F379716

General Info

Members Datasets Scaffolds Average Seq Length
274 182 237 413

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10031826|Ga0157371_100318263
Length 435
Sequence MFTIYKPYKKKILMKTHNNFDGQYEFVGKAKTWSLICIVIGLVAILGGFALGYAERTFANLLLMTYYFAAVCMCGIFFCAVQYAAQAGWSASMIRIPQAFGKVLPIAAITLIVVVIAGFSLTHTVTNEEGKQVVAPYLYKIWAAAGVTDPHNENYNAIIAGKAGYMNKVGFIIRLICFLGSYCIFGRLLAKYSEAEDDLGGMFYYKKSFNMSCLFLVIFGFTTPIYAFDTIMSLEAEWFSTMFGWYNFAAMWVSGLSVITLTLIRLKRIGYFEWVSEDHMHSLTKFIFGFSIFWTYVWFAQFLLIYYANMPEETVYFFKRWEPEFKPWFWINIVVNFLTPLLVLMSRDSKRIYRTVEIMCIILIVGHWLDYFMMIMPGTVGPTSSWLTEVGPIEIGVFLGFGGLFTFTAMTALTKFKSLVPKKHPFLQESLHHHI

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
17 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
18 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
19 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
20 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
21 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
22 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
23 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
24 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
25 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
26 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
27 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
28 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
29 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
30 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
31 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
32 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
33 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
34 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
35 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
36 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
37 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
133 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
134 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
135 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
177 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
178 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
182 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.13
Metatranscriptomes 0.36
Isolates 13.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.66
Nodule 0
Rhizoplane 0.36
Rhizosphere 81.75
Stem 0
Stem Tuber 0
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002505 3300001904 Bacteria 3249
2 JGI24737J22298_10000384 3300001990 Bacteria 15070
3 JGI24737J22298_10007737 3300001990 Bacteria 3622
4 JGI24735J21928_10000003 3300002067 Bacteria 385983
5 JGI24744J21845_10003083 3300002077 Bacteria 3414
6 JGI25152J39213_1000050 3300002773 Bacteria 79659
7 JGI25150J39212_1000003 3300002774 Bacteria 508651
8 JGI25151J46595_10000002 3300003187 Bacteria 731381
9 JGI25153J46596_10000030 3300003215 Bacteria 200879
10 rootH1_10052326 3300003316 Bacteria 4580
11 rootH2_10005722 3300003320 Bacteria 98526
12 rootH1_10114888 3300003323 Bacteria 3010
13 Ga0055536_1000010 3300003781 Bacteria 304614
14 Ga0055530_10001512 3300003791 Bacteria 16820
15 Ga0065714_10005395 3300005288 Bacteria 4483
16 Ga0065714_10006345 3300005288 Bacteria 3339
17 Ga0065714_10006626 3300005288 Bacteria 7869
18 Ga0065714_10008402 3300005288 Bacteria 2564
19 Ga0065714_10097620 3300005288 Bacteria 1725
20 Ga0065704_10003614 3300005289 Bacteria 4646
21 Ga0065704_10081318 3300005289 Bacteria 3781
22 Ga0070658_10000060 3300005327 Bacteria 112561
23 Ga0070676_10000152 3300005328 Bacteria 27554
24 Ga0068868_100063493 3300005338 Bacteria 2929
25 Ga0068868_100133177 3300005338 Bacteria 2036
26 Ga0070660_100003098 3300005339 Bacteria 11425
27 Ga0070660_100059209 3300005339 Bacteria 2970
28 Ga0070660_100106585 3300005339 Bacteria 2226
29 Ga0070671_100010058 3300005355 Bacteria 7598
30 Ga0070673_100024947 3300005364 Bacteria 4392
31 Ga0070659_100000199 3300005366 Bacteria 46342
32 Ga0070678_100008100 3300005456 Bacteria 6276
33 Ga0070662_100000935 3300005457 Bacteria 17877
34 Ga0068867_100002522 3300005459 Bacteria 12881
35 Ga0070684_100246317 3300005535 Bacteria 1633
36 Ga0068853_100191460 3300005539 Bacteria 1858
37 Ga0070672_100070313 3300005543 Bacteria 2781
38 Ga0070665_100000264 3300005548 Bacteria 85867
39 Ga0068855_100063015 3300005563 Bacteria 4328
40 Ga0068855_100242834 3300005563 Bacteria 2012
41 Ga0068855_100259884 3300005563 Unclassified 1934
42 Ga0068856_100010799 3300005614 Bacteria 8869
43 Ga0068856_100069209 3300005614 Bacteria 3490
44 Ga0068852_100000389 3300005616 Bacteria 29439
45 Ga0075366_10026040 3300006195 Bacteria 3423
46 Ga0075366_10068088 3300006195 Bacteria 2119
47 Ga0097621_100000232 3300006237 Bacteria 37391
48 Ga0068871_100000800 3300006358 Bacteria 21155
49 Ga0068865_100001329 3300006881 Bacteria 14401
50 Ga0105244_10082373 3300009036 Bacteria 1591
51 Ga0105240_10000371 3300009093 Bacteria 84390
52 Ga0105240_10322437 3300009093 Bacteria 1760
53 Ga0105240_10391374 3300009093 Unclassified 1567
54 Ga0105240_10451503 3300009093 Bacteria 1438
55 Ga0105243_10000018 3300009148 Bacteria 227618
56 Ga0105241_10007118 3300009174 Bacteria 8236
57 Ga0105241_10009788 3300009174 Bacteria 7044
58 Ga0105241_10013554 3300009174 Bacteria 5974
59 Ga0105241_10293416 3300009174 Bacteria 1393
60 Ga0105237_10000120 3300009545 Bacteria 109953
61 Ga0105237_10000535 3300009545 Bacteria 53620
62 Ga0105237_10000632 3300009545 Bacteria 49178
63 Ga0105237_10002670 3300009545 Bacteria 21900
64 Ga0105237_10113021 3300009545 Bacteria 2708
65 Ga0105238_10000612 3300009551 Bacteria 37482
66 Ga0105238_10055142 3300009551 Bacteria 3991
67 Ga0105238_10163327 3300009551 Bacteria 2203
68 Ga0105239_10000086 3300010375 Bacteria 129798
69 Ga0105239_10222094 3300010375 Bacteria 2119
70 Ga0105239_10274823 3300010375 Bacteria 1895
71 Ga0105239_10498122 3300010375 Bacteria 1385
72 Ga0105246_10092880 3300011119 Bacteria 2179
73 Ga0157373_10000125 3300013100 Bacteria 59653
74 Ga0157373_10001788 3300013100 Bacteria 16341
75 Ga0157373_10007861 3300013100 Bacteria 7933
76 Ga0157371_10000143 3300013102 Bacteria 103796
77 Ga0157371_10023271 3300013102 Bacteria 4530
78 Ga0157371_10031826 3300013102 Bacteria 3798
79 Ga0157371_10063222 3300013102 Bacteria 2623
80 Ga0157370_10000125 3300013104 Bacteria 91078
81 Ga0157370_10039156 3300013104 Bacteria 4581
82 Ga0157370_10104435 3300013104 Bacteria 2652
83 Ga0157370_10105076 3300013104 Bacteria 2643
84 Ga0157369_10000373 3300013105 Bacteria 59576
85 Ga0157369_10166787 3300013105 Bacteria 2322
86 Ga0157374_10006785 3300013296 Bacteria 9734
87 Ga0157374_10006972 3300013296 Bacteria 9619
88 Ga0157374_10085050 3300013296 Bacteria 3007
89 Ga0157378_10019254 3300013297 Bacteria 5999
90 Ga0163162_10000008 3300013306 Bacteria 316194
91 Ga0163162_10000036 3300013306 Bacteria 144093
92 Ga0163162_10005924 3300013306 Bacteria 11828
93 Ga0163162_10120380 3300013306 Bacteria 2729
94 Ga0157372_10000404 3300013307 Bacteria 47383
95 Ga0157372_10000514 3300013307 Bacteria 42626
96 Ga0157372_10002106 3300013307 Bacteria 21657
97 Ga0157375_10036678 3300013308 Bacteria 4692
98 Ga0157375_10130161 3300013308 Bacteria 2635
99 Ga0182008_10000002 3300014497 Bacteria 480216
100 Ga0182008_10000122 3300014497 Bacteria 58755
101 Ga0182008_10000438 3300014497 Bacteria 31655
102 Ga0182008_10008112 3300014497 Bacteria 5750
103 Ga0182008_10065261 3300014497 Bacteria 1791
104 Ga0157377_10130071 3300014745 Bacteria 1536
105 Ga0157376_10083562 3300014969 Bacteria 2747
106 Ga0182006_1001113 3300015261 Bacteria 17114
107 Ga0182006_1011248 3300015261 Bacteria 3945
108 Ga0182006_1021888 3300015261 Bacteria 2661
109 Ga0182006_1031473 3300015261 Bacteria 2137
110 Ga0182007_10000009 3300015262 Bacteria 316298
111 Ga0182007_10005257 3300015262 Bacteria 5714
112 Ga0182007_10005614 3300015262 Bacteria 5481
113 Ga0183373_1009 3300015682 Bacteria 210158
114 Ga0163161_10000194 3300017792 Bacteria 55862
115 Ga0163161_10067301 3300017792 Bacteria 2616
116 Ga0163161_10074526 3300017792 Bacteria 2489
117 Ga0163161_10084497 3300017792 Bacteria 2341
118 Ga0163161_10289374 3300017792 Bacteria 1287
119 Ga0206351_11017393 3300020077 Bacteria 14569
120 Ga0213872_10010139 3300021361 Bacteria 4494
121 Ga0207427_100131 3300025231 Bacteria 93947
122 Ga0209437_100048 3300025233 Bacteria 405107
123 Ga0207425_1000003 3300025245 Bacteria 1145342
124 Ga0209026_1000683 3300025250 Bacteria 20446
125 Ga0209129_1000014 3300025258 Bacteria 509018
126 Ga0209233_1000029 3300025261 Bacteria 641642
127 Ga0209676_1000009 3300025292 Bacteria 981719
128 Ga0209025_1000007 3300025294 Bacteria 1145109
129 Ga0209758_1000012 3300025297 Bacteria 949866
130 Ga0209050_1000190 3300025298 Bacteria 138532
131 Ga0207647_10000546 3300025904 Bacteria 29990
132 Ga0207645_10000948 3300025907 Bacteria 24090
133 Ga0207705_10000233 3300025909 Bacteria 55125
134 Ga0207654_10025113 3300025911 Bacteria 3210
135 Ga0207654_10073320 3300025911 Bacteria 2040
136 Ga0207695_10000142 3300025913 Bacteria 214715
137 Ga0207695_10045798 3300025913 Bacteria 4640
138 Ga0207695_10046589 3300025913 Bacteria 4596
139 Ga0207695_10108349 3300025913 Bacteria 2762
140 Ga0207695_10232972 3300025913 Bacteria 1745
141 Ga0207671_10000110 3300025914 Bacteria 126480
142 Ga0207671_10001385 3300025914 Bacteria 28199
143 Ga0207671_10015940 3300025914 Bacteria 5860
144 Ga0207657_10018794 3300025919 Bacteria 6583
145 Ga0207657_10032033 3300025919 Bacteria 4755
146 Ga0207657_10113932 3300025919 Bacteria 2230
147 Ga0207694_10211475 3300025924 Bacteria 1580
148 Ga0207644_10006015 3300025931 Bacteria 7911
149 Ga0207690_10001029 3300025932 Bacteria 17866
150 Ga0207690_10040176 3300025932 Bacteria 3057
151 Ga0207706_10000013 3300025933 Bacteria 188236
152 Ga0207709_10000021 3300025935 Bacteria 386722
153 Ga0207704_10000405 3300025938 Bacteria 19602
154 Ga0207667_10000014 3300025949 Bacteria 421261
155 Ga0207667_10053016 3300025949 Bacteria 4269
156 Ga0207667_10073227 3300025949 Bacteria 3560
157 Ga0207651_10017246 3300025960 Bacteria 4260
158 Ga0207677_10246312 3300026023 Bacteria 1449
159 Ga0207639_10143021 3300026041 Bacteria 1995
160 Ga0207702_10022067 3300026078 Bacteria 5274
161 Ga0207702_10062382 3300026078 Bacteria 3183
162 Ga0207648_10001141 3300026089 Bacteria 29844
163 Ga0207683_10028058 3300026121 Bacteria 4867
164 Ga0207698_10049524 3300026142 Bacteria 3198
165 Ga0268266_10000268 3300028379 Bacteria 85976
166 Ga0307517_10000207 3300028786 Bacteria 99774
167 Ga0316177_1195072 3300030731 Bacteria 9957
168 Ga0316183_1098725 3300030742 Bacteria 33143
169 Ga0316181_1105588 3300030744 Bacteria 4026
170 Ga0316182_1372759 3300030745 Bacteria 1523
171 Ga0307408_100000151 3300031548 Bacteria 77679
172 Ga0307408_100002559 3300031548 Bacteria 12703
173 Ga0307405_10000016 3300031731 Bacteria 197180
174 Ga0307407_10000012 3300031903 Bacteria 172479
175 Ga0307412_10000038 3300031911 Bacteria 187857
176 Ga0307412_10001770 3300031911 Bacteria 11933
177 Ga0307416_100000024 3300032002 Bacteria 186924
178 Ga0307414_10001061 3300032004 Bacteria 14064
179 Ga0307414_10002249 3300032004 Bacteria 10081
180 Ga0307414_10005514 3300032004 Bacteria 6976
181 Ga0307414_10010487 3300032004 Bacteria 5381
182 Ga0307414_10010569 3300032004 Bacteria 5366
183 Ga0307414_10047763 3300032004 Bacteria 2948
184 Ga0307414_10071603 3300032004 Bacteria 2501
185 Ga0307414_10108279 3300032004 Bacteria 2108
186 Ga0307411_10119080 3300032005 Bacteria 1906
187 Ga0307510_10005470 3300033180 Bacteria 15135
188 Ga0395899_0000027 3300037312 Bacteria 337387
189 Ga0395899_0004227 3300037312 Bacteria 11253
190 Ga0395899_0006674 3300037312 Bacteria 8940
191 Ga0395900_0002139 3300037418 Bacteria 22114
192 Ga0395900_0010672 3300037418 Bacteria 9395
193 Ga0395900_0049461 3300037418 Bacteria 4331
194 Ga0395898_0033349 3300037466 Bacteria 5140
195 Ga0395898_0067572 3300037466 Bacteria 3460
196 Ga0395905_0000729 3300037471 Bacteria 43376
197 Ga0395901_0003992 3300038443 Bacteria 14854
198 Ga0395901_0023191 3300038443 Bacteria 6362
199 Ga0436361_1223234 3300039447 Bacteria 16015
200 Ga0439448_0007278 3300042005 Bacteria 3204
201 Ga0439455_0004713 3300042012 Bacteria 2720
202 Ga0466959_0108696 3300045049 Bacteria 1981
203 Ga0495651_0016810 3300046462 Bacteria 5667
204 Ga0495650_0000107 3300046471 Bacteria 200864
205 Ga0495585_0000753 3300046492 Bacteria 28699
206 Ga0495596_0073723 3300046500 Bacteria 1325
207 Ga0495606_0000303 3300046507 Bacteria 84874
208 Ga0495610_0000289 3300046512 Bacteria 52803
209 Ga0495610_0002888 3300046512 Bacteria 13909
210 Ga0495616_0004837 3300046513 Bacteria 8436
211 Ga0495631_0001423 3300046518 Bacteria 14537
212 Ga0495637_0057891 3300046520 Bacteria 1599
213 Ga0495644_0003251 3300046523 Bacteria 6423
214 Ga0495652_0116147 3300046529 Bacteria 2143
215 Ga0495609_0008812 3300046538 Bacteria 4910
216 Ga0495609_0014257 3300046538 Bacteria 3741
217 Ga0495633_0003813 3300046558 Bacteria 9866
218 Ga0495625_0000021 3300046660 Bacteria 282133
219 Ga0495661_0006212 3300046665 Bacteria 8406
220 Ga0495649_0000009 3300046694 Bacteria 451725
221 Ga0495687_003939 3300047443 Bacteria 10391
222 Ga0495685_041395 3300047447 Bacteria 1575
223 Ga0495686_0029512 3300047472 Bacteria 3567
224 Ga0496117_0000934 3300048920 Bacteria 44763
225 Ga0496118_0165560 3300048921 Bacteria 1359
226 Ga0496122_0007550 3300048925 Bacteria 12037
227 Ga0496122_0053385 3300048925 Bacteria 3047
228 Ga0496123_0000866 3300048926 Bacteria 48135
229 Ga0496123_0052241 3300048926 Bacteria 2714
230 Ga0501223_000109 3300049663 Bacteria 23861
231 Ga0501240_000077 3300049673 Bacteria 6010
232 Ga0501241_000397 3300049758 Bacteria 9529
233 Ga0501241_000758 3300049758 Bacteria 6935
234 nmdc:mga0k408_1446_c1 3300050493 Bacteria 12847
235 nmdc:mga0k408_23183_c1 3300050493 Bacteria 3499
236 Ga0500651_0000188 3300053093 Bacteria 39379
237 Ga0500608_005103 3300053122 Bacteria 5173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0052241 Ga0496123_0052241_48_1058 336
2 3300009551 Ga0105238_10055142 Ga0105238_100551423 339
3 3300015262 Ga0182007_10005614 Ga0182007_100056141 343
4 3300046500 Ga0495596_0073723 Ga0495596_0073723_220_1296 352
5 3300017792 Ga0163161_10084497 Ga0163161_100844973 364
6 3300009174 Ga0105241_10293416 Ga0105241_102934162 367
7 3300031548 Ga0307408_100000151 Ga0307408_10000015126 374
8 3300005288 Ga0065714_10097620 Ga0065714_100976202 376
9 3300032004 Ga0307414_10010569 Ga0307414_100105693 391
10 3300013307 Ga0157372_10002106 Ga0157372_1000210620 394
11 3300020077 Ga0206351_11017393 Ga0206351_110173937 394
12 iso_pu_bacteria 2842903701 2842904837 396
13 iso_pu_bacteria 2738541284 2738761865 397
14 iso_pu_bacteria 2738543023 2739302212 397
15 iso_pu_bacteria 2739367663 2739646471 397
16 iso_pu_bacteria 2775506987 2776615490 397
17 iso_pu_bacteria 2852627209 2852631121 397
18 iso_pu_bacteria 2919186247 2919188698 397
19 iso_pu_bacteria 2939664404 2939667147 397
20 iso_pu_bacteria 2585427687 2586208222 398
21 iso_pu_bacteria 2738541283 2738759023 398
22 iso_pu_bacteria 2739367651 2739587753 398
23 iso_pu_bacteria 2842722452 2842724460 398
24 iso_pu_bacteria 2842909656 2842912046 398
25 iso_pu_bacteria 2849281842 2849285605 398
26 iso_pu_bacteria 2857627736 2857629924 398
27 iso_pu_bacteria 2904445276 2904448339 398
28 iso_pu_bacteria 2945997725 2945998691 398
29 iso_pu_bacteria 2954016120 2954021143 398
30 3300005289 Ga0065704_10003614 Ga0065704_100036143 400
31 3300009148 Ga0105243_10000018 Ga0105243_1000001812 400
32 3300025935 Ga0207709_10000021 Ga0207709_10000021181 400
33 3300030731 Ga0316177_1195072 Ga0316177_11950725 400
34 3300030742 Ga0316183_1098725 Ga0316183_109872538 400
35 3300030744 Ga0316181_1105588 Ga0316181_11055882 400
36 3300030745 Ga0316182_1372759 Ga0316182_13727591 400
37 3300048920 Ga0496117_0000934 Ga0496117_0000934_10814_12049 400
38 3300048921 Ga0496118_0165560 Ga0496118_0165560_79_1314 400
39 3300048925 Ga0496122_0053385 Ga0496122_0053385_394_1629 400
40 iso_pu_bacteria 2896344016 2896345198 400
41 3300005288 Ga0065714_10005395 Ga0065714_100053952 401
42 3300005288 Ga0065714_10006626 Ga0065714_100066262 401
43 3300005289 Ga0065704_10081318 Ga0065704_100813182 401
44 3300013100 Ga0157373_10000125 Ga0157373_100001256 401
45 3300013102 Ga0157371_10023271 Ga0157371_100232713 401
46 3300013102 Ga0157371_10063222 Ga0157371_100632222 401
47 3300013104 Ga0157370_10039156 Ga0157370_100391565 401
48 3300013104 Ga0157370_10104435 Ga0157370_101044351 401
49 3300013104 Ga0157370_10105076 Ga0157370_101050761 401
50 3300014497 Ga0182008_10000002 Ga0182008_10000002192 401
51 3300014497 Ga0182008_10008112 Ga0182008_100081122 401
52 3300014497 Ga0182008_10065261 Ga0182008_100652612 401
53 3300015261 Ga0182006_1011248 Ga0182006_10112483 401
54 3300015262 Ga0182007_10005257 Ga0182007_100052572 401
55 3300015682 Ga0183373_1009 Ga0183373_100971 401
56 3300031911 Ga0307412_10000038 Ga0307412_10000038166 401
57 3300032004 Ga0307414_10001061 Ga0307414_1000106112 401
58 3300032004 Ga0307414_10005514 Ga0307414_100055145 401
59 3300049758 Ga0501241_000397 Ga0501241_000397_7321_8535 401
60 3300049758 Ga0501241_000758 Ga0501241_000758_3348_4562 401
61 3300053093 Ga0500651_0000188 Ga0500651_0000188_15597_16811 401
62 iso_pu_bacteria 2721755487 2722726418 401
63 iso_pu_bacteria 2890737413 2890739340 401
64 iso_pu_bacteria 2896317667 2896319345 401
65 iso_pu_bacteria 2898713307 2898713617 401
66 iso_pu_bacteria 2902048731 2902052923 401
67 iso_pu_bacteria 2904780799 2904783712 401
68 iso_pu_bacteria 2919177583 2919182262 401
69 iso_pu_bacteria 3003233435 3003233443 401
70 iso_pu_bacteria 8055588893 8055591162 401
71 3300003781 Ga0055536_1000010 Ga0055536_1000010249 402
72 3300003791 Ga0055530_10001512 Ga0055530_1000151214 402
73 3300005288 Ga0065714_10008402 Ga0065714_100084022 402
74 3300009545 Ga0105237_10000120 Ga0105237_1000012035 402
75 3300013100 Ga0157373_10007861 Ga0157373_100078614 402
76 3300013104 Ga0157370_10000125 Ga0157370_100001254 402
77 3300013105 Ga0157369_10000373 Ga0157369_1000037348 402
78 3300013306 Ga0163162_10000036 Ga0163162_100000366 402
79 3300014497 Ga0182008_10000122 Ga0182008_100001227 402
80 3300014497 Ga0182008_10000438 Ga0182008_100004381 402
81 3300015261 Ga0182006_1001113 Ga0182006_10011138 402
82 3300015261 Ga0182006_1021888 Ga0182006_10218882 402
83 3300015261 Ga0182006_1031473 Ga0182006_10314732 402
84 3300015262 Ga0182007_10000009 Ga0182007_10000009255 402
85 3300017792 Ga0163161_10000194 Ga0163161_1000019412 402
86 3300017792 Ga0163161_10067301 Ga0163161_100673011 402
87 3300017792 Ga0163161_10074526 Ga0163161_100745263 402
88 3300017792 Ga0163161_10289374 Ga0163161_102893741 402
89 3300025292 Ga0209676_1000009 Ga0209676_1000009629 402
90 3300025298 Ga0209050_1000190 Ga0209050_100019028 402
91 3300025914 Ga0207671_10001385 Ga0207671_1000138524 402
92 3300031731 Ga0307405_10000016 Ga0307405_1000001612 402
93 3300031903 Ga0307407_10000012 Ga0307407_10000012116 402
94 3300032002 Ga0307416_100000024 Ga0307416_1000000248 402
95 3300032004 Ga0307414_10047763 Ga0307414_100477632 402
96 3300032004 Ga0307414_10071603 Ga0307414_100716033 402
97 3300046512 Ga0495610_0000289 Ga0495610_0000289_16710_17933 402
98 3300046538 Ga0495609_0014257 Ga0495609_0014257_1403_2620 402
99 3300048925 Ga0496122_0007550 Ga0496122_0007550_7989_9206 402
100 3300048926 Ga0496123_0000866 Ga0496123_0000866_41400_42617 402
101 3300031548 Ga0307408_100002559 Ga0307408_1000025596 403
102 3300031911 Ga0307412_10001770 Ga0307412_100017707 403
103 3300032004 Ga0307414_10002249 Ga0307414_100022493 403
104 3300032004 Ga0307414_10010487 Ga0307414_100104872 403
105 3300032004 Ga0307414_10108279 Ga0307414_101082792 403
106 3300032005 Ga0307411_10119080 Ga0307411_101190802 403
107 3300049663 Ga0501223_000109 Ga0501223_000109_11622_12860 403
108 3300049673 Ga0501240_000077 Ga0501240_000077_1010_2245 403
109 3300037312 Ga0395899_0000027 Ga0395899_0000027_41577_42833 406
110 iso_pu_bacteria 2738541302 2738856324 411
111 iso_pu_bacteria 2739367656 2739614566 411
112 iso_pu_bacteria 2818991437 2819545654 411
113 3300042005 Ga0439448_0007278 Ga0439448_0007278_412_1665 412
114 3300042012 Ga0439455_0004713 Ga0439455_0004713_640_1893 412
115 3300037312 Ga0395899_0004227 Ga0395899_0004227_8756_10024 413
116 3300037418 Ga0395900_0010672 Ga0395900_0010672_2899_4167 413
117 3300037466 Ga0395898_0033349 Ga0395898_0033349_1365_2633 413
118 3300037471 Ga0395905_0000729 Ga0395905_0000729_24078_25346 413
119 3300038443 Ga0395901_0023191 Ga0395901_0023191_1573_2841 413
120 iso_pu_bacteria 2852623160 2852625562 414
121 iso_pu_bacteria 2884933994 2884934566 414
122 3300002773 JGI25152J39213_1000050 JGI25152J39213_100005048 415
123 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003148 415
124 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002148 415
125 3300003215 JGI25153J46596_10000030 JGI25153J46596_10000030138 415
126 3300005288 Ga0065714_10006345 Ga0065714_100063453 415
127 3300009036 Ga0105244_10082373 Ga0105244_100823731 415
128 3300013102 Ga0157371_10000143 Ga0157371_1000014376 415
129 3300025245 Ga0207425_1000003 Ga0207425_1000003690 415
130 3300025258 Ga0209129_1000014 Ga0209129_1000014143 415
131 3300025294 Ga0209025_1000007 Ga0209025_1000007689 415
132 3300025297 Ga0209758_1000012 Ga0209758_1000012690 415
133 3300028786 Ga0307517_10000207 Ga0307517_1000020735 415
134 3300033180 Ga0307510_10005470 Ga0307510_100054705 415
135 3300046518 Ga0495631_0001423 Ga0495631_0001423_8809_10074 415
136 3300005355 Ga0070671_100010058 Ga0070671_1000100584 417
137 3300005535 Ga0070684_100246317 Ga0070684_1002463171 417
138 3300005563 Ga0068855_100259884 Ga0068855_1002598841 417
139 3300009093 Ga0105240_10000371 Ga0105240_1000037158 417
140 3300009093 Ga0105240_10391374 Ga0105240_103913742 417
141 3300009174 Ga0105241_10013554 Ga0105241_100135543 417
142 3300009545 Ga0105237_10000632 Ga0105237_100006327 417
143 3300009545 Ga0105237_10113021 Ga0105237_101130212 417
144 3300009551 Ga0105238_10163327 Ga0105238_101633272 417
145 3300010375 Ga0105239_10498122 Ga0105239_104981221 417
146 3300011119 Ga0105246_10092880 Ga0105246_100928803 417
147 3300013100 Ga0157373_10001788 Ga0157373_100017889 417
148 3300013306 Ga0163162_10120380 Ga0163162_101203802 417
149 3300013307 Ga0157372_10000404 Ga0157372_1000040442 417
150 3300013308 Ga0157375_10036678 Ga0157375_100366783 417
151 3300021361 Ga0213872_10010139 Ga0213872_100101393 417
152 3300025913 Ga0207695_10000142 Ga0207695_1000014225 417
153 3300025913 Ga0207695_10045798 Ga0207695_100457981 417
154 3300025914 Ga0207671_10000110 Ga0207671_100001105 417
155 3300025924 Ga0207694_10211475 Ga0207694_102114752 417
156 3300025931 Ga0207644_10006015 Ga0207644_100060157 417
157 3300025949 Ga0207667_10073227 Ga0207667_100732272 417
158 3300037312 Ga0395899_0006674 Ga0395899_0006674_6390_7643 417
159 3300037418 Ga0395900_0049461 Ga0395900_0049461_2112_3365 417
160 3300037466 Ga0395898_0067572 Ga0395898_0067572_564_1817 417
161 3300038443 Ga0395901_0003992 Ga0395901_0003992_3673_4926 417
162 3300039447 Ga0436361_1223234 Ga0436361_1223234_9327_10580 417
163 iso_pu_bacteria 2599185184 2599479673 417
164 iso_pu_bacteria 2928078545 2928083771 417
165 iso_pu_bacteria 2928147474 2928152212 417
166 iso_pu_bacteria 2932082852 2932084775 417
167 3300005339 Ga0070660_100003098 Ga0070660_1000030982 418
168 3300005366 Ga0070659_100000199 Ga0070659_1000001997 418
169 3300025250 Ga0209026_1000683 Ga0209026_10006836 418
170 3300025919 Ga0207657_10113932 Ga0207657_101139322 418
171 3300025932 Ga0207690_10001029 Ga0207690_1000102915 418
172 3300046523 Ga0495644_0003251 Ga0495644_0003251_540_1799 418
173 3300046665 Ga0495661_0006212 Ga0495661_0006212_4628_5896 418
174 3300047447 Ga0495685_041395 Ga0495685_041395_268_1527 418
175 3300005614 Ga0068856_100069209 Ga0068856_1000692093 420
176 3300009545 Ga0105237_10002670 Ga0105237_1000267011 420
177 3300010375 Ga0105239_10000086 Ga0105239_100000863 420
178 3300025913 Ga0207695_10108349 Ga0207695_101083492 420
179 3300025914 Ga0207671_10015940 Ga0207671_100159403 420
180 3300026078 Ga0207702_10062382 Ga0207702_100623823 420
181 3300046462 Ga0495651_0016810 Ga0495651_0016810_1869_3140 420
182 3300046529 Ga0495652_0116147 Ga0495652_0116147_188_1459 420
183 3300001904 JGI24736J21556_1002505 JGI24736J21556_10025052 421
184 3300001990 JGI24737J22298_10000384 JGI24737J22298_100003844 421
185 3300001990 JGI24737J22298_10007737 JGI24737J22298_100077371 421
186 3300002067 JGI24735J21928_10000003 JGI24735J21928_1000000393 421
187 3300002077 JGI24744J21845_10003083 JGI24744J21845_100030832 421
188 3300003316 rootH1_10052326 rootH1_100523264 421
189 3300003320 rootH2_10005722 rootH2_100057224 421
190 3300003323 rootH1_10114888 rootH1_101148884 421
191 3300005327 Ga0070658_10000060 Ga0070658_1000006035 421
192 3300005328 Ga0070676_10000152 Ga0070676_1000015212 421
193 3300005338 Ga0068868_100063493 Ga0068868_1000634932 421
194 3300005338 Ga0068868_100133177 Ga0068868_1001331772 421
195 3300005339 Ga0070660_100059209 Ga0070660_1000592091 421
196 3300005339 Ga0070660_100106585 Ga0070660_1001065851 421
197 3300005364 Ga0070673_100024947 Ga0070673_1000249473 421
198 3300005456 Ga0070678_100008100 Ga0070678_1000081004 421
199 3300005457 Ga0070662_100000935 Ga0070662_1000009357 421
200 3300005459 Ga0068867_100002522 Ga0068867_1000025229 421
201 3300005539 Ga0068853_100191460 Ga0068853_1001914601 421
202 3300005543 Ga0070672_100070313 Ga0070672_1000703132 421
203 3300005548 Ga0070665_100000264 Ga0070665_10000026448 421
204 3300005563 Ga0068855_100063015 Ga0068855_1000630152 421
205 3300005563 Ga0068855_100242834 Ga0068855_1002428342 421
206 3300005614 Ga0068856_100010799 Ga0068856_1000107993 421
207 3300005616 Ga0068852_100000389 Ga0068852_10000038929 421
208 3300006195 Ga0075366_10026040 Ga0075366_100260402 421
209 3300006195 Ga0075366_10068088 Ga0075366_100680883 421
210 3300006237 Ga0097621_100000232 Ga0097621_10000023234 421
211 3300006358 Ga0068871_100000800 Ga0068871_1000008002 421
212 3300006881 Ga0068865_100001329 Ga0068865_1000013294 421
213 3300009093 Ga0105240_10322437 Ga0105240_103224372 421
214 3300009093 Ga0105240_10451503 Ga0105240_104515031 421
215 3300009174 Ga0105241_10007118 Ga0105241_100071182 421
216 3300009174 Ga0105241_10009788 Ga0105241_100097883 421
217 3300009545 Ga0105237_10000535 Ga0105237_1000053513 421
218 3300009551 Ga0105238_10000612 Ga0105238_1000061221 421
219 3300010375 Ga0105239_10222094 Ga0105239_102220941 421
220 3300010375 Ga0105239_10274823 Ga0105239_102748232 421
221 3300013102 Ga0157371_10031826 Ga0157371_100318263 421
222 3300013105 Ga0157369_10166787 Ga0157369_101667873 421
223 3300013296 Ga0157374_10006785 Ga0157374_100067856 421
224 3300013296 Ga0157374_10006972 Ga0157374_100069724 421
225 3300013296 Ga0157374_10085050 Ga0157374_100850502 421
226 3300013297 Ga0157378_10019254 Ga0157378_100192543 421
227 3300013306 Ga0163162_10000008 Ga0163162_10000008105 421
228 3300013306 Ga0163162_10005924 Ga0163162_100059244 421
229 3300013307 Ga0157372_10000514 Ga0157372_100005142 421
230 3300013308 Ga0157375_10130161 Ga0157375_101301612 421
231 3300014745 Ga0157377_10130071 Ga0157377_101300712 421
232 3300014969 Ga0157376_10083562 Ga0157376_100835622 421
233 3300025231 Ga0207427_100131 Ga0207427_10013147 421
234 3300025233 Ga0209437_100048 Ga0209437_10004863 421
235 3300025261 Ga0209233_1000029 Ga0209233_1000029314 421
236 3300025904 Ga0207647_10000546 Ga0207647_100005466 421
237 3300025907 Ga0207645_10000948 Ga0207645_1000094822 421
238 3300025909 Ga0207705_10000233 Ga0207705_1000023335 421
239 3300025911 Ga0207654_10025113 Ga0207654_100251132 421
240 3300025911 Ga0207654_10073320 Ga0207654_100733201 421
241 3300025913 Ga0207695_10046589 Ga0207695_100465893 421
242 3300025913 Ga0207695_10232972 Ga0207695_102329722 421
243 3300025919 Ga0207657_10018794 Ga0207657_100187942 421
244 3300025919 Ga0207657_10032033 Ga0207657_100320333 421
245 3300025932 Ga0207690_10040176 Ga0207690_100401761 421
246 3300025933 Ga0207706_10000013 Ga0207706_1000001362 421
247 3300025938 Ga0207704_10000405 Ga0207704_100004055 421
248 3300025949 Ga0207667_10000014 Ga0207667_10000014120 421
249 3300025949 Ga0207667_10053016 Ga0207667_100530163 421
250 3300025960 Ga0207651_10017246 Ga0207651_100172463 421
251 3300026023 Ga0207677_10246312 Ga0207677_102463121 421
252 3300026041 Ga0207639_10143021 Ga0207639_101430211 421
253 3300026078 Ga0207702_10022067 Ga0207702_100220675 421
254 3300026089 Ga0207648_10001141 Ga0207648_1000114116 421
255 3300026121 Ga0207683_10028058 Ga0207683_100280583 421
256 3300026142 Ga0207698_10049524 Ga0207698_100495242 421
257 3300028379 Ga0268266_10000268 Ga0268266_1000026847 421
258 3300037418 Ga0395900_0002139 Ga0395900_0002139_1147_2415 421
259 3300045049 Ga0466959_0108696 Ga0466959_0108696_36_1304 421
260 3300046471 Ga0495650_0000107 Ga0495650_0000107_145457_146725 421
261 3300046492 Ga0495585_0000753 Ga0495585_0000753_2677_3984 421
262 3300046507 Ga0495606_0000303 Ga0495606_0000303_38174_39442 421
263 3300046512 Ga0495610_0002888 Ga0495610_0002888_7062_8369 421
264 3300046513 Ga0495616_0004837 Ga0495616_0004837_617_1885 421
265 3300046520 Ga0495637_0057891 Ga0495637_0057891_23_1291 421
266 3300046538 Ga0495609_0008812 Ga0495609_0008812_2331_3638 421
267 3300046558 Ga0495633_0003813 Ga0495633_0003813_2672_3979 421
268 3300046660 Ga0495625_0000021 Ga0495625_0000021_77543_78850 421
269 3300046694 Ga0495649_0000009 Ga0495649_0000009_380677_381945 421
270 3300047443 Ga0495687_003939 Ga0495687_003939_5728_7035 421
271 3300047472 Ga0495686_0029512 Ga0495686_0029512_1600_2907 421
272 3300050493 nmdc:mga0k408_1446_c1 nmdc:mga0k408_1446_c1_9957_11264 421
273 3300050493 nmdc:mga0k408_23183_c1 nmdc:mga0k408_23183_c1_2042_3310 421
274 3300053122 Ga0500608_005103 Ga0500608_005103_2358_3623 421

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f0k-assembly1.cif.gz_F alternative complex iii 0.9084 16 417
6f0k-assembly1.cif.gz_F alternative complex iii 0.9016 16 417
6btm-assembly1.cif.gz_F structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.9008 11 421
6loe-assembly1.cif.gz_F cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8974 15 418
6btm-assembly1.cif.gz_F structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.8964 11 421
ID Description Score Start End Superfamily
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6743 42 360 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6377 42 360 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6195 48 357 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6003 48 357 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.4652 41 360 1.20.1630.10
ID Description Score Start End GO Terms
AF-A0A1J5PBS0-F1-model_v4 Uncharacterized protein 0.9732 52 289 GO:0016020
AF-A0A1J5PBS0-F1-model_v4 Uncharacterized protein 0.9613 52 289 GO:0016020
AF-A0A4Q3L7V8-F1-model_v4 deleted 0.9567 1 334
AF-A0A7Y5C149-F1-model_v4 Quinol:cytochrome C oxidoreductase 0.9542 16 421 GO:0016020
AF-A0A2E4BDB9-F1-model_v4 Quinol:cytochrome C oxidoreductase 0.9541 40 364 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map