365 |
| 154 | Ga0316593_10002539 | 3300032168 | Bacteria | 4355 |
| 155 | Ga0316593_10008062 | 3300032168 | Bacteria | 2922 |
| 156 | Ga0316593_10008832 | 3300032168 | Bacteria | 2826 |
| 157 | Ga0316593_10018490 | 3300032168 | Bacteria | 2142 |
| 158 | Ga0316592_1001708 | 3300033524 | Bacteria | 3638 |
| 159 | Ga0316592_1009853 | 3300033524 | Bacteria | 1918 |
| 160 | Ga0316586_1000087 | 3300033527 | Bacteria | 6641 |
| 161 | Ga0316586_1000921 | 3300033527 | Bacteria | 3119 |
| 162 | Ga0316586_1013471 | 3300033527 | Bacteria | 1280 |
| 163 | Ga0316588_1000842 | 3300033528 | Bacteria | 4629 |
| 164 | Ga0316588_1007656 | 3300033528 | Bacteria | 2199 |
| 165 | Ga0316587_1000274 | 3300033529 | Bacteria | 4713 |
| 166 | Ga0316587_1000488 | 3300033529 | Bacteria | 4022 |
| 167 | Ga0316596_1001239 | 3300033541 | Bacteria | 5046 |
| 168 | Ga0316596_1001404 | 3300033541 | Bacteria | 4841 |
| 169 | Ga0316596_1001575 | 3300033541 | Bacteria | 4656 |
| 170 | Ga0316596_1002799 | 3300033541 | Bacteria | 3767 |
| 171 | Ga0316596_1002805 | 3300033541 | Bacteria | 3762 |
| 172 | Ga0316596_1004314 | 3300033541 | Bacteria | 3182 |
| 173 | Ga0316596_1004462 | 3300033541 | Bacteria | 3143 |
| 174 | Ga0316596_1034251 | 3300033541 | Bacteria | 1326 |
| 175 | Ga0316596_1035618 | 3300033541 | Bacteria | 1301 |
| 176 | Ga0316596_1042767 | 3300033541 | Bacteria | 1192 |
| 177 | Ga0316574_0003177 | 3300035398 | Bacteria | 8410 |
| 178 | Ga0316574_0007008 | 3300035398 | Bacteria | 6142 |
| 179 | Ga0316574_0014818 | 3300035398 | Bacteria | 4513 |
| 180 | Ga0316574_0022183 | 3300035398 | Bacteria | 3779 |
| 181 | Ga0316574_0036203 | 3300035398 | Bacteria | 3020 |
| 182 | Ga0316574_0056359 | 3300035398 | Bacteria | 2458 |
| 183 | Ga0316574_0114408 | 3300035398 | Bacteria | 1730 |
| 184 | Ga0316582_0000848 | 3300036647 | Bacteria | 12445 |
| 185 | Ga0316582_0008519 | 3300036647 | Bacteria | 5519 |
| 186 | Ga0316582_0016932 | 3300036647 | Bacteria | 4204 |
| 187 | Ga0316582_0018507 | 3300036647 | Bacteria | 4055 |
| 188 | Ga0316582_0021751 | 3300036647 | Bacteria | 3796 |
| 189 | Ga0316582_0034801 | 3300036647 | Bacteria | 3105 |
| 190 | Ga0316582_0050116 | 3300036647 | Bacteria | 2643 |
| 191 | Ga0316582_0098486 | 3300036647 | Bacteria | 1934 |
| 192 | Ga0316584_0000524 | 3300036712 | Bacteria | 20424 |
| 193 | Ga0316584_0002549 | 3300036712 | Bacteria | 11564 |
| 194 | Ga0316584_0003592 | 3300036712 | Bacteria | 10131 |
| 195 | Ga0316584_0020560 | 3300036712 | Bacteria | 4787 |
| 196 | Ga0316584_0023983 | 3300036712 | Bacteria | 4460 |
| 197 | Ga0316584_0036812 | 3300036712 | Bacteria | 3632 |
| 198 | Ga0316584_0037737 | 3300036712 | Bacteria | 3591 |
| 199 | Ga0316584_0051542 | 3300036712 | Bacteria | 3077 |
| 200 | Ga0395899_0000190 | 3300037312 | Bacteria | 90356 |
| 201 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 202 | Ga0395900_0045719 | 3300037418 | Bacteria | 4509 |
| 203 | Ga0395898_0053806 | 3300037466 | Bacteria | 3930 |
| 204 | Ga0395898_0131939 | 3300037466 | Bacteria | 2392 |
| 205 | Ga0395905_0008108 | 3300037471 | Bacteria | 10376 |
| 206 | Ga0395905_0020588 | 3300037471 | Bacteria | 6246 |
| 207 | Ga0316581_0002020 | 3300037588 | Bacteria | 4761 |
| 208 | Ga0436364_0254948 | 3300037853 | Bacteria | 1143 |
| 209 | Ga0395901_0000013 | 3300038443 | Bacteria | 375733 |
| 210 | Ga0395901_0116010 | 3300038443 | Bacteria | 2813 |
| 211 | Ga0400484_08605 | 3300038725 | Bacteria | 9704 |
| 212 | Ga0400484_30885 | 3300038725 | Bacteria | 4265 |
| 213 | Ga0400484_39316 | 3300038725 | Bacteria | 39081 |
| 214 | Ga0400484_43922 | 3300038725 | Bacteria | 19793 |
| 215 | Ga0400490_52669 | 3300038726 | Bacteria | 57174 |
| 216 | Ga0400491_03802 | 3300038727 | Bacteria | 9394 |
| 217 | Ga0400491_19509 | 3300038727 | Bacteria | 3551 |
| 218 | Ga0400488_11709 | 3300038741 | Bacteria | 2745 |
| 219 | Ga0400488_17990 | 3300038741 | Bacteria | 4160 |
| 220 | Ga0400488_53715 | 3300038741 | Bacteria | 10433 |
| 221 | Ga0400488_58485 | 3300038741 | Bacteria | 2815 |
| 222 | Ga0400488_63364 | 3300038741 | Bacteria | 2781 |
| 223 | Ga0400483_047511 | 3300039062 | Bacteria | 8737 |
| 224 | Ga0400483_100739 | 3300039062 | Bacteria | 13980 |
| 225 | Ga0400483_130807 | 3300039062 | Bacteria | 8278 |
| 226 | Ga0400483_212840 | 3300039062 | Bacteria | 1537 |
| 227 | Ga0400483_237044 | 3300039062 | Bacteria | 19668 |
| 228 | Ga0400483_259285 | 3300039062 | Bacteria | 1060 |
| 229 | Ga0400483_266345 | 3300039062 | Bacteria | 3151 |
| 230 | Ga0400483_289224 | 3300039062 | Bacteria | 44357 |
| 231 | Ga0400487_01301 | 3300039110 | Bacteria | 43520 |
| 232 | Ga0400487_10987 | 3300039110 | Bacteria | 10109 |
| 233 | Ga0400487_43990 | 3300039110 | Bacteria | 1630 |
| 234 | Ga0400487_60213 | 3300039110 | Bacteria | 4341 |
| 235 | Ga0436361_0241912 | 3300039447 | Bacteria | 7874 |
| 236 | Ga0436361_0662680 | 3300039447 | Bacteria | 39242 |
| 237 | Ga0466961_0001945 | 3300044693 | Bacteria | 12870 |
| 238 | Ga0453684_0162692 | 3300044712 | Bacteria | 2638 |
| 239 | Ga0466959_0027065 | 3300045049 | Bacteria | 4253 |
| 240 | Ga0451576_0000929 | 3300045051 | Bacteria | 55238 |
| 241 | Ga0451576_0272631 | 3300045051 | Bacteria | 1769 |
| 242 | Ga0496102_0057120 | 3300048905 | Bacteria | 3562 |
| 243 | Ga0496103_0019714 | 3300048906 | Bacteria | 4048 |
| 244 | Ga0496103_0068738 | 3300048906 | Bacteria | 2214 |
| 245 | Ga0496113_0067503 | 3300048916 | Bacteria | 2712 |
| 246 | Ga0501033_0002370 | 3300049570 | Bacteria | 16053 |
| 247 | Ga0501033_0092322 | 3300049570 | Bacteria | 2214 |
| 248 | Ga0501034_0004671 | 3300049571 | Bacteria | 15164 |
| 249 | Ga0501037_0009706 | 3300049573 | Bacteria | 7064 |
| 250 | Ga0501038_0001732 | 3300049574 | Bacteria | 20307 |
| 251 | Ga0501043_0004555 | 3300049579 | Bacteria | 11257 |
| 252 | Ga0501047_0025099 | 3300049581 | Bacteria | 5725 |
| 253 | Ga0501047_0483250 | 3300049581 | Bacteria | 1066 |
| 254 | Ga0501073_0010392 | 3300049589 | Bacteria | 6828 |
| 255 | Ga0501074_0010249 | 3300049590 | Bacteria | 6802 |
| 256 | Ga0501080_0011081 | 3300049742 | Bacteria | 8250 |
| 257 | Ga0501035_0003145 | 3300049822 | Bacteria | 15857 |
| 258 | Ga0501044_0002284 | 3300049823 | Bacteria | 21834 |
| 259 | Ga0501044_0005108 | 3300049823 | Bacteria | 14635 |
| 260 | Ga0501044_0142063 | 3300049823 | Bacteria | 2389 |
| 261 | nmdc:mga00v17_1583_c1 | 3300050491 | Bacteria | 11891 |
| 262 | nmdc:mga0k408_24316_c1 | 3300050493 | Bacteria | 3423 |
| 263 | nmdc:mga06z11_65147_c1 | 3300050494 | Bacteria | 1912 |
| 264 | nmdc:mga07m45_3161_c1 | 3300050496 | Bacteria | 7901 |
| 265 | nmdc:mga07m45_46719_c1 | 3300050496 | Bacteria | 2433 |
| 266 | nmdc:mga0n895_243311_c1 | 3300050512 | Bacteria | 1826 |
| 267 | nmdc:mga0sz30_19064_c1 | 3300050516 | Bacteria | 2751 |
| 268 | Ga0500635_0000051 | 3300053080 | Bacteria | 76510 |
| 269 | Ga0500603_009122 | 3300053150 | Bacteria | 2215 |
| 270 | Ga0500636_0011772 | 3300053177 | Bacteria | 5122 |
| 271 | Ga0500637_0003033 | 3300053178 | Bacteria | 7632 |
| 272 | Ga0501082_0040616 | 3300060353 | Bacteria | 4012 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_10175806 | Ga0070666_101758062 | 338 |
| 2 | 3300006871 | Ga0075434_100115026 | Ga0075434_1001150264 | 338 |
| 3 | 3300009177 | Ga0105248_10002412 | Ga0105248_100024126 | 338 |
| 4 | 3300050512 | nmdc:mga0n895_243311_c1 | nmdc:mga0n895_243311_c1_484_1551 | 338 |
| 5 | 3300032168 | Ga0316593_10000549 | Ga0316593_100005493 | 340 |
| 6 | 3300039062 | Ga0400483_259285 | Ga0400483_259285_18_1043 | 340 |
| 7 | 3300049581 | Ga0501047_0483250 | Ga0501047_0483250_29_1054 | 340 |
| 8 | 3300031733 | Ga0316577_10065426 | Ga0316577_100654262 | 342 |
| 9 | 3300036647 | Ga0316582_0016932 | Ga0316582_0016932_633_1718 | 342 |
| 10 | 3300005331 | Ga0070670_100000004 | Ga0070670_10000000490 | 346 |
| 11 | 3300005347 | Ga0070668_100000598 | Ga0070668_10000059821 | 346 |
| 12 | 3300005347 | Ga0070668_100009890 | Ga0070668_1000098903 | 346 |
| 13 | 3300005367 | Ga0070667_100000105 | Ga0070667_10000010547 | 346 |
| 14 | 3300005548 | Ga0070665_100000784 | Ga0070665_1000007849 | 346 |
| 15 | 3300005616 | Ga0068852_100269598 | Ga0068852_1002695982 | 346 |
| 16 | 3300005618 | Ga0068864_100000106 | Ga0068864_10000010617 | 346 |
| 17 | 3300005618 | Ga0068864_100000965 | Ga0068864_10000096511 | 346 |
| 18 | 3300005618 | Ga0068864_100061790 | Ga0068864_1000617904 | 346 |
| 19 | 3300005841 | Ga0068863_100000079 | Ga0068863_10000007972 | 346 |
| 20 | 3300005841 | Ga0068863_100001463 | Ga0068863_10000146311 | 346 |
| 21 | 3300005842 | Ga0068858_100000006 | Ga0068858_10000000671 | 346 |
| 22 | 3300005842 | Ga0068858_100008921 | Ga0068858_1000089218 | 346 |
| 23 | 3300005843 | Ga0068860_100000077 | Ga0068860_10000007790 | 346 |
| 24 | 3300005844 | Ga0068862_100000457 | Ga0068862_10000045733 | 346 |
| 25 | 3300006042 | Ga0075368_10032271 | Ga0075368_100322712 | 346 |
| 26 | 3300006178 | Ga0075367_10029598 | Ga0075367_100295982 | 346 |
| 27 | 3300006195 | Ga0075366_10028340 | Ga0075366_100283403 | 346 |
| 28 | 3300006353 | Ga0075370_10014454 | Ga0075370_100144544 | 346 |
| 29 | 3300009177 | Ga0105248_10042535 | Ga0105248_100425354 | 346 |
| 30 | 3300013104 | Ga0157370_10220023 | Ga0157370_102200232 | 346 |
| 31 | 3300013105 | Ga0157369_10311125 | Ga0157369_103111252 | 346 |
| 32 | 3300014325 | Ga0163163_10243413 | Ga0163163_102434132 | 346 |
| 33 | 3300014968 | Ga0157379_10038936 | Ga0157379_100389364 | 346 |
| 34 | 3300025913 | Ga0207695_10026563 | Ga0207695_100265633 | 346 |
| 35 | 3300025917 | Ga0207660_10163061 | Ga0207660_101630612 | 346 |
| 36 | 3300025923 | Ga0207681_10113552 | Ga0207681_101135521 | 346 |
| 37 | 3300025925 | Ga0207650_10000033 | Ga0207650_10000033184 | 346 |
| 38 | 3300025941 | Ga0207711_10007165 | Ga0207711_100071654 | 346 |
| 39 | 3300025949 | Ga0207667_10029046 | Ga0207667_100290462 | 346 |
| 40 | 3300025972 | Ga0207668_10000004 | Ga0207668_10000004124 | 346 |
| 41 | 3300025972 | Ga0207668_10000703 | Ga0207668_1000070312 | 346 |
| 42 | 3300025986 | Ga0207658_10000607 | Ga0207658_1000060733 | 346 |
| 43 | 3300026035 | Ga0207703_10001558 | Ga0207703_1000155820 | 346 |
| 44 | 3300026035 | Ga0207703_10001666 | Ga0207703_1000166619 | 346 |
| 45 | 3300026088 | Ga0207641_10000003 | Ga0207641_10000003375 | 346 |
| 46 | 3300026088 | Ga0207641_10001940 | Ga0207641_1000194014 | 346 |
| 47 | 3300026095 | Ga0207676_10000084 | Ga0207676_1000008428 | 346 |
| 48 | 3300026095 | Ga0207676_10000830 | Ga0207676_1000083011 | 346 |
| 49 | 3300026095 | Ga0207676_10046808 | Ga0207676_100468083 | 346 |
| 50 | 3300028379 | Ga0268266_10002069 | Ga0268266_1000206914 | 346 |
| 51 | 3300028380 | Ga0268265_10001071 | Ga0268265_100010719 | 346 |
| 52 | 3300028381 | Ga0268264_10000032 | Ga0268264_10000032325 | 346 |
| 53 | 3300028786 | Ga0307517_10077474 | Ga0307517_100774744 | 346 |
| 54 | 3300032168 | Ga0316593_10018490 | Ga0316593_100184902 | 346 |
| 55 | 3300037312 | Ga0395899_0000190 | Ga0395899_0000190_22374_23426 | 346 |
| 56 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_407582_408634 | 346 |
| 57 | 3300037418 | Ga0395900_0045719 | Ga0395900_0045719_2301_3353 | 346 |
| 58 | 3300037466 | Ga0395898_0053806 | Ga0395898_0053806_418_1470 | 346 |
| 59 | 3300037466 | Ga0395898_0131939 | Ga0395898_0131939_426_1478 | 346 |
| 60 | 3300037471 | Ga0395905_0008108 | Ga0395905_0008108_7167_8219 | 346 |
| 61 | 3300037471 | Ga0395905_0020588 | Ga0395905_0020588_2166_3218 | 346 |
| 62 | 3300037853 | Ga0436364_0254948 | Ga0436364_0254948_17_1069 | 346 |
| 63 | 3300038443 | Ga0395901_0000013 | Ga0395901_0000013_295151_296203 | 346 |
| 64 | 3300038443 | Ga0395901_0116010 | Ga0395901_0116010_1348_2400 | 346 |
| 65 | 3300048905 | Ga0496102_0057120 | Ga0496102_0057120_1390_2442 | 346 |
| 66 | 3300048906 | Ga0496103_0068738 | Ga0496103_0068738_1126_2178 | 346 |
| 67 | 3300049570 | Ga0501033_0092322 | Ga0501033_0092322_59_1111 | 346 |
| 68 | 3300049823 | Ga0501044_0005108 | Ga0501044_0005108_6495_7547 | 346 |
| 69 | 3300050491 | nmdc:mga00v17_1583_c1 | nmdc:mga00v17_1583_c1_5720_6772 | 346 |
| 70 | 3300050493 | nmdc:mga0k408_24316_c1 | nmdc:mga0k408_24316_c1_580_1632 | 346 |
| 71 | 3300050494 | nmdc:mga06z11_65147_c1 | nmdc:mga06z11_65147_c1_602_1654 | 346 |
| 72 | 3300050496 | nmdc:mga07m45_3161_c1 | nmdc:mga07m45_3161_c1_4240_5292 | 346 |
| 73 | 3300050496 | nmdc:mga07m45_46719_c1 | nmdc:mga07m45_46719_c1_1030_2082 | 346 |
| 74 | 3300050516 | nmdc:mga0sz30_19064_c1 | nmdc:mga0sz30_19064_c1_445_1497 | 346 |
| 75 | 3300053080 | Ga0500635_0000051 | Ga0500635_0000051_13754_14806 | 346 |
| 76 | 3300053150 | Ga0500603_009122 | Ga0500603_009122_588_1640 | 346 |
| 77 | 3300053177 | Ga0500636_0011772 | Ga0500636_0011772_1608_2660 | 346 |
| 78 | 3300053178 | Ga0500637_0003033 | Ga0500637_0003033_1562_2614 | 346 |
| 79 | 3300013100 | Ga0157373_10006299 | Ga0157373_100062994 | 347 |
| 80 | 3300025932 | Ga0207690_10001874 | Ga0207690_100018749 | 347 |
| 81 | 3300025945 | Ga0207679_10177958 | Ga0207679_101779581 | 347 |
| 82 | 3300031344 | Ga0265316_10032119 | Ga0265316_100321191 | 351 |
| 83 | 3300031665 | Ga0316575_10001671 | Ga0316575_100016713 | 351 |
| 84 | 3300031691 | Ga0316579_10003584 | Ga0316579_100035843 | 351 |
| 85 | 3300031727 | Ga0316576_10011865 | Ga0316576_100118653 | 351 |
| 86 | 3300031728 | Ga0316578_10041969 | Ga0316578_100419692 | 351 |
| 87 | 3300031733 | Ga0316577_10009713 | Ga0316577_100097131 | 351 |
| 88 | 3300032133 | Ga0316583_10006097 | Ga0316583_100060973 | 351 |
| 89 | 3300032137 | Ga0316585_10003921 | Ga0316585_100039213 | 351 |
| 90 | 3300032139 | Ga0316580_10012290 | Ga0316580_100122902 | 351 |
| 91 | 3300033524 | Ga0316592_1001708 | Ga0316592_10017082 | 351 |
| 92 | 3300033527 | Ga0316586_1000087 | Ga0316586_10000874 | 351 |
| 93 | 3300033528 | Ga0316588_1000842 | Ga0316588_10008422 | 351 |
| 94 | 3300033529 | Ga0316587_1000274 | Ga0316587_10002743 | 351 |
| 95 | 3300033541 | Ga0316596_1002805 | Ga0316596_10028053 | 351 |
| 96 | 3300033541 | Ga0316596_1034251 | Ga0316596_10342511 | 351 |
| 97 | 3300035398 | Ga0316574_0007008 | Ga0316574_0007008_2654_3739 | 351 |
| 98 | 3300035398 | Ga0316574_0014818 | Ga0316574_0014818_3445_4500 | 351 |
| 99 | 3300036647 | Ga0316582_0050116 | Ga0316582_0050116_578_1663 | 351 |
| 100 | 3300036712 | Ga0316584_0020560 | Ga0316584_0020560_585_1670 | 351 |
| 101 | 3300028800 | Ga0265338_10016438 | Ga0265338_100164388 | 352 |
| 102 | 3300031247 | Ga0265340_10031426 | Ga0265340_100314262 | 352 |
| 103 | 3300031251 | Ga0265327_10002374 | Ga0265327_1000237412 | 352 |
| 104 | 3300035398 | Ga0316574_0003177 | Ga0316574_0003177_6019_7080 | 352 |
| 105 | 3300049823 | Ga0501044_0142063 | Ga0501044_0142063_489_1562 | 352 |
| 106 | 3300021361 | Ga0213872_10000255 | Ga0213872_1000025527 | 354 |
| 107 | 3300021361 | Ga0213872_10085761 | Ga0213872_100857612 | 354 |
| 108 | 3300031727 | Ga0316576_10011968 | Ga0316576_100119683 | 354 |
| 109 | 3300031727 | Ga0316576_10060922 | Ga0316576_100609225 | 354 |
| 110 | 3300031733 | Ga0316577_10000133 | Ga0316577_1000013310 | 354 |
| 111 | 3300032139 | Ga0316580_10041748 | Ga0316580_100417482 | 354 |
| 112 | 3300032168 | Ga0316593_10000220 | Ga0316593_100002203 | 354 |
| 113 | 3300033541 | Ga0316596_1042767 | Ga0316596_10427671 | 354 |
| 114 | 3300035398 | Ga0316574_0022183 | Ga0316574_0022183_979_2049 | 354 |
| 115 | 3300035398 | Ga0316574_0036203 | Ga0316574_0036203_1415_2485 | 354 |
| 116 | 3300035398 | Ga0316574_0114408 | Ga0316574_0114408_80_1153 | 354 |
| 117 | 3300036647 | Ga0316582_0034801 | Ga0316582_0034801_1099_2175 | 354 |
| 118 | 3300036712 | Ga0316584_0023983 | Ga0316584_0023983_245_1318 | 354 |
| 119 | 3300036712 | Ga0316584_0051542 | Ga0316584_0051542_232_1308 | 354 |
| 120 | 3300038741 | Ga0400488_11709 | Ga0400488_11709_1331_2404 | 354 |
| 121 | 3300039062 | Ga0400483_100739 | Ga0400483_100739_3720_4793 | 354 |
| 122 | 3300039062 | Ga0400483_130807 | Ga0400483_130807_6620_7693 | 354 |
| 123 | 3300039062 | Ga0400483_237044 | Ga0400483_237044_15781_16854 | 354 |
| 124 | 3300039447 | Ga0436361_0241912 | Ga0436361_0241912_2151_3215 | 354 |
| 125 | 3300039447 | Ga0436361_0662680 | Ga0436361_0662680_11359_12423 | 354 |
| 126 | iso_pu_bacteria | 2894510363 | 2894511515 | 354 |
| 127 | iso_pu_bacteria | 2989392574 | 2989393255 | 354 |
| 128 | 3300031691 | Ga0316579_10000074 | Ga0316579_100000742 | 355 |
| 129 | 3300031711 | Ga0265314_10122684 | Ga0265314_101226842 | 355 |
| 130 | 3300031727 | Ga0316576_10000087 | Ga0316576_1000008724 | 355 |
| 131 | 3300031727 | Ga0316576_10039469 | Ga0316576_100394692 | 355 |
| 132 | 3300031733 | Ga0316577_10005347 | Ga0316577_100053472 | 355 |
| 133 | 3300032137 | Ga0316585_10002613 | Ga0316585_100026132 | 355 |
| 134 | 3300032139 | Ga0316580_10000107 | Ga0316580_1000010713 | 355 |
| 135 | 3300032168 | Ga0316593_10001350 | Ga0316593_100013503 | 355 |
| 136 | 3300032168 | Ga0316593_10002523 | Ga0316593_100025233 | 355 |
| 137 | 3300032168 | Ga0316593_10002539 | Ga0316593_100025392 | 355 |
| 138 | 3300033524 | Ga0316592_1009853 | Ga0316592_10098532 | 355 |
| 139 | 3300033541 | Ga0316596_1001404 | Ga0316596_10014042 | 355 |
| 140 | 3300033541 | Ga0316596_1002799 | Ga0316596_10027992 | 355 |
| 141 | 3300035398 | Ga0316574_0056359 | Ga0316574_0056359_27_1103 | 355 |
| 142 | 3300036647 | Ga0316582_0021751 | Ga0316582_0021751_51_1127 | 355 |
| 143 | 3300036647 | Ga0316582_0098486 | Ga0316582_0098486_812_1888 | 355 |
| 144 | 3300036712 | Ga0316584_0000524 | Ga0316584_0000524_17636_18712 | 355 |
| 145 | 3300036712 | Ga0316584_0002549 | Ga0316584_0002549_3512_4588 | 355 |
| 146 | 3300038725 | Ga0400484_08605 | Ga0400484_08605_5544_6620 | 355 |
| 147 | 3300038725 | Ga0400484_39316 | Ga0400484_39316_6123_7199 | 355 |
| 148 | 3300038725 | Ga0400484_43922 | Ga0400484_43922_9625_10701 | 355 |
| 149 | 3300038726 | Ga0400490_52669 | Ga0400490_52669_9698_10774 | 355 |
| 150 | 3300038727 | Ga0400491_03802 | Ga0400491_03802_6322_7398 | 355 |
| 151 | 3300038727 | Ga0400491_19509 | Ga0400491_19509_2156_3232 | 355 |
| 152 | 3300038741 | Ga0400488_17990 | Ga0400488_17990_2442_3518 | 355 |
| 153 | 3300038741 | Ga0400488_53715 | Ga0400488_53715_8988_10064 | 355 |
| 154 | 3300038741 | Ga0400488_58485 | Ga0400488_58485_1448_2524 | 355 |
| 155 | 3300038741 | Ga0400488_63364 | Ga0400488_63364_35_1111 | 355 |
| 156 | 3300039062 | Ga0400483_047511 | Ga0400483_047511_1996_3072 | 355 |
| 157 | 3300039062 | Ga0400483_266345 | Ga0400483_266345_438_1514 | 355 |
| 158 | 3300039062 | Ga0400483_289224 | Ga0400483_289224_28844_29920 | 355 |
| 159 | 3300039110 | Ga0400487_10987 | Ga0400487_10987_8262_9338 | 355 |
| 160 | 3300039110 | Ga0400487_43990 | Ga0400487_43990_442_1518 | 355 |
| 161 | 3300039110 | Ga0400487_60213 | Ga0400487_60213_3250_4326 | 355 |
| 162 | 3300049570 | Ga0501033_0002370 | Ga0501033_0002370_653_1729 | 355 |
| 163 | 3300049571 | Ga0501034_0004671 | Ga0501034_0004671_2022_3098 | 355 |
| 164 | 3300049573 | Ga0501037_0009706 | Ga0501037_0009706_4320_5396 | 355 |
| 165 | 3300049574 | Ga0501038_0001732 | Ga0501038_0001732_7617_8693 | 355 |
| 166 | 3300049579 | Ga0501043_0004555 | Ga0501043_0004555_15_1091 | 355 |
| 167 | 3300049581 | Ga0501047_0025099 | Ga0501047_0025099_1880_2956 | 355 |
| 168 | 3300049589 | Ga0501073_0010392 | Ga0501073_0010392_4390_5466 | 355 |
| 169 | 3300049590 | Ga0501074_0010249 | Ga0501074_0010249_3444_4520 | 355 |
| 170 | 3300049742 | Ga0501080_0011081 | Ga0501080_0011081_2784_3860 | 355 |
| 171 | 3300049822 | Ga0501035_0003145 | Ga0501035_0003145_9375_10451 | 355 |
| 172 | 3300049823 | Ga0501044_0002284 | Ga0501044_0002284_11245_12321 | 355 |
| 173 | 3300060353 | Ga0501082_0040616 | Ga0501082_0040616_1510_2586 | 355 |
| 174 | 3300003322 | rootL2_10055570 | rootL2_100555706 | 356 |
| 175 | 3300005331 | Ga0070670_100004099 | Ga0070670_1000040994 | 356 |
| 176 | 3300005334 | Ga0068869_100001687 | Ga0068869_1000016874 | 356 |
| 177 | 3300005347 | Ga0070668_100001724 | Ga0070668_10000172414 | 356 |
| 178 | 3300005353 | Ga0070669_100049017 | Ga0070669_1000490174 | 356 |
| 179 | 3300005356 | Ga0070674_100012709 | Ga0070674_1000127094 | 356 |
| 180 | 3300005367 | Ga0070667_100013717 | Ga0070667_1000137175 | 356 |
| 181 | 3300005441 | Ga0070700_100107854 | Ga0070700_1001078542 | 356 |
| 182 | 3300005459 | Ga0068867_100110917 | Ga0068867_1001109172 | 356 |
| 183 | 3300005539 | Ga0068853_100001464 | Ga0068853_1000014648 | 356 |
| 184 | 3300005543 | Ga0070672_100224102 | Ga0070672_1002241022 | 356 |
| 185 | 3300005545 | Ga0070695_100083546 | Ga0070695_1000835462 | 356 |
| 186 | 3300005577 | Ga0068857_100011768 | Ga0068857_1000117685 | 356 |
| 187 | 3300005618 | Ga0068864_100002543 | Ga0068864_10000254313 | 356 |
| 188 | 3300005841 | Ga0068863_100009999 | Ga0068863_1000099994 | 356 |
| 189 | 3300005842 | Ga0068858_100021158 | Ga0068858_1000211582 | 356 |
| 190 | 3300005843 | Ga0068860_100005662 | Ga0068860_1000056624 | 356 |
| 191 | 3300005844 | Ga0068862_100035794 | Ga0068862_1000357943 | 356 |
| 192 | 3300006237 | Ga0097621_100003209 | Ga0097621_1000032094 | 356 |
| 193 | 3300006358 | Ga0068871_100004593 | Ga0068871_1000045933 | 356 |
| 194 | 3300009098 | Ga0105245_10132628 | Ga0105245_101326281 | 356 |
| 195 | 3300013297 | Ga0157378_10041480 | Ga0157378_100414804 | 356 |
| 196 | 3300013308 | Ga0157375_10036287 | Ga0157375_100362875 | 356 |
| 197 | 3300014325 | Ga0163163_10027372 | Ga0163163_100273726 | 356 |
| 198 | 3300014968 | Ga0157379_10011876 | Ga0157379_100118767 | 356 |
| 199 | 3300014968 | Ga0157379_10016512 | Ga0157379_100165122 | 356 |
| 200 | 3300025907 | Ga0207645_10116185 | Ga0207645_101161852 | 356 |
| 201 | 3300025925 | Ga0207650_10005813 | Ga0207650_100058137 | 356 |
| 202 | 3300025927 | Ga0207687_10177320 | Ga0207687_101773201 | 356 |
| 203 | 3300025938 | Ga0207704_10035500 | Ga0207704_100355003 | 356 |
| 204 | 3300025940 | Ga0207691_10135758 | Ga0207691_101357582 | 356 |
| 205 | 3300025941 | Ga0207711_10028100 | Ga0207711_100281002 | 356 |
| 206 | 3300025942 | Ga0207689_10000354 | Ga0207689_100003544 | 356 |
| 207 | 3300025945 | Ga0207679_10047112 | Ga0207679_100471124 | 356 |
| 208 | 3300025960 | Ga0207651_10003368 | Ga0207651_100033686 | 356 |
| 209 | 3300025961 | Ga0207712_10169883 | Ga0207712_101698832 | 356 |
| 210 | 3300025986 | Ga0207658_10014187 | Ga0207658_100141873 | 356 |
| 211 | 3300026035 | Ga0207703_10010295 | Ga0207703_100102951 | 356 |
| 212 | 3300026035 | Ga0207703_10087658 | Ga0207703_100876582 | 356 |
| 213 | 3300026067 | Ga0207678_10272504 | Ga0207678_102725042 | 356 |
| 214 | 3300026075 | Ga0207708_10145105 | Ga0207708_101451052 | 356 |
| 215 | 3300026089 | Ga0207648_10182963 | Ga0207648_101829632 | 356 |
| 216 | 3300026116 | Ga0207674_10019180 | Ga0207674_100191804 | 356 |
| 217 | 3300026118 | Ga0207675_100010505 | Ga0207675_1000105053 | 356 |
| 218 | 3300028380 | Ga0268265_10025899 | Ga0268265_100258994 | 356 |
| 219 | 3300028381 | Ga0268264_10002307 | Ga0268264_1000230711 | 356 |
| 220 | 3300031665 | Ga0316575_10008971 | Ga0316575_100089712 | 356 |
| 221 | 3300031665 | Ga0316575_10014942 | Ga0316575_100149423 | 356 |
| 222 | 3300031665 | Ga0316575_10023231 | Ga0316575_100232312 | 356 |
| 223 | 3300031665 | Ga0316575_10065867 | Ga0316575_100658672 | 356 |
| 224 | 3300031691 | Ga0316579_10001514 | Ga0316579_100015144 | 356 |
| 225 | 3300031691 | Ga0316579_10001869 | Ga0316579_100018693 | 356 |
| 226 | 3300031691 | Ga0316579_10005872 | Ga0316579_100058725 | 356 |
| 227 | 3300031711 | Ga0265314_10023005 | Ga0265314_100230052 | 356 |
| 228 | 3300031727 | Ga0316576_10024710 | Ga0316576_100247102 | 356 |
| 229 | 3300031727 | Ga0316576_10025135 | Ga0316576_100251353 | 356 |
| 230 | 3300031727 | Ga0316576_10068695 | Ga0316576_100686953 | 356 |
| 231 | 3300031727 | Ga0316576_10121668 | Ga0316576_101216682 | 356 |
| 232 | 3300031727 | Ga0316576_10174544 | Ga0316576_101745442 | 356 |
| 233 | 3300031727 | Ga0316576_10186110 | Ga0316576_101861101 | 356 |
| 234 | 3300031728 | Ga0316578_10000713 | Ga0316578_100007136 | 356 |
| 235 | 3300031728 | Ga0316578_10005148 | Ga0316578_100051483 | 356 |
| 236 | 3300031728 | Ga0316578_10014985 | Ga0316578_100149852 | 356 |
| 237 | 3300031728 | Ga0316578_10052117 | Ga0316578_100521171 | 356 |
| 238 | 3300031728 | Ga0316578_10059838 | Ga0316578_100598382 | 356 |
| 239 | 3300032133 | Ga0316583_10000574 | Ga0316583_100005743 | 356 |
| 240 | 3300032133 | Ga0316583_10009256 | Ga0316583_100092562 | 356 |
| 241 | 3300032137 | Ga0316585_10000495 | Ga0316585_100004953 | 356 |
| 242 | 3300032139 | Ga0316580_10007905 | Ga0316580_100079053 | 356 |
| 243 | 3300032139 | Ga0316580_10038507 | Ga0316580_100385072 | 356 |
| 244 | 3300032168 | Ga0316593_10000225 | Ga0316593_100002253 | 356 |
| 245 | 3300032168 | Ga0316593_10000282 | Ga0316593_100002823 | 356 |
| 246 | 3300032168 | Ga0316593_10001211 | Ga0316593_100012113 | 356 |
| 247 | 3300032168 | Ga0316593_10008062 | Ga0316593_100080622 | 356 |
| 248 | 3300032168 | Ga0316593_10008832 | Ga0316593_100088322 | 356 |
| 249 | 3300033527 | Ga0316586_1000921 | Ga0316586_10009213 | 356 |
| 250 | 3300033527 | Ga0316586_1013471 | Ga0316586_10134711 | 356 |
| 251 | 3300033528 | Ga0316588_1007656 | Ga0316588_10076562 | 356 |
| 252 | 3300033529 | Ga0316587_1000488 | Ga0316587_10004883 | 356 |
| 253 | 3300033541 | Ga0316596_1001239 | Ga0316596_10012393 | 356 |
| 254 | 3300033541 | Ga0316596_1001575 | Ga0316596_10015752 | 356 |
| 255 | 3300033541 | Ga0316596_1004314 | Ga0316596_10043143 | 356 |
| 256 | 3300033541 | Ga0316596_1004462 | Ga0316596_10044621 | 356 |
| 257 | 3300033541 | Ga0316596_1035618 | Ga0316596_10356181 | 356 |
| 258 | 3300036647 | Ga0316582_0000848 | Ga0316582_0000848_9066_10145 | 356 |
| 259 | 3300036647 | Ga0316582_0008519 | Ga0316582_0008519_521_1609 | 356 |
| 260 | 3300036647 | Ga0316582_0018507 | Ga0316582_0018507_2879_3961 | 356 |
| 261 | 3300036712 | Ga0316584_0003592 | Ga0316584_0003592_8837_9916 | 356 |
| 262 | 3300036712 | Ga0316584_0036812 | Ga0316584_0036812_560_1639 | 356 |
| 263 | 3300036712 | Ga0316584_0037737 | Ga0316584_0037737_2067_3146 | 356 |
| 264 | 3300037588 | Ga0316581_0002020 | Ga0316581_0002020_1714_2793 | 356 |
| 265 | 3300038725 | Ga0400484_30885 | Ga0400484_30885_972_2051 | 356 |
| 266 | 3300039062 | Ga0400483_212840 | Ga0400483_212840_170_1249 | 356 |
| 267 | 3300039110 | Ga0400487_01301 | Ga0400487_01301_12000_13079 | 356 |
| 268 | 3300044693 | Ga0466961_0001945 | Ga0466961_0001945_553_1623 | 356 |
| 269 | 3300044712 | Ga0453684_0162692 | Ga0453684_0162692_888_1976 | 356 |
| 270 | 3300045049 | Ga0466959_0027065 | Ga0466959_0027065_593_1663 | 356 |
| 271 | 3300045051 | Ga0451576_0000929 | Ga0451576_0000929_5413_6504 | 356 |
| 272 | 3300045051 | Ga0451576_0272631 | Ga0451576_0272631_359_1429 | 356 |
| 273 | 3300048906 | Ga0496103_0019714 | Ga0496103_0019714_2431_3504 | 356 |
| 274 | 3300048916 | Ga0496113_0067503 | Ga0496113_0067503_468_1541 | 356 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j34-assembly2.cif.gz_D | isopropylmalate dehydrogenase k232m mutant | 0.9756 | 2 | 356 |
| 3r8w-assembly2.cif.gz_D | structure of 3-isopropylmalate dehydrogenase isoform 2 from arabidopsis thaliana at 2.2 angstrom resolution | 0.9725 | 2 | 354 |
| 1gc8-assembly1.cif.gz_B | the crystal structure of thermus thermophilus 3-isopropylmalate dehydrogenase mutated at 172th from ala to phe | 0.9702 | 1 | 354 |
| 5j34-assembly2.cif.gz_D | isopropylmalate dehydrogenase k232m mutant | 0.9702 | 2 | 356 |
| 1dr0-assembly1.cif.gz_B | structure of modified 3-isopropylmalate dehydrogenase at the c-terminus, hd708 | 0.9699 | 1 | 356 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u1hA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9369 | 1 | 355 | 3.40.718.10 |
| 1x0lB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9207 | 2 | 355 | 3.40.718.10 |
| 1w0dB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.914 | 2 | 353 | 3.40.718.10 |
| 3u1hA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9139 | 1 | 355 | 3.40.718.10 |
| 1x0lB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9071 | 2 | 355 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M2U952-F1-model_v4 | Isopropylmalate dehydrogenase-like domain-containing protein | 0.9981 | 262 | 355 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
| AF-A0A351KSQ8-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) | 0.9911 | 247 | 356 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
| AF-K1TTI4-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) | 0.9898 | 158 | 353 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
| AF-A0A352SCX0-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) | 0.9893 | 188 | 353 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
| AF-A0A7C3GWX1-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) | 0.9876 | 233 | 355 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar