F379273

General Info

Members Datasets Scaffolds Average Seq Length
273 205 546 114

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0096703|Ga0496105_0096703_1303_1683
Length 126
Sequence MTRADPAAALHFLRRGQLVLASLDPAMGNEASKTCPVVIVSNNTANAAAVRVGGVVTVVPVTTNTARILPFQVLLPAAETGLPHDSKAQAEQVRSLSISRICGIVGWVQSALLGEIDEALRLHLSL

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
96 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
97 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
101 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
106 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
199 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
200 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
201 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
202 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
203 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
204 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
205 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 1.47
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.73
Rhizoplane 2.2
Rhizosphere 90.84
Stem 0
Stem Tuber 0
Unclassified 17.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0096703 3300048908 Bacteria 2439
2 JGI24740J21852_10109935 3300001979 Unclassified 696
3 rootH2_10332410 3300003320 Unclassified 1484
4 Ga0070658_10551018 3300005327 Bacteria 998
5 Ga0070658_10781528 3300005327 Unclassified 829
6 Ga0070683_100547957 3300005329 Bacteria 1106
7 Ga0070682_100184245 3300005337 Unclassified 1461
8 Ga0070682_100851099 3300005337 Unclassified 745
9 Ga0070660_100812233 3300005339 Bacteria 787
10 Ga0070692_10553308 3300005345 Bacteria 754
11 Ga0070714_100000010 3300005435 Bacteria 262871
12 Ga0070714_100413717 3300005435 Bacteria 1276
13 Ga0070714_101057969 3300005435 Unclassified 790
14 Ga0070713_100121302 3300005436 Bacteria 2293
15 Ga0070705_100041602 3300005440 Bacteria 2621
16 Ga0070694_100764024 3300005444 Bacteria 790
17 Ga0070708_100005891 3300005445 Bacteria 9736
18 Ga0070708_100058594 3300005445 Bacteria 3432
19 Ga0070708_100902874 3300005445 Bacteria 829
20 Ga0070708_100936239 3300005445 Bacteria 813
21 Ga0070681_10078076 3300005458 Bacteria 3268
22 Ga0068867_101778611 3300005459 Bacteria 579
23 Ga0070706_100015444 3300005467 Bacteria 7053
24 Ga0070706_100477008 3300005467 Bacteria 1160
25 Ga0070706_100975772 3300005467 Bacteria 782
26 Ga0070707_100022075 3300005468 Bacteria 6018
27 Ga0070707_100133324 3300005468 Bacteria 2416
28 Ga0070707_100225302 3300005468 Bacteria 1825
29 Ga0070707_100531854 3300005468 Unclassified 1137
30 Ga0070707_101002525 3300005468 Bacteria 800
31 Ga0070698_100010346 3300005471 Bacteria 9960
32 Ga0070698_100037372 3300005471 Bacteria 5007
33 Ga0070698_100185835 3300005471 Bacteria 2016
34 Ga0070698_100221508 3300005471 Bacteria 1825
35 Ga0070699_100286401 3300005518 Bacteria 1476
36 Ga0070699_101110438 3300005518 Bacteria 725
37 Ga0070699_101206785 3300005518 Bacteria 694
38 Ga0070679_100106940 3300005530 Unclassified 2783
39 Ga0070679_100460680 3300005530 Bacteria 1216
40 Ga0070679_100504467 3300005530 Bacteria 1154
41 Ga0070684_100085926 3300005535 Bacteria 2791
42 Ga0070697_100065110 3300005536 Bacteria 2978
43 Ga0070697_100173576 3300005536 Bacteria 1825
44 Ga0070697_100199166 3300005536 Unclassified 1702
45 Ga0068853_102244976 3300005539 Unclassified 529
46 Ga0070695_100138924 3300005545 Bacteria 1682
47 Ga0070696_100030650 3300005546 Unclassified 3684
48 Ga0070693_100965092 3300005547 Bacteria 643
49 Ga0070704_100041215 3300005549 Bacteria 3185
50 Ga0070704_100161062 3300005549 Unclassified 1775
51 Ga0068855_100917968 3300005563 Unclassified 924
52 Ga0068855_101095479 3300005563 Bacteria 833
53 Ga0068854_101706791 3300005578 Unclassified 576
54 Ga0070717_11107487 3300006028 Bacteria 721
55 Ga0070716_100819402 3300006173 Bacteria 722
56 Ga0070712_100660832 3300006175 Bacteria 889
57 Ga0075430_100094098 3300006846 Bacteria 2505
58 Ga0075431_100000884 3300006847 Bacteria 26373
59 Ga0075433_10135250 3300006852 Unclassified 2191
60 Ga0075433_11593363 3300006852 Unclassified 563
61 Ga0075434_101109171 3300006871 Unclassified 804
62 Ga0075429_100010113 3300006880 Bacteria 8174
63 Ga0068865_102075918 3300006881 Bacteria 516
64 Ga0075436_100668239 3300006914 Unclassified 768
65 Ga0105240_11399396 3300009093 Bacteria 735
66 Ga0114129_10173982 3300009147 Bacteria 2933
67 Ga0105243_12077710 3300009148 Bacteria 603
68 Ga0105237_11149779 3300009545 Bacteria 783
69 Ga0105238_11263100 3300009551 Bacteria 764
70 Ga0157373_10067662 3300013100 Bacteria 2525
71 Ga0157370_10650864 3300013104 Bacteria 963
72 Ga0157369_10041425 3300013105 Bacteria 5027
73 Ga0157369_10133603 3300013105 Unclassified 2628
74 Ga0157369_10611241 3300013105 Unclassified 1125
75 Ga0157372_10320039 3300013307 Bacteria 1806
76 Ga0157379_10675002 3300014968 Bacteria 969
77 Ga0157376_10073118 3300014969 Bacteria 2919
78 Ga0206349_1192717 3300020075 Bacteria 1370
79 Ga0206355_1395609 3300020076 Unclassified 828
80 Ga0206353_10015205 3300020082 Unclassified 1009
81 Ga0213875_10000459 3300021388 Bacteria 35263
82 Ga0213875_10588640 3300021388 Unclassified 537
83 Ga0224712_10012439 3300022467 Bacteria 2678
84 Ga0207653_10025544 3300025885 Bacteria 1889
85 Ga0207705_10470098 3300025909 Bacteria 976
86 Ga0207684_10006243 3300025910 Bacteria 10883
87 Ga0207684_10360613 3300025910 Bacteria 1251
88 Ga0207684_10605857 3300025910 Unclassified 935
89 Ga0207684_10801875 3300025910 Bacteria 796
90 Ga0207684_10998640 3300025910 Unclassified 700
91 Ga0207707_10861313 3300025912 Bacteria 751
92 Ga0207657_10686101 3300025919 Bacteria 796
93 Ga0207652_10467434 3300025921 Unclassified 1136
94 Ga0207652_10520109 3300025921 Bacteria 1071
95 Ga0207646_10000883 3300025922 Bacteria 38704
96 Ga0207646_10002119 3300025922 Bacteria 23747
97 Ga0207646_10013453 3300025922 Bacteria 7826
98 Ga0207646_10021184 3300025922 Bacteria 6011
99 Ga0207646_10127514 3300025922 Bacteria 2288
100 Ga0207646_10862446 3300025922 Unclassified 804
101 Ga0207700_10413038 3300025928 Bacteria 1184
102 Ga0207664_10000009 3300025929 Bacteria 299246
103 Ga0207664_10691309 3300025929 Bacteria 917
104 Ga0207664_10770433 3300025929 Bacteria 865
105 Ga0207661_10411176 3300025944 Bacteria 1228
106 Ga0207661_10870860 3300025944 Bacteria 829
107 Ga0207667_11240469 3300025949 Bacteria 724
108 Ga0207640_11384243 3300025981 Bacteria 630
109 Ga0207677_12284715 3300026023 Bacteria 503
110 Ga0207702_10118323 3300026078 Bacteria 2367
111 Ga0209974_10064898 3300027876 Bacteria 1239
112 Ga0307517_10347494 3300028786 Bacteria 807
113 Ga0307513_10004734 3300031456 Bacteria 18084
114 Ga0307408_100237272 3300031548 Bacteria 1497
115 Ga0307413_10059053 3300031824 Bacteria 2355
116 Ga0307410_11306621 3300031852 Bacteria 634
117 Ga0307406_11465488 3300031901 Bacteria 600
118 Ga0307411_11599422 3300032005 Unclassified 601
119 Ga0373944_0082577 3300035089 Unclassified 1063
120 Ga0373944_0165099 3300035089 Bacteria 787
121 Ga0373923_0046771 3300035111 Bacteria 1801
122 Ga0373936_0060094 3300035113 Bacteria 1550
123 Ga0373953_0048292 3300035117 Bacteria 1714
124 Ga0373954_0152368 3300035118 Bacteria 1129
125 Ga0373957_0016396 3300035120 Bacteria 2563
126 Ga0373943_0989637 3300035170 Unclassified 504
127 Ga0373946_0076051 3300035171 Bacteria 1461
128 Ga0373955_0007856 3300035172 Bacteria 4921
129 Ga0373924_0009811 3300035410 Bacteria 3518
130 Ga0373935_0128011 3300035692 Bacteria 1703
131 Ga0373927_0119043 3300035695 Bacteria 1723
132 Ga0373933_0004630 3300035724 Bacteria 7535
133 Ga0373937_0032775 3300036401 Bacteria 4713
134 Ga0373937_1879685 3300036401 Bacteria 545
135 Ga0316584_0467491 3300036712 Bacteria 890
136 Ga0373925_0069608 3300037068 Unclassified 2658
137 Ga0373925_0216222 3300037068 Bacteria 1528
138 Ga0436364_0548921 3300037853 Bacteria 70374
139 Ga0436364_0654836 3300037853 Bacteria 892
140 Ga0436364_0692224 3300037853 Bacteria 737
141 Ga0436364_0816562 3300037853 Bacteria 639
142 Ga0436364_1190589 3300037853 Bacteria 908
143 Ga0400485_08319 3300038735 Bacteria 132575
144 Ga0400486_10057 3300038742 Bacteria 45646
145 Ga0400489_45298 3300039093 Bacteria 1329
146 Ga0436361_0708248 3300039447 Unclassified 856
147 Ga0436362_0405284 3300039453 Bacteria 772
148 Ga0451789_1231897 3300041443 Bacteria 588
149 Ga0451791_1576231 3300041451 Bacteria 1393
150 Ga0451802_1664700 3300041460 Bacteria 652
151 Ga0451833_0270539 3300041491 Bacteria 823
152 Ga0451853_3749088 3300041512 Bacteria 511
153 Ga0450906_066613 3300042145 Bacteria 643
154 Ga0450910_094161 3300042147 Unclassified 533
155 Ga0466965_0075634 3300044683 Bacteria 1698
156 Ga0466961_0133142 3300044693 Bacteria 1558
157 Ga0466963_0227345 3300044694 Bacteria 1307
158 Ga0466963_0728786 3300044694 Bacteria 699
159 Ga0466960_0073794 3300044901 Bacteria 1703
160 Ga0466958_0976403 3300045836 Bacteria 553
161 Ga0466967_1362179 3300045976 Bacteria 707
162 Ga0495617_151688 3300046452 Bacteria 737
163 Ga0495592_0017788 3300046454 Bacteria 5403
164 Ga0495629_0078958 3300046459 Bacteria 2298
165 Ga0495641_0069521 3300046461 Bacteria 1582
166 Ga0495651_0027419 3300046462 Bacteria 4436
167 Ga0495653_0070016 3300046463 Bacteria 2626
168 Ga0495605_0190850 3300046474 Bacteria 896
169 Ga0495662_0233239 3300046476 Bacteria 907
170 Ga0495664_0018498 3300046477 Bacteria 3993
171 Ga0495585_0022906 3300046492 Bacteria 3585
172 Ga0495608_0015772 3300046511 Bacteria 5228
173 Ga0495618_0044555 3300046514 Bacteria 2798
174 Ga0495620_0055290 3300046515 Bacteria 1673
175 Ga0495628_0051878 3300046516 Bacteria 3241
176 Ga0495630_0022028 3300046517 Bacteria 4707
177 Ga0495644_0148354 3300046523 Bacteria 897
178 Ga0495652_0050078 3300046529 Bacteria 3573
179 Ga0495665_0086962 3300046531 Bacteria 1643
180 Ga0495640_0039471 3300046533 Bacteria 3312
181 Ga0495586_0124738 3300046535 Bacteria 1440
182 Ga0495587_0021296 3300046536 Bacteria 3998
183 Ga0495645_0000022 3300046543 Bacteria 137019
184 Ga0495645_0040940 3300046543 Bacteria 3378
185 Ga0495667_0010793 3300046559 Bacteria 6175
186 Ga0495634_0129400 3300046642 Bacteria 1610
187 Ga0495635_0039855 3300046663 Bacteria 3248
188 Ga0495661_0105558 3300046665 Bacteria 1577
189 Ga0495657_0025918 3300046675 Bacteria 4159
190 Ga0495599_0013059 3300046678 Bacteria 5127
191 Ga0495623_0036324 3300046679 Bacteria 3157
192 Ga0495646_0012365 3300046680 Bacteria 5428
193 Ga0495658_0064576 3300046683 Bacteria 2109
194 Ga0495613_0063057 3300046689 Bacteria 2712
195 Ga0495589_0095308 3300046794 Bacteria 1443
196 Ga0495600_0029411 3300046809 Bacteria 3557
197 Ga0495581_0078970 3300047315 Bacteria 1904
198 Ga0495604_0017847 3300047317 Bacteria 5676
199 Ga0495674_0037315 3300047319 Bacteria 4366
200 Ga0495680_0016367 3300047322 Bacteria 6374
201 Ga0495683_0042581 3300047323 Bacteria 2289
202 Ga0495675_0061070 3300047444 Bacteria 2388
203 Ga0495685_038192 3300047447 Bacteria 1645
204 Ga0495684_0043026 3300047471 Bacteria 3457
205 Ga0495593_0069127 3300047673 Bacteria 1837
206 Ga0495602_0015453 3300048088 Bacteria 7702
207 Ga0496111_0847321 3300048914 Bacteria 660
208 Ga0496113_0485732 3300048916 Unclassified 992
209 Ga0501031_0033527 3300049568 Bacteria 3350
210 Ga0501031_0371567 3300049568 Unclassified 925
211 Ga0501032_0044134 3300049569 Bacteria 3018
212 Ga0501032_0374405 3300049569 Bacteria 916
213 Ga0501032_0654339 3300049569 Unclassified 667
214 Ga0501033_1019184 3300049570 Unclassified 553
215 Ga0501034_0073775 3300049571 Bacteria 3421
216 Ga0501036_0128359 3300049572 Bacteria 2141
217 Ga0501036_0132136 3300049572 Bacteria 2107
218 Ga0501036_1261478 3300049572 Unclassified 601
219 Ga0501037_0496580 3300049573 Unclassified 828
220 Ga0501037_0588357 3300049573 Bacteria 748
221 Ga0501038_0026900 3300049574 Bacteria 5122
222 Ga0501039_0243231 3300049575 Bacteria 1415
223 Ga0501039_0254374 3300049575 Bacteria 1381
224 Ga0501040_0265025 3300049576 Bacteria 1226
225 Ga0501041_0031791 3300049577 Bacteria 3191
226 Ga0501041_0126534 3300049577 Bacteria 1591
227 Ga0501042_0597388 3300049578 Unclassified 802
228 Ga0501043_0144308 3300049579 Bacteria 1864
229 Ga0501046_0264788 3300049580 Bacteria 1262
230 Ga0501046_0391668 3300049580 Bacteria 1004
231 Ga0501047_0120476 3300049581 Unclassified 2506
232 Ga0501048_0583475 3300049582 Bacteria 802
233 Ga0501071_0235307 3300049587 Bacteria 1380
234 Ga0501071_0368060 3300049587 Bacteria 1095
235 Ga0501074_0325274 3300049590 Bacteria 1092
236 Ga0501075_0028652 3300049591 Bacteria 4111
237 Ga0501075_0078264 3300049591 Bacteria 2503
238 Ga0501076_0240986 3300049592 Bacteria 1479
239 Ga0501077_0633325 3300049593 Bacteria 687
240 Ga0501079_0108821 3300049741 Bacteria 2152
241 Ga0501079_0184978 3300049741 Bacteria 1626
242 Ga0501080_0231706 3300049742 Bacteria 1688
243 Ga0501080_0667576 3300049742 Bacteria 919
244 Ga0501080_0709230 3300049742 Unclassified 887
245 Ga0501081_0212432 3300049743 Bacteria 1405
246 Ga0501081_0696481 3300049743 Bacteria 763
247 Ga0501083_0143074 3300049744 Bacteria 1566
248 Ga0501083_0714815 3300049744 Unclassified 652
249 Ga0501035_0490928 3300049822 Unclassified 1012
250 Ga0501045_0107609 3300049824 Bacteria 2066
251 nmdc:mga05p37_210417_c1 3300050507 Bacteria 2351
252 nmdc:mga09592_6300_c1 3300050508 Bacteria 9665
253 nmdc:mga0qj67_84657_c1 3300050509 Bacteria 2543
254 nmdc:mga06r32_216_c1 3300050510 Bacteria 46547
255 nmdc:mga0n895_1384163_c1 3300050512 Unclassified 672
256 nmdc:mga08x19_363711_c1 3300050514 Bacteria 1011
257 nmdc:mga0a205_138793_c1 3300050515 Unclassified 2331
258 Ga0495601_0020212 3300053077 Bacteria 4066
259 Ga0495595_0019278 3300053084 Bacteria 2959
260 Ga0495619_0019516 3300053085 Bacteria 4311
261 Ga0501084_1006796 3300054114 Bacteria 700
262 Ga0501082_0047815 3300060353 Unclassified 3687
263 Ga0530510_0111814 3300061734 Bacteria 2001
264 Ga0530510_0122722 3300061734 Bacteria 1908
265 Ga0530510_0185404 3300061734 Bacteria 1544
266 2739607194 2739367654 Bacteria 6049412
267 2753070402 2751185734 Bacteria 8863695
268 2819693631 2818991463 Bacteria 7948711
269 2862384878 2862382967 Bacteria 10317375
270 2870729780 2870721527 Bacteria 9689237
271 2899363894 2899359706 Bacteria 10940472
272 8008559588 8008558824 Bacteria 10610750
273 8056579826 8056579771 Bacteria 5840325
274 Ga0496105_0096703
275 JGI24740J21852_10109935
276 rootH2_10332410
277 Ga0070658_10551018
278 Ga0070658_10781528
279 Ga0070683_100547957
280 Ga0070682_100184245
281 Ga0070682_100851099
282 Ga0070660_100812233
283 Ga0070692_10553308
284 Ga0070714_100000010
285 Ga0070714_100413717
286 Ga0070714_101057969
287 Ga0070713_100121302
288 Ga0070705_100041602
289 Ga0070694_100764024
290 Ga0070708_100005891
291 Ga0070708_100058594
292 Ga0070708_100902874
293 Ga0070708_100936239
294 Ga0070681_10078076
295 Ga0068867_101778611
296 Ga0070706_100015444
297 Ga0070706_100477008
298 Ga0070706_100975772
299 Ga0070707_100022075
300 Ga0070707_100133324
301 Ga0070707_100225302
302 Ga0070707_100531854
303 Ga0070707_101002525
304 Ga0070698_100010346
305 Ga0070698_100037372
306 Ga0070698_100185835
307 Ga0070698_100221508
308 Ga0070699_100286401
309 Ga0070699_101110438
310 Ga0070699_101206785
311 Ga0070679_100106940
312 Ga0070679_100460680
313 Ga0070679_100504467
314 Ga0070684_100085926
315 Ga0070697_100065110
316 Ga0070697_100173576
317 Ga0070697_100199166
318 Ga0068853_102244976
319 Ga0070695_100138924
320 Ga0070696_100030650
321 Ga0070693_100965092
322 Ga0070704_100041215
323 Ga0070704_100161062
324 Ga0068855_100917968
325 Ga0068855_101095479
326 Ga0068854_101706791
327 Ga0070717_11107487
328 Ga0070716_100819402
329 Ga0070712_100660832
330 Ga0075430_100094098
331 Ga0075431_100000884
332 Ga0075433_10135250
333 Ga0075433_11593363
334 Ga0075434_101109171
335 Ga0075429_100010113
336 Ga0068865_102075918
337 Ga0075436_100668239
338 Ga0105240_11399396
339 Ga0114129_10173982
340 Ga0105243_12077710
341 Ga0105237_11149779
342 Ga0105238_11263100
343 Ga0157373_10067662
344 Ga0157370_10650864
345 Ga0157369_10041425
346 Ga0157369_10133603
347 Ga0157369_10611241
348 Ga0157372_10320039
349 Ga0157379_10675002
350 Ga0157376_10073118
351 Ga0206349_1192717
352 Ga0206355_1395609
353 Ga0206353_10015205
354 Ga0213875_10000459
355 Ga0213875_10588640
356 Ga0224712_10012439
357 Ga0207653_10025544
358 Ga0207705_10470098
359 Ga0207684_10006243
360 Ga0207684_10360613
361 Ga0207684_10605857
362 Ga0207684_10801875
363 Ga0207684_10998640
364 Ga0207707_10861313
365 Ga0207657_10686101
366 Ga0207652_10467434
367 Ga0207652_10520109
368 Ga0207646_10000883
369 Ga0207646_10002119
370 Ga0207646_10013453
371 Ga0207646_10021184
372 Ga0207646_10127514
373 Ga0207646_10862446
374 Ga0207700_10413038
375 Ga0207664_10000009
376 Ga0207664_10691309
377 Ga0207664_10770433
378 Ga0207661_10411176
379 Ga0207661_10870860
380 Ga0207667_11240469
381 Ga0207640_11384243
382 Ga0207677_12284715
383 Ga0207702_10118323
384 Ga0209974_10064898
385 Ga0307517_10347494
386 Ga0307513_10004734
387 Ga0307408_100237272
388 Ga0307413_10059053
389 Ga0307410_11306621
390 Ga0307406_11465488
391 Ga0307411_11599422
392 Ga0373944_0082577
393 Ga0373944_0165099
394 Ga0373923_0046771
395 Ga0373936_0060094
396 Ga0373953_0048292
397 Ga0373954_0152368
398 Ga0373957_0016396
399 Ga0373943_0989637
400 Ga0373946_0076051
401 Ga0373955_0007856
402 Ga0373924_0009811
403 Ga0373935_0128011
404 Ga0373927_0119043
405 Ga0373933_0004630
406 Ga0373937_0032775
407 Ga0373937_1879685
408 Ga0316584_0467491
409 Ga0373925_0069608
410 Ga0373925_0216222
411 Ga0436364_0548921
412 Ga0436364_0654836
413 Ga0436364_0692224
414 Ga0436364_0816562
415 Ga0436364_1190589
416 Ga0400485_08319
417 Ga0400486_10057
418 Ga0400489_45298
419 Ga0436361_0708248
420 Ga0436362_0405284
421 Ga0451789_1231897
422 Ga0451791_1576231
423 Ga0451802_1664700
424 Ga0451833_0270539
425 Ga0451853_3749088
426 Ga0450906_066613
427 Ga0450910_094161
428 Ga0466965_0075634
429 Ga0466961_0133142
430 Ga0466963_0227345
431 Ga0466963_0728786
432 Ga0466960_0073794
433 Ga0466958_0976403
434 Ga0466967_1362179
435 Ga0495617_151688
436 Ga0495592_0017788
437 Ga0495629_0078958
438 Ga0495641_0069521
439 Ga0495651_0027419
440 Ga0495653_0070016
441 Ga0495605_0190850
442 Ga0495662_0233239
443 Ga0495664_0018498
444 Ga0495585_0022906
445 Ga0495608_0015772
446 Ga0495618_0044555
447 Ga0495620_0055290
448 Ga0495628_0051878
449 Ga0495630_0022028
450 Ga0495644_0148354
451 Ga0495652_0050078
452 Ga0495665_0086962
453 Ga0495640_0039471
454 Ga0495586_0124738
455 Ga0495587_0021296
456 Ga0495645_0000022
457 Ga0495645_0040940
458 Ga0495667_0010793
459 Ga0495634_0129400
460 Ga0495635_0039855
461 Ga0495661_0105558
462 Ga0495657_0025918
463 Ga0495599_0013059
464 Ga0495623_0036324
465 Ga0495646_0012365
466 Ga0495658_0064576
467 Ga0495613_0063057
468 Ga0495589_0095308
469 Ga0495600_0029411
470 Ga0495581_0078970
471 Ga0495604_0017847
472 Ga0495674_0037315
473 Ga0495680_0016367
474 Ga0495683_0042581
475 Ga0495675_0061070
476 Ga0495685_038192
477 Ga0495684_0043026
478 Ga0495593_0069127
479 Ga0495602_0015453
480 Ga0496111_0847321
481 Ga0496113_0485732
482 Ga0501031_0033527
483 Ga0501031_0371567
484 Ga0501032_0044134
485 Ga0501032_0374405
486 Ga0501032_0654339
487 Ga0501033_1019184
488 Ga0501034_0073775
489 Ga0501036_0128359
490 Ga0501036_0132136
491 Ga0501036_1261478
492 Ga0501037_0496580
493 Ga0501037_0588357
494 Ga0501038_0026900
495 Ga0501039_0243231
496 Ga0501039_0254374
497 Ga0501040_0265025
498 Ga0501041_0031791
499 Ga0501041_0126534
500 Ga0501042_0597388
501 Ga0501043_0144308
502 Ga0501046_0264788
503 Ga0501046_0391668
504 Ga0501047_0120476
505 Ga0501048_0583475
506 Ga0501071_0235307
507 Ga0501071_0368060
508 Ga0501074_0325274
509 Ga0501075_0028652
510 Ga0501075_0078264
511 Ga0501076_0240986
512 Ga0501077_0633325
513 Ga0501079_0108821
514 Ga0501079_0184978
515 Ga0501080_0231706
516 Ga0501080_0667576
517 Ga0501080_0709230
518 Ga0501081_0212432
519 Ga0501081_0696481
520 Ga0501083_0143074
521 Ga0501083_0714815
522 Ga0501035_0490928
523 Ga0501045_0107609
524 nmdc:mga05p37_210417_c1
525 nmdc:mga09592_6300_c1
526 nmdc:mga0qj67_84657_c1
527 nmdc:mga06r32_216_c1
528 nmdc:mga0n895_1384163_c1
529 nmdc:mga08x19_363711_c1
530 nmdc:mga0a205_138793_c1
531 Ga0495601_0020212
532 Ga0495595_0019278
533 Ga0495619_0019516
534 Ga0501084_1006796
535 Ga0501082_0047815
536 Ga0530510_0111814
537 Ga0530510_0122722
538 Ga0530510_0185404
539 2739607194
540 2753070402
541 2819693631
542 2862384878
543 2870729780
544 2899363894
545 8008559588
546 8056579826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

14

124

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l2a-assembly1.cif.gz_A-2 a mutant form of m. tb toxin mazef-mt1 0.9878 9 126
6l2a-assembly1.cif.gz_A-2 a mutant form of m. tb toxin mazef-mt1 0.9613 9 126
6kyt-assembly1.cif.gz_K the structure of the m. tb toxin mazef-mt1 complex 0.9568 10 125
6kyt-assembly1.cif.gz_J the structure of the m. tb toxin mazef-mt1 complex 0.9554 10 126
6kyt-assembly1.cif.gz_A the structure of the m. tb toxin mazef-mt1 complex 0.9497 12 126
ID Description Score Start End Superfamily
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9479 11 126 2.30.30.110
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9399 11 126 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8971 11 126 2.30.30.110
4hkeA00 Mainly Beta;Roll;SH3 type barrels.; 0.8941 10 126 2.30.30.110
af_P0CL62_2_115_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8886 13 126 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A2Y9BXD9-F1-model_v4 mRNA interferase MazF 0.9812 59 126 GO:0003677
AF-A0A6J4LQL2-F1-model_v4 Programmed cell death toxin YdcE 0.972 57 125 GO:0003677
AF-A3IN55-F1-model_v4 Transcriptional modulator of MazE/toxin, MazF 0.9623 57 125 GO:0003677
AF-A0A353BNV2-F1-model_v4 deleted 0.9587 55 125
AF-A0A2Y9BXD9-F1-model_v4 mRNA interferase MazF 0.9536 59 126 GO:0003677

Map