F379137

General Info

Members Datasets Scaffolds Average Seq Length
273 181 547 389

Family's Representative Sequence

Representative Sequence 3300035090|Ga0373949_0013344|Ga0373949_0013344_162_1406
Length 414
Sequence MNKRERGRLWRGSPADQEVGISMRYVGIDVGSDSHVVAAVTADGTVAVKPTGIAEDAAGYAKLFALLGQAPVALVAMEATGHYWRNLFAALAAHGYAVALLNPLRTRRFAGEDLERTKTDSIDALGIARFGAQKRPAATRLPDAAADELRELVRHRDRLVADFGDRVRQLHRLVDLGFPEFTRHVKSLDSMLACTLLAEYPNAQAFAGAPPRRLAKLVYDGVHKVGPELAAALIAAAKVSVGRHHGPAYRIQVRHTCQDLDLLRRRIRELDDDIARQLDDHEVGALLTSIDGIGTNTAARLIAELGDFSRFRNAAALAAYVGVVPGLKQSGKRRGQKAGLCPIGHARLRAALWMPLLVAVRRNPWLEAFYDRLIGRGKLPKVALVAALRKLLGAVFAVVRDRKPFVPRLGPAAA

Samples

Sample ID Description Type Environment
1 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
126 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373949_0013344 3300035090 Bacteria 1820
2 rootH1_10191444 3300003316 Unclassified 2077
3 rootH1_10191444 3300003323 Bacteria 1915
4 Ga0070658_10231865 3300005327 Bacteria 1563
5 Ga0070683_100226144 3300005329 Bacteria 1778
6 Ga0070683_100257355 3300005329 Bacteria 1660
7 Ga0070680_100179861 3300005336 Bacteria 1781
8 Ga0070682_100126451 3300005337 Bacteria 1724
9 Ga0070660_100047418 3300005339 Bacteria 3297
10 Ga0070660_100116463 3300005339 Unclassified 2131
11 Ga0070660_100239916 3300005339 Unclassified 1476
12 Ga0070691_10064894 3300005341 Bacteria 1762
13 Ga0070661_100017396 3300005344 Bacteria 5100
14 Ga0070661_100112734 3300005344 Bacteria 2032
15 Ga0070692_10053082 3300005345 Bacteria 2113
16 Ga0070659_100037264 3300005366 Bacteria 3790
17 Ga0070709_10022039 3300005434 Bacteria 3720
18 Ga0070709_10090459 3300005434 Bacteria 2017
19 Ga0070709_10251917 3300005434 Unclassified 1272
20 Ga0070714_100318259 3300005435 Bacteria 1454
21 Ga0070710_10135369 3300005437 Bacteria 1506
22 Ga0070711_100029046 3300005439 Bacteria 3645
23 Ga0070711_100201613 3300005439 Bacteria 1536
24 Ga0070663_100182591 3300005455 Bacteria 1628
25 Ga0070681_10239658 3300005458 Unclassified 1727
26 Ga0070681_10243067 3300005458 Bacteria 1713
27 Ga0070681_10362527 3300005458 Bacteria 1360
28 Ga0070699_100024648 3300005518 Bacteria 5186
29 Ga0070699_100122984 3300005518 Bacteria 2283
30 Ga0070679_100244011 3300005530 Bacteria 1753
31 Ga0070679_100442026 3300005530 Unclassified 1245
32 Ga0070684_100009745 3300005535 Bacteria 7582
33 Ga0070697_100221416 3300005536 Bacteria 1613
34 Ga0068853_100276507 3300005539 Bacteria 1547
35 Ga0070672_100297525 3300005543 Bacteria 1367
36 Ga0070696_100004679 3300005546 Bacteria 9146
37 Ga0068855_100140242 3300005563 Bacteria 2756
38 Ga0068855_100413526 3300005563 Bacteria 1476
39 Ga0070664_100069165 3300005564 Bacteria 3020
40 Ga0068857_100168598 3300005577 Bacteria 1989
41 Ga0068857_100200127 3300005577 Bacteria 1821
42 Ga0068857_100241428 3300005577 Bacteria 1654
43 Ga0068854_100204981 3300005578 Bacteria 1552
44 Ga0068854_100237179 3300005578 Unclassified 1451
45 Ga0068856_100006318 3300005614 Bacteria 11625
46 Ga0068852_100196241 3300005616 Unclassified 1908
47 Ga0068852_100344011 3300005616 Bacteria 1454
48 Ga0068864_100217242 3300005618 Bacteria 1762
49 Ga0068851_10004409 3300005834 Bacteria 6345
50 Ga0068863_100239908 3300005841 Bacteria 1749
51 Ga0081455_10093777 3300005937 Bacteria 2426
52 Ga0081540_1000989 3300005983 Bacteria 25631
53 Ga0070716_100164265 3300006173 Bacteria 1442
54 Ga0070712_100095653 3300006175 Bacteria 2186
55 Ga0075428_100260496 3300006844 Unclassified 1867
56 Ga0075431_100327579 3300006847 Bacteria 1543
57 Ga0075433_10103509 3300006852 Bacteria 2522
58 Ga0075434_100309515 3300006871 Bacteria 1600
59 Ga0075429_100046533 3300006880 Bacteria 3775
60 Ga0075436_100089255 3300006914 Bacteria 2142
61 Ga0099794_10055737 3300007265 Bacteria 1911
62 Ga0114129_10016403 3300009147 Bacteria 10542
63 Ga0114129_10454070 3300009147 Unclassified 1680
64 Ga0105241_10058533 3300009174 Bacteria 2959
65 Ga0105248_10393169 3300009177 Bacteria 1561
66 Ga0105237_10091408 3300009545 Bacteria 3033
67 Ga0105238_10269420 3300009551 Unclassified 1683
68 Ga0105249_10552098 3300009553 Bacteria 1203
69 Ga0105239_10013608 3300010375 Bacteria 9032
70 Ga0157373_10165243 3300013100 Bacteria 1558
71 Ga0157371_10083559 3300013102 Bacteria 2261
72 Ga0157370_10036267 3300013104 Bacteria 4786
73 Ga0157370_10263788 3300013104 Bacteria 1592
74 Ga0157369_10134422 3300013105 Bacteria 2619
75 Ga0157372_10420198 3300013307 Bacteria 1558
76 Ga0157372_10480236 3300013307 Unclassified 1449
77 Ga0182008_10049745 3300014497 Bacteria 2080
78 Ga0206356_11621294 3300020070 Bacteria 1929
79 Ga0213873_10020929 3300021358 Bacteria 1533
80 Ga0213872_10047637 3300021361 Bacteria 1948
81 Ga0213874_10024632 3300021377 Bacteria 1689
82 Ga0213874_10040185 3300021377 Bacteria 1395
83 Ga0213876_10100554 3300021384 Bacteria 1532
84 Ga0213875_10053613 3300021388 Bacteria 1888
85 Ga0213875_10070833 3300021388 Bacteria 1627
86 Ga0213871_10024820 3300021441 Bacteria 1521
87 Ga0207656_10063005 3300025321 Bacteria 1631
88 Ga0207692_10113012 3300025898 Bacteria 1509
89 Ga0207699_10047072 3300025906 Bacteria 2526
90 Ga0207699_10158069 3300025906 Bacteria 1506
91 Ga0207705_10181102 3300025909 Bacteria 1590
92 Ga0207684_10229395 3300025910 Bacteria 1602
93 Ga0207654_10146383 3300025911 Bacteria 1512
94 Ga0207707_10234045 3300025912 Bacteria 1598
95 Ga0207707_10265392 3300025912 Bacteria 1489
96 Ga0207695_10015110 3300025913 Bacteria 9109
97 Ga0207695_10108458 3300025913 Bacteria 2761
98 Ga0207671_10085808 3300025914 Bacteria 2366
99 Ga0207671_10184679 3300025914 Bacteria 1624
100 Ga0207693_10032816 3300025915 Bacteria 4097
101 Ga0207663_10167549 3300025916 Bacteria 1557
102 Ga0207663_10180463 3300025916 Bacteria 1507
103 Ga0207660_10193984 3300025917 Bacteria 1583
104 Ga0207657_10006960 3300025919 Bacteria 11648
105 Ga0207657_10177773 3300025919 Unclassified 1721
106 Ga0207657_10202193 3300025919 Bacteria 1597
107 Ga0207649_10071337 3300025920 Bacteria 2218
108 Ga0207649_10158938 3300025920 Bacteria 1564
109 Ga0207649_10170235 3300025920 Unclassified 1517
110 Ga0207652_10256198 3300025921 Bacteria 1578
111 Ga0207694_10074388 3300025924 Unclassified 2659
112 Ga0207694_10253053 3300025924 Unclassified 1442
113 Ga0207664_10251251 3300025929 Bacteria 1543
114 Ga0207664_10267115 3300025929 Bacteria 1498
115 Ga0207690_10188786 3300025932 Bacteria 1557
116 Ga0207665_10231064 3300025939 Bacteria 1359
117 Ga0207711_10239663 3300025941 Bacteria 1663
118 Ga0207689_10282392 3300025942 Bacteria 1375
119 Ga0207661_10245266 3300025944 Bacteria 1590
120 Ga0207661_10287691 3300025944 Bacteria 1470
121 Ga0207679_10183795 3300025945 Bacteria 1732
122 Ga0207679_10243417 3300025945 Bacteria 1525
123 Ga0207667_10092210 3300025949 Bacteria 3129
124 Ga0207667_10113746 3300025949 Bacteria 2790
125 Ga0207640_10153971 3300025981 Bacteria 1692
126 Ga0207639_10222417 3300026041 Bacteria 1631
127 Ga0207678_10226591 3300026067 Bacteria 1600
128 Ga0207702_10294160 3300026078 Bacteria 1539
129 Ga0207674_10250547 3300026116 Bacteria 1718
130 Ga0207674_10333915 3300026116 Bacteria 1466
131 Ga0207698_10258874 3300026142 Bacteria 1597
132 Ga0207698_10328696 3300026142 Unclassified 1435
133 Ga0268265_10225353 3300028380 Bacteria 1643
134 Ga0265338_10029094 3300028800 Bacteria 5489
135 Ga0265760_10025947 3300031090 Unclassified 1713
136 Ga0307410_10158526 3300031852 Bacteria 1693
137 Ga0307412_10061381 3300031911 Bacteria 2527
138 Ga0307409_100269166 3300031995 Bacteria 1568
139 Ga0307416_100276453 3300032002 Bacteria 1653
140 Ga0307415_100088109 3300032126 Bacteria 2239
141 Ga0373923_0059203 3300035111 Bacteria 1623
142 Ga0373957_0056231 3300035120 Unclassified 1514
143 Ga0373943_0054150 3300035170 Bacteria 1983
144 Ga0373955_0015896 3300035172 Bacteria 3693
145 Ga0373935_0115563 3300035692 Bacteria 1786
146 Ga0373927_0088317 3300035695 Unclassified 2012
147 Ga0373937_0147800 3300036401 Bacteria 2200
148 Ga0316584_0205544 3300036712 Bacteria 1451
149 Ga0373925_0161256 3300037068 Unclassified 1766
150 Ga0395900_0177343 3300037418 Bacteria 2167
151 Ga0395900_0215566 3300037418 Bacteria 1937
152 Ga0395905_0267700 3300037471 Bacteria 1594
153 Ga0436364_0075365 3300037853 Bacteria 2275
154 Ga0436364_1167807 3300037853 Bacteria 2966
155 Ga0395901_0186678 3300038443 Bacteria 2174
156 Ga0395901_0310844 3300038443 Bacteria 1632
157 Ga0436365_0459136 3300039437 Bacteria 2696
158 Ga0436365_1170734 3300039437 Bacteria 2146
159 Ga0436360_0142219 3300039438 Bacteria 2329
160 Ga0436360_0636450 3300039438 Bacteria 3015
161 Ga0436360_1072092 3300039438 Unclassified 1860
162 Ga0436361_0048069 3300039447 Bacteria 1809
163 Ga0436361_0152705 3300039447 Unclassified 1545
164 Ga0436361_0783757 3300039447 Bacteria 2916
165 Ga0436363_1244042 3300039450 Bacteria 5226
166 Ga0436363_1585868 3300039450 Bacteria 1853
167 Ga0436362_0449612 3300039453 Bacteria 2141
168 Ga0436362_0678733 3300039453 Bacteria 2376
169 Ga0436362_0983354 3300039453 Bacteria 1575
170 Ga0451853_3028276 3300041512 Bacteria 1650
171 Ga0439441_020413 3300042001 Bacteria 1214
172 Ga0439456_009985 3300042013 Bacteria 1960
173 Ga0439435_0031436 3300042436 Unclassified 1443
174 Ga0439444_0006709 3300042437 Bacteria 1747
175 Ga0439459_0007892 3300042438 Bacteria 1807
176 Ga0451577_0056580 3300042876 Bacteria 3498
177 Ga0451577_0061843 3300042876 Bacteria 3339
178 Ga0451577_0196984 3300042876 Unclassified 1818
179 Ga0451577_0231406 3300042876 Bacteria 1671
180 Ga0451577_0232486 3300042876 Bacteria 1667
181 Ga0466972_0044374 3300044658 Bacteria 2156
182 Ga0453684_0069090 3300044712 Bacteria 4482
183 Ga0453684_0240448 3300044712 Bacteria 2084
184 Ga0453684_0276057 3300044712 Bacteria 1918
185 Ga0453684_0286906 3300044712 Bacteria 1875
186 Ga0453684_0317509 3300044712 Bacteria 1765
187 Ga0453684_0406606 3300044712 Bacteria 1523
188 Ga0451576_0141019 3300045051 Bacteria 2513
189 Ga0451576_0380573 3300045051 Bacteria 1479
190 Ga0495651_0081530 3300046462 Bacteria 2442
191 Ga0495608_0095255 3300046511 Bacteria 1923
192 Ga0495640_0101421 3300046533 Bacteria 1889
193 Ga0495587_0097587 3300046536 Bacteria 1694
194 Ga0495667_0010311 3300046559 Bacteria 6321
195 Ga0495657_0112935 3300046675 Unclassified 1719
196 Ga0495646_0100822 3300046680 Unclassified 1656
197 Ga0495600_0096668 3300046809 Unclassified 1925
198 Ga0495680_0093254 3300047322 Bacteria 2254
199 Ga0495675_0003511 3300047444 Bacteria 9445
200 Ga0495684_0236224 3300047471 Unclassified 1335
201 Ga0495684_0274697 3300047471 Bacteria 1218
202 Ga0495602_0169064 3300048088 Unclassified 1698
203 Ga0501031_0116261 3300049568 Bacteria 1747
204 Ga0501032_0142996 3300049569 Bacteria 1575
205 Ga0501034_0184826 3300049571 Unclassified 2048
206 Ga0501036_0097108 3300049572 Bacteria 2491
207 Ga0501036_0202704 3300049572 Bacteria 1668
208 Ga0501036_0224171 3300049572 Bacteria 1578
209 Ga0501038_0200750 3300049574 Bacteria 1600
210 Ga0501038_0250817 3300049574 Bacteria 1402
211 Ga0501039_0101081 3300049575 Bacteria 2251
212 Ga0501039_0138346 3300049575 Bacteria 1912
213 Ga0501039_0155817 3300049575 Unclassified 1794
214 Ga0501039_0170209 3300049575 Bacteria 1713
215 Ga0501040_0064762 3300049576 Bacteria 2517
216 Ga0501040_0109476 3300049576 Bacteria 1931
217 Ga0501040_0168864 3300049576 Bacteria 1548
218 Ga0501041_0140037 3300049577 Bacteria 1508
219 Ga0501042_0119748 3300049578 Unclassified 1895
220 Ga0501042_0156352 3300049578 Bacteria 1644
221 Ga0501043_0171548 3300049579 Bacteria 1692
222 Ga0501046_0168221 3300049580 Bacteria 1646
223 Ga0501046_0176902 3300049580 Bacteria 1598
224 Ga0501048_0090916 3300049582 Bacteria 2153
225 Ga0501069_0111179 3300049585 Bacteria 1560
226 Ga0501070_0361550 3300049586 Bacteria 1177
227 Ga0501071_0122365 3300049587 Bacteria 1929
228 Ga0501071_0181600 3300049587 Bacteria 1576
229 Ga0501072_0042982 3300049588 Bacteria 3551
230 Ga0501072_0199441 3300049588 Bacteria 1595
231 Ga0501073_0192034 3300049589 Bacteria 1413
232 Ga0501075_0057411 3300049591 Bacteria 2931
233 Ga0501075_0074046 3300049591 Bacteria 2576
234 Ga0501075_0173139 3300049591 Bacteria 1647
235 Ga0501075_0196271 3300049591 Unclassified 1539
236 Ga0501076_0015146 3300049592 Bacteria 5822
237 Ga0501076_0126591 3300049592 Bacteria 2070
238 Ga0501076_0152288 3300049592 Bacteria 1881
239 Ga0501076_0165629 3300049592 Bacteria 1801
240 Ga0501076_0200979 3300049592 Bacteria 1627
241 Ga0501077_0078606 3300049593 Bacteria 2090
242 Ga0501077_0096707 3300049593 Bacteria 1871
243 Ga0501077_0119124 3300049593 Unclassified 1673
244 Ga0501077_0169052 3300049593 Bacteria 1389
245 Ga0501079_0076872 3300049741 Bacteria 2582
246 Ga0501079_0277662 3300049741 Bacteria 1310
247 Ga0501080_0239076 3300049742 Bacteria 1658
248 Ga0501080_0249842 3300049742 Bacteria 1617
249 Ga0501081_0085569 3300049743 Bacteria 2213
250 Ga0501081_0138161 3300049743 Bacteria 1745
251 Ga0501081_0204885 3300049743 Bacteria 1431
252 Ga0501083_0113009 3300049744 Bacteria 1784
253 Ga0501035_0143978 3300049822 Bacteria 2071
254 Ga0501044_0225041 3300049823 Bacteria 1826
255 Ga0501045_0074897 3300049824 Bacteria 2493
256 nmdc:mga05p37_598018_c1 3300050507 Unclassified 1246
257 nmdc:mga0qj67_225598_c1 3300050509 Bacteria 1521
258 nmdc:mga06r32_220813_c1 3300050510 Bacteria 1883
259 nmdc:mga0rr50_164067_c1 3300050513 Bacteria 1805
260 nmdc:mga08x19_59898_c1 3300050514 Bacteria 2465
261 nmdc:mga0a205_143386_c1 3300050515 Bacteria 2289
262 Ga0495601_0070443 3300053077 Bacteria 2232
263 Ga0495595_0020422 3300053084 Bacteria 2883
264 Ga0495619_0181898 3300053085 Bacteria 1454
265 Ga0501084_0126224 3300054114 Bacteria 2153
266 Ga0501084_0212820 3300054114 Unclassified 1631
267 Ga0501084_0216871 3300054114 Bacteria 1614
268 Ga0501084_0235785 3300054114 Bacteria 1544
269 Ga0501084_0277156 3300054114 Unclassified 1416
270 Ga0501082_0064123 3300060353 Bacteria 3164
271 Ga0501082_0105319 3300060353 Bacteria 2440
272 Ga0501082_0223994 3300060353 Bacteria 1636
273 Ga0530510_0064767 3300061734 Bacteria 2647
274 Ga0530510_0183607 3300061734 Bacteria 1551
275 Ga0373949_0013344
276 rootH1_10191444
277 Ga0070658_10231865
278 Ga0070683_100226144
279 Ga0070683_100257355
280 Ga0070680_100179861
281 Ga0070682_100126451
282 Ga0070660_100047418
283 Ga0070660_100116463
284 Ga0070660_100239916
285 Ga0070691_10064894
286 Ga0070661_100017396
287 Ga0070661_100112734
288 Ga0070692_10053082
289 Ga0070659_100037264
290 Ga0070709_10022039
291 Ga0070709_10090459
292 Ga0070709_10251917
293 Ga0070714_100318259
294 Ga0070710_10135369
295 Ga0070711_100029046
296 Ga0070711_100201613
297 Ga0070663_100182591
298 Ga0070681_10239658
299 Ga0070681_10243067
300 Ga0070681_10362527
301 Ga0070699_100024648
302 Ga0070699_100122984
303 Ga0070679_100244011
304 Ga0070679_100442026
305 Ga0070684_100009745
306 Ga0070697_100221416
307 Ga0068853_100276507
308 Ga0070672_100297525
309 Ga0070696_100004679
310 Ga0068855_100140242
311 Ga0068855_100413526
312 Ga0070664_100069165
313 Ga0068857_100168598
314 Ga0068857_100200127
315 Ga0068857_100241428
316 Ga0068854_100204981
317 Ga0068854_100237179
318 Ga0068856_100006318
319 Ga0068852_100196241
320 Ga0068852_100344011
321 Ga0068864_100217242
322 Ga0068851_10004409
323 Ga0068863_100239908
324 Ga0081455_10093777
325 Ga0081540_1000989
326 Ga0070716_100164265
327 Ga0070712_100095653
328 Ga0075428_100260496
329 Ga0075431_100327579
330 Ga0075433_10103509
331 Ga0075434_100309515
332 Ga0075429_100046533
333 Ga0075436_100089255
334 Ga0099794_10055737
335 Ga0114129_10016403
336 Ga0114129_10454070
337 Ga0105241_10058533
338 Ga0105248_10393169
339 Ga0105237_10091408
340 Ga0105238_10269420
341 Ga0105249_10552098
342 Ga0105239_10013608
343 Ga0157373_10165243
344 Ga0157371_10083559
345 Ga0157370_10036267
346 Ga0157370_10263788
347 Ga0157369_10134422
348 Ga0157372_10420198
349 Ga0157372_10480236
350 Ga0182008_10049745
351 Ga0206356_11621294
352 Ga0213873_10020929
353 Ga0213872_10047637
354 Ga0213874_10024632
355 Ga0213874_10040185
356 Ga0213876_10100554
357 Ga0213875_10053613
358 Ga0213875_10070833
359 Ga0213871_10024820
360 Ga0207656_10063005
361 Ga0207692_10113012
362 Ga0207699_10047072
363 Ga0207699_10158069
364 Ga0207705_10181102
365 Ga0207684_10229395
366 Ga0207654_10146383
367 Ga0207707_10234045
368 Ga0207707_10265392
369 Ga0207695_10015110
370 Ga0207695_10108458
371 Ga0207671_10085808
372 Ga0207671_10184679
373 Ga0207693_10032816
374 Ga0207663_10167549
375 Ga0207663_10180463
376 Ga0207660_10193984
377 Ga0207657_10006960
378 Ga0207657_10177773
379 Ga0207657_10202193
380 Ga0207649_10071337
381 Ga0207649_10158938
382 Ga0207649_10170235
383 Ga0207652_10256198
384 Ga0207694_10074388
385 Ga0207694_10253053
386 Ga0207664_10251251
387 Ga0207664_10267115
388 Ga0207690_10188786
389 Ga0207665_10231064
390 Ga0207711_10239663
391 Ga0207689_10282392
392 Ga0207661_10245266
393 Ga0207661_10287691
394 Ga0207679_10183795
395 Ga0207679_10243417
396 Ga0207667_10092210
397 Ga0207667_10113746
398 Ga0207640_10153971
399 Ga0207639_10222417
400 Ga0207678_10226591
401 Ga0207702_10294160
402 Ga0207674_10250547
403 Ga0207674_10333915
404 Ga0207698_10258874
405 Ga0207698_10328696
406 Ga0268265_10225353
407 Ga0265338_10029094
408 Ga0265760_10025947
409 Ga0307410_10158526
410 Ga0307412_10061381
411 Ga0307409_100269166
412 Ga0307416_100276453
413 Ga0307415_100088109
414 Ga0373923_0059203
415 Ga0373957_0056231
416 Ga0373943_0054150
417 Ga0373955_0015896
418 Ga0373935_0115563
419 Ga0373927_0088317
420 Ga0373937_0147800
421 Ga0316584_0205544
422 Ga0373925_0161256
423 Ga0395900_0177343
424 Ga0395900_0215566
425 Ga0395905_0267700
426 Ga0436364_0075365
427 Ga0436364_1167807
428 Ga0395901_0186678
429 Ga0395901_0310844
430 Ga0436365_0459136
431 Ga0436365_1170734
432 Ga0436360_0142219
433 Ga0436360_0636450
434 Ga0436360_1072092
435 Ga0436361_0048069
436 Ga0436361_0152705
437 Ga0436361_0783757
438 Ga0436363_1244042
439 Ga0436363_1585868
440 Ga0436362_0449612
441 Ga0436362_0678733
442 Ga0436362_0983354
443 Ga0451853_3028276
444 Ga0439441_020413
445 Ga0439456_009985
446 Ga0439435_0031436
447 Ga0439444_0006709
448 Ga0439459_0007892
449 Ga0451577_0056580
450 Ga0451577_0061843
451 Ga0451577_0196984
452 Ga0451577_0231406
453 Ga0451577_0232486
454 Ga0466972_0044374
455 Ga0453684_0069090
456 Ga0453684_0240448
457 Ga0453684_0276057
458 Ga0453684_0286906
459 Ga0453684_0317509
460 Ga0453684_0406606
461 Ga0451576_0141019
462 Ga0451576_0380573
463 Ga0495651_0081530
464 Ga0495608_0095255
465 Ga0495640_0101421
466 Ga0495587_0097587
467 Ga0495667_0010311
468 Ga0495657_0112935
469 Ga0495646_0100822
470 Ga0495600_0096668
471 Ga0495680_0093254
472 Ga0495675_0003511
473 Ga0495684_0236224
474 Ga0495684_0274697
475 Ga0495602_0169064
476 Ga0501031_0116261
477 Ga0501032_0142996
478 Ga0501034_0184826
479 Ga0501036_0097108
480 Ga0501036_0202704
481 Ga0501036_0224171
482 Ga0501038_0200750
483 Ga0501038_0250817
484 Ga0501039_0101081
485 Ga0501039_0138346
486 Ga0501039_0155817
487 Ga0501039_0170209
488 Ga0501040_0064762
489 Ga0501040_0109476
490 Ga0501040_0168864
491 Ga0501041_0140037
492 Ga0501042_0119748
493 Ga0501042_0156352
494 Ga0501043_0171548
495 Ga0501046_0168221
496 Ga0501046_0176902
497 Ga0501048_0090916
498 Ga0501069_0111179
499 Ga0501070_0361550
500 Ga0501071_0122365
501 Ga0501071_0181600
502 Ga0501072_0042982
503 Ga0501072_0199441
504 Ga0501073_0192034
505 Ga0501075_0057411
506 Ga0501075_0074046
507 Ga0501075_0173139
508 Ga0501075_0196271
509 Ga0501076_0015146
510 Ga0501076_0126591
511 Ga0501076_0152288
512 Ga0501076_0165629
513 Ga0501076_0200979
514 Ga0501077_0078606
515 Ga0501077_0096707
516 Ga0501077_0119124
517 Ga0501077_0169052
518 Ga0501079_0076872
519 Ga0501079_0277662
520 Ga0501080_0239076
521 Ga0501080_0249842
522 Ga0501081_0085569
523 Ga0501081_0138161
524 Ga0501081_0204885
525 Ga0501083_0113009
526 Ga0501035_0143978
527 Ga0501044_0225041
528 Ga0501045_0074897
529 nmdc:mga05p37_598018_c1
530 nmdc:mga0qj67_225598_c1
531 nmdc:mga06r32_220813_c1
532 nmdc:mga0rr50_164067_c1
533 nmdc:mga08x19_59898_c1
534 nmdc:mga0a205_143386_c1
535 Ga0495601_0070443
536 Ga0495595_0020422
537 Ga0495619_0181898
538 Ga0501084_0126224
539 Ga0501084_0212820
540 Ga0501084_0216871
541 Ga0501084_0235785
542 Ga0501084_0277156
543 Ga0501082_0064123
544 Ga0501082_0105319
545 Ga0501082_0223994
546 Ga0530510_0064767
547 Ga0530510_0183607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01548

DEDD_Tnp_IS110

Transposase

26

179

0.98

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

284

371

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hrg-assembly1.cif.gz_A crystal structure of bacteroides thetaiotaomicron bt_3980, protein with actin-like atpase fold and unknown function (np_812891.1) from bacteroides thetaiotaomicron vpi-5482 at 1.85 a resolution 0.7565 2 81
2ozb-assembly2.cif.gz_E structure of a human prp31-15.5k-u4 snrna complex 0.7475 121 380
2ozb-assembly1.cif.gz_B structure of a human prp31-15.5k-u4 snrna complex 0.7434 121 380
3siv-assembly2.cif.gz_H structure of a hprp31-15.5k-u4atac 5' stem loop complex, dimeric form 0.7243 121 380
6qx9-assembly1.cif.gz_4C structure of a human fully-assembled precatalytic spliceosome (pre-b complex). 0.7209 123 380
ID Description Score Start End Superfamily
5gipB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8803 129 258 1.10.287.4070
2nnwC02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.873 122 258 1.10.287.4070
af_O07182_4_158_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.871 5 153 3.30.420.10
3nviA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8681 121 257 1.10.287.4070
af_A0A1D6G5P2_19_183_1.10.287.4070 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8664 122 258 1.10.287.4070
ID Description Score Start End GO Terms
AF-A0A845GF70-F1-model_v4 Transposase 0.9264 241 385 GO:0003677
GO:0004803
GO:0006313
AF-A0A369RIU8-F1-model_v4 IS110 family transposase (Transposase IS116/IS110/IS902 family protein) 0.9174 239 385 GO:0003677
GO:0004803
GO:0006313
AF-A0A2T1E6A8-F1-model_v4 Transposase IS116/IS110/IS902 C-terminal domain-containing protein 0.9151 260 385 GO:0003677
GO:0004803
GO:0006313
AF-R2P9T0-F1-model_v4 Transposase 0.9118 128 384 GO:0003677
GO:0004803
GO:0006313
AF-A0A7H4KVV9-F1-model_v4 deleted 0.911 264 388

Map