F379116
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 182 | 268 | 373 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100003396|Ga0307408_1000033961 |
| Length | 382 |
| Sequence | MTDTPDRDQKTEAPTEKRRRDAAQKGDVLQSRELGTALVVLGGAAWFALAGPWMMEALERMLVRSLSFDDGALEAFDPGGAVMGMIGAIAIPLASLFAVTLIAAIGTPALLGSLGFRWSAVAFKGGKLNPLSGIKRIFGAQGLIELAKSMAKVVLLGAVGVWLLAGQADELMTLGRQDIGPALGQLGHSFIIAVLVMAXXXXVIALIDIPAQIFQRGGRLRMTKQEVKDEHKQTEGSPELKAAIRRKQHETLRGSARTAIAEASVVLVNPTHFAVALRYRPGLDAAPIVVARGRGATAQAIRDLADEHTVPVLSYPQLTRAIYYTARAGQVIREDLYIAVATVLAFVFNLDRAMAEGVAQPNVEVPPEARFDENGRPTPPPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 3 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 4 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 5 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 107 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 116 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 117 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 118 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 119 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 120 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 135 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 136 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 139 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 140 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 141 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 142 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 143 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 144 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 146 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 147 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 148 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 155 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 158 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 159 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 160 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 161 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 162 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 163 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 164 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 165 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 166 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 168 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 169 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 170 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 171 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 172 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 173 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 174 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 175 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 176 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 177 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 178 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 179 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 180 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 181 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 182 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.8 |
| Metatranscriptomes | 0.37 |
| Isolates | 1.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.42 |
| Nodule | 0 |
| Rhizoplane | 3.66 |
| Rhizosphere | 79.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000015 | 3300001904 | Bacteria | 28999 |
| 2 | JGI24740J21852_10015927 | 3300001979 | Bacteria | 2730 |
| 3 | JGI24740J21852_10024674 | 3300001979 | Bacteria | 2038 |
| 4 | JGI24735J21928_10019158 | 3300002067 | Unclassified | 2104 |
| 5 | JGI24750J21931_1000259 | 3300002070 | Bacteria | 9019 |
| 6 | JGI24748J21848_1000023 | 3300002074 | Bacteria | 106523 |
| 7 | JGI24738J21930_10003014 | 3300002075 | Bacteria | 4303 |
| 8 | JGI24034J26672_10000010 | 3300002239 | Bacteria | 150746 |
| 9 | JGI24751J29686_10003999 | 3300002459 | Bacteria | 2981 |
| 10 | Ga0065704_10075029 | 3300005289 | Bacteria | 5834 |
| 11 | Ga0065707_10082699 | 3300005295 | Bacteria | 12652 |
| 12 | Ga0070658_10108690 | 3300005327 | Bacteria | 2296 |
| 13 | Ga0070690_100000055 | 3300005330 | Bacteria | 55023 |
| 14 | Ga0070670_100000012 | 3300005331 | Bacteria | 256314 |
| 15 | Ga0070670_100000135 | 3300005331 | Bacteria | 69478 |
| 16 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 17 | Ga0070689_100028360 | 3300005340 | Bacteria | 4231 |
| 18 | Ga0070661_100149775 | 3300005344 | Bacteria | 1763 |
| 19 | Ga0070668_100000004 | 3300005347 | Bacteria | 189408 |
| 20 | Ga0070668_100012073 | 3300005347 | Bacteria | 6435 |
| 21 | Ga0070669_100000017 | 3300005353 | Bacteria | 195995 |
| 22 | Ga0070669_100000041 | 3300005353 | Bacteria | 127426 |
| 23 | Ga0070671_100000951 | 3300005355 | Bacteria | 21207 |
| 24 | Ga0070671_100022673 | 3300005355 | Bacteria | 5129 |
| 25 | Ga0070688_100001642 | 3300005365 | Bacteria | 11198 |
| 26 | Ga0070659_100087537 | 3300005366 | Bacteria | 2494 |
| 27 | Ga0070667_100000037 | 3300005367 | Bacteria | 172343 |
| 28 | Ga0070667_100000969 | 3300005367 | Bacteria | 26391 |
| 29 | Ga0070667_100001215 | 3300005367 | Bacteria | 23486 |
| 30 | Ga0070667_100062510 | 3300005367 | Bacteria | 3154 |
| 31 | Ga0070663_100023270 | 3300005455 | Bacteria | 4150 |
| 32 | Ga0070685_10004021 | 3300005466 | Bacteria | 7423 |
| 33 | Ga0068853_100031344 | 3300005539 | Bacteria | 4497 |
| 34 | Ga0068853_100213797 | 3300005539 | Bacteria | 1758 |
| 35 | Ga0070686_100000041 | 3300005544 | Bacteria | 104174 |
| 36 | Ga0070686_100000577 | 3300005544 | Bacteria | 21790 |
| 37 | Ga0070665_100000238 | 3300005548 | Bacteria | 91410 |
| 38 | Ga0070665_100000368 | 3300005548 | Bacteria | 67541 |
| 39 | Ga0070664_100109249 | 3300005564 | Bacteria | 2412 |
| 40 | Ga0068857_100211400 | 3300005577 | Bacteria | 1770 |
| 41 | Ga0068852_100135898 | 3300005616 | Bacteria | 2270 |
| 42 | Ga0068852_100275756 | 3300005616 | Bacteria | 1620 |
| 43 | Ga0068859_100002580 | 3300005617 | Bacteria | 18427 |
| 44 | Ga0068859_100007063 | 3300005617 | Bacteria | 11405 |
| 45 | Ga0068864_100000010 | 3300005618 | Bacteria | 358723 |
| 46 | Ga0068864_100000798 | 3300005618 | Bacteria | 26391 |
| 47 | Ga0068861_100025636 | 3300005719 | Bacteria | 4278 |
| 48 | Ga0068861_100119446 | 3300005719 | Bacteria | 2124 |
| 49 | Ga0068861_100127445 | 3300005719 | Bacteria | 2062 |
| 50 | Ga0068863_100000132 | 3300005841 | Bacteria | 78811 |
| 51 | Ga0068863_100000705 | 3300005841 | Bacteria | 33651 |
| 52 | Ga0068863_100068031 | 3300005841 | Bacteria | 3369 |
| 53 | Ga0068863_100493636 | 3300005841 | Bacteria | 1205 |
| 54 | Ga0068858_100000466 | 3300005842 | Bacteria | 42207 |
| 55 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 56 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 57 | Ga0068860_100024461 | 3300005843 | Bacteria | 5835 |
| 58 | Ga0068862_100000016 | 3300005844 | Bacteria | 250031 |
| 59 | Ga0068862_100000151 | 3300005844 | Bacteria | 78811 |
| 60 | Ga0068862_100000580 | 3300005844 | Bacteria | 38040 |
| 61 | Ga0068862_100000596 | 3300005844 | Bacteria | 37603 |
| 62 | Ga0081455_10000049 | 3300005937 | Bacteria | 126459 |
| 63 | Ga0075366_10139805 | 3300006195 | Bacteria | 1464 |
| 64 | Ga0075434_100020512 | 3300006871 | Bacteria | 6410 |
| 65 | Ga0097620_100002581 | 3300006931 | Bacteria | 18427 |
| 66 | Ga0097620_100007063 | 3300006931 | Bacteria | 11405 |
| 67 | Ga0105251_10000264 | 3300009011 | Bacteria | 52208 |
| 68 | Ga0105247_10003404 | 3300009101 | Bacteria | 10393 |
| 69 | Ga0105248_10000012 | 3300009177 | Bacteria | 333963 |
| 70 | Ga0105248_10007162 | 3300009177 | Bacteria | 12236 |
| 71 | Ga0105248_10086299 | 3300009177 | Bacteria | 3532 |
| 72 | Ga0105237_10254739 | 3300009545 | Bacteria | 1757 |
| 73 | Ga0105249_10000014 | 3300009553 | Bacteria | 283274 |
| 74 | Ga0105249_10000099 | 3300009553 | Bacteria | 119885 |
| 75 | Ga0105239_10000451 | 3300010375 | Bacteria | 59882 |
| 76 | Ga0157326_1000348 | 3300012513 | Bacteria | 5467 |
| 77 | Ga0157373_10008588 | 3300013100 | Bacteria | 7586 |
| 78 | Ga0157371_10145038 | 3300013102 | Bacteria | 1691 |
| 79 | Ga0157370_10003119 | 3300013104 | Bacteria | 19629 |
| 80 | Ga0157378_10190535 | 3300013297 | Bacteria | 1934 |
| 81 | Ga0163162_10213751 | 3300013306 | Bacteria | 2058 |
| 82 | Ga0157372_10099337 | 3300013307 | Bacteria | 3320 |
| 83 | Ga0163163_10021759 | 3300014325 | Bacteria | 6058 |
| 84 | Ga0163163_10166180 | 3300014325 | Bacteria | 2253 |
| 85 | Ga0157380_10000120 | 3300014326 | Bacteria | 43644 |
| 86 | Ga0157380_10000350 | 3300014326 | Bacteria | 27615 |
| 87 | Ga0157380_10001483 | 3300014326 | Bacteria | 15349 |
| 88 | Ga0157379_10077734 | 3300014968 | Bacteria | 2972 |
| 89 | Ga0163161_10000860 | 3300017792 | Bacteria | 23679 |
| 90 | Ga0163161_10126096 | 3300017792 | Bacteria | 1928 |
| 91 | Ga0206356_10211798 | 3300020070 | Bacteria | 6317 |
| 92 | Ga0213875_10000269 | 3300021388 | Bacteria | 51323 |
| 93 | Ga0207656_10002482 | 3300025321 | Bacteria | 6228 |
| 94 | Ga0207713_1001017 | 3300025735 | Bacteria | 24423 |
| 95 | Ga0207710_10010312 | 3300025900 | Bacteria | 3933 |
| 96 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 97 | Ga0207647_10000323 | 3300025904 | Bacteria | 39393 |
| 98 | Ga0207647_10003168 | 3300025904 | Bacteria | 12342 |
| 99 | Ga0207654_10000521 | 3300025911 | Bacteria | 22010 |
| 100 | Ga0207695_10004592 | 3300025913 | Bacteria | 18760 |
| 101 | Ga0207695_10019005 | 3300025913 | Bacteria | 7924 |
| 102 | Ga0207671_10000740 | 3300025914 | Bacteria | 41467 |
| 103 | Ga0207671_10001130 | 3300025914 | Bacteria | 32130 |
| 104 | Ga0207657_10023543 | 3300025919 | Bacteria | 5732 |
| 105 | Ga0207649_10049935 | 3300025920 | Bacteria | 2586 |
| 106 | Ga0207681_10000013 | 3300025923 | Bacteria | 357411 |
| 107 | Ga0207681_10000029 | 3300025923 | Bacteria | 177260 |
| 108 | Ga0207694_10002569 | 3300025924 | Bacteria | 14737 |
| 109 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 110 | Ga0207650_10000182 | 3300025925 | Bacteria | 73032 |
| 111 | Ga0207650_10183917 | 3300025925 | Bacteria | 1667 |
| 112 | Ga0207644_10012210 | 3300025931 | Bacteria | 5700 |
| 113 | Ga0207690_10114333 | 3300025932 | Bacteria | 1949 |
| 114 | Ga0207706_10087440 | 3300025933 | Bacteria | 2740 |
| 115 | Ga0207670_10016382 | 3300025936 | Bacteria | 4454 |
| 116 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 117 | Ga0207711_10002001 | 3300025941 | Bacteria | 18440 |
| 118 | Ga0207711_10082610 | 3300025941 | Bacteria | 2809 |
| 119 | Ga0207667_10000825 | 3300025949 | Bacteria | 40050 |
| 120 | Ga0207667_10094612 | 3300025949 | Bacteria | 3085 |
| 121 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 122 | Ga0207712_10000161 | 3300025961 | Bacteria | 69260 |
| 123 | Ga0207668_10000122 | 3300025972 | Bacteria | 54614 |
| 124 | Ga0207668_10007659 | 3300025972 | Bacteria | 6426 |
| 125 | Ga0207640_10024429 | 3300025981 | Bacteria | 3646 |
| 126 | Ga0207640_10260822 | 3300025981 | Bacteria | 1350 |
| 127 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 128 | Ga0207658_10000405 | 3300025986 | Bacteria | 41161 |
| 129 | Ga0207658_10000462 | 3300025986 | Bacteria | 38001 |
| 130 | Ga0207658_10002864 | 3300025986 | Bacteria | 12353 |
| 131 | Ga0207703_10001057 | 3300026035 | Bacteria | 26252 |
| 132 | Ga0207703_10003457 | 3300026035 | Bacteria | 13224 |
| 133 | Ga0207639_10013785 | 3300026041 | Bacteria | 5667 |
| 134 | Ga0207639_10250173 | 3300026041 | Bacteria | 1545 |
| 135 | Ga0207639_10353945 | 3300026041 | Bacteria | 1312 |
| 136 | Ga0207678_10015297 | 3300026067 | Bacteria | 6749 |
| 137 | Ga0207702_10007703 | 3300026078 | Bacteria | 9147 |
| 138 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 139 | Ga0207641_10000263 | 3300026088 | Bacteria | 66525 |
| 140 | Ga0207641_10054970 | 3300026088 | Bacteria | 3380 |
| 141 | Ga0207676_10000012 | 3300026095 | Bacteria | 353971 |
| 142 | Ga0207676_10000046 | 3300026095 | Bacteria | 149037 |
| 143 | Ga0207676_10009645 | 3300026095 | Bacteria | 6869 |
| 144 | Ga0207674_10171188 | 3300026116 | Bacteria | 2125 |
| 145 | Ga0207674_10174513 | 3300026116 | Bacteria | 2102 |
| 146 | Ga0207675_100000131 | 3300026118 | Bacteria | 62791 |
| 147 | Ga0207675_100001041 | 3300026118 | Bacteria | 27481 |
| 148 | Ga0207675_100053012 | 3300026118 | Bacteria | 3785 |
| 149 | Ga0207698_10085878 | 3300026142 | Bacteria | 2557 |
| 150 | Ga0207698_10196324 | 3300026142 | Bacteria | 1803 |
| 151 | Ga0268266_10000061 | 3300028379 | Bacteria | 255207 |
| 152 | Ga0268266_10000117 | 3300028379 | Bacteria | 163515 |
| 153 | Ga0268265_10000006 | 3300028380 | Bacteria | 466482 |
| 154 | Ga0268265_10000026 | 3300028380 | Bacteria | 246653 |
| 155 | Ga0268265_10000266 | 3300028380 | Bacteria | 59618 |
| 156 | Ga0268265_10000849 | 3300028380 | Bacteria | 28736 |
| 157 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 158 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 159 | Ga0268264_10049664 | 3300028381 | Bacteria | 3491 |
| 160 | Ga0307513_10043653 | 3300031456 | Bacteria | 4921 |
| 161 | Ga0307408_100003396 | 3300031548 | Bacteria | 10921 |
| 162 | Ga0307405_10043244 | 3300031731 | Bacteria | 2747 |
| 163 | Ga0307406_10020843 | 3300031901 | Bacteria | 3868 |
| 164 | Ga0307412_10000933 | 3300031911 | Bacteria | 16724 |
| 165 | Ga0307412_10195798 | 3300031911 | Bacteria | 1531 |
| 166 | Ga0307412_10225500 | 3300031911 | Bacteria | 1439 |
| 167 | Ga0307416_100018226 | 3300032002 | Bacteria | 4940 |
| 168 | Ga0307414_10037901 | 3300032004 | Bacteria | 3232 |
| 169 | Ga0307414_10166848 | 3300032004 | Bacteria | 1756 |
| 170 | Ga0395899_0000530 | 3300037312 | Bacteria | 41828 |
| 171 | Ga0395900_0001531 | 3300037418 | Bacteria | 27485 |
| 172 | Ga0395898_0000315 | 3300037466 | Bacteria | 111811 |
| 173 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 174 | Ga0436364_1538936 | 3300037853 | Bacteria | 27273 |
| 175 | Ga0395901_0011646 | 3300038443 | Bacteria | 8907 |
| 176 | Ga0436365_0813034 | 3300039437 | Bacteria | 2012 |
| 177 | Ga0439448_0005114 | 3300042005 | Bacteria | 3730 |
| 178 | Ga0439448_0023592 | 3300042005 | Bacteria | 1920 |
| 179 | Ga0439454_001760 | 3300042011 | Bacteria | 2158 |
| 180 | Ga0439455_0001942 | 3300042012 | Bacteria | 3641 |
| 181 | Ga0439458_0003996 | 3300042157 | Bacteria | 3408 |
| 182 | Ga0439458_0004673 | 3300042157 | Bacteria | 3125 |
| 183 | Ga0466973_0088490 | 3300044659 | Bacteria | 2678 |
| 184 | Ga0466968_0011259 | 3300044735 | Bacteria | 3483 |
| 185 | Ga0495638_0066410 | 3300046460 | Bacteria | 2217 |
| 186 | Ga0495643_0035047 | 3300046522 | Bacteria | 2765 |
| 187 | Ga0495643_0130315 | 3300046522 | Bacteria | 1263 |
| 188 | Ga0495654_0048311 | 3300046530 | Bacteria | 2089 |
| 189 | Ga0495597_0027513 | 3300046542 | Bacteria | 2607 |
| 190 | Ga0495668_0020625 | 3300046616 | Bacteria | 3788 |
| 191 | Ga0495668_0021025 | 3300046616 | Bacteria | 3747 |
| 192 | Ga0495668_0026327 | 3300046616 | Bacteria | 3301 |
| 193 | Ga0495625_0160977 | 3300046660 | Bacteria | 1504 |
| 194 | Ga0495649_0108708 | 3300046694 | Bacteria | 1471 |
| 195 | Ga0495589_0045141 | 3300046794 | Bacteria | 2190 |
| 196 | Ga0495685_058251 | 3300047447 | Bacteria | 1304 |
| 197 | Ga0495673_0030270 | 3300047469 | Bacteria | 2544 |
| 198 | Ga0495686_0000141 | 3300047472 | Bacteria | 144510 |
| 199 | Ga0496101_0154134 | 3300048904 | Bacteria | 1759 |
| 200 | Ga0496101_0216298 | 3300048904 | Bacteria | 1486 |
| 201 | Ga0496102_0000036 | 3300048905 | Bacteria | 201896 |
| 202 | Ga0496102_0009074 | 3300048905 | Bacteria | 8532 |
| 203 | Ga0496103_0000074 | 3300048906 | Bacteria | 116385 |
| 204 | Ga0496103_0004026 | 3300048906 | Bacteria | 8927 |
| 205 | Ga0496103_0107531 | 3300048906 | Bacteria | 1769 |
| 206 | Ga0496105_0020591 | 3300048908 | Bacteria | 5332 |
| 207 | Ga0496106_0046477 | 3300048909 | Bacteria | 3264 |
| 208 | Ga0496107_0008992 | 3300048910 | Bacteria | 6925 |
| 209 | Ga0496116_0001569 | 3300048919 | Bacteria | 25208 |
| 210 | Ga0496116_0011962 | 3300048919 | Bacteria | 7130 |
| 211 | Ga0496117_0000093 | 3300048920 | Bacteria | 201862 |
| 212 | Ga0496117_0008800 | 3300048920 | Bacteria | 9525 |
| 213 | Ga0496117_0039453 | 3300048920 | Bacteria | 3485 |
| 214 | Ga0496117_0056776 | 3300048920 | Bacteria | 2724 |
| 215 | Ga0496118_0000070 | 3300048921 | Bacteria | 201866 |
| 216 | Ga0496118_0000416 | 3300048921 | Bacteria | 70809 |
| 217 | Ga0496118_0008773 | 3300048921 | Bacteria | 10365 |
| 218 | Ga0496118_0055734 | 3300048921 | Bacteria | 2979 |
| 219 | Ga0496121_0000880 | 3300048924 | Bacteria | 54384 |
| 220 | Ga0496124_0000225 | 3300048927 | Bacteria | 110516 |
| 221 | Ga0496126_0100277 | 3300048929 | Bacteria | 2535 |
| 222 | Ga0495678_030206 | 3300049459 | Bacteria | 2269 |
| 223 | Ga0501290_000348 | 3300049513 | Bacteria | 7544 |
| 224 | Ga0501292_000096 | 3300049515 | Bacteria | 15530 |
| 225 | Ga0501300_001248 | 3300049523 | Bacteria | 3850 |
| 226 | Ga0501032_0017948 | 3300049569 | Bacteria | 4964 |
| 227 | Ga0501034_0037966 | 3300049571 | Bacteria | 4878 |
| 228 | Ga0501043_0018815 | 3300049579 | Bacteria | 5422 |
| 229 | Ga0501043_0052610 | 3300049579 | Bacteria | 3198 |
| 230 | Ga0501046_0058657 | 3300049580 | Bacteria | 3017 |
| 231 | Ga0501047_0003521 | 3300049581 | Bacteria | 14779 |
| 232 | Ga0501069_0012752 | 3300049585 | Bacteria | 4474 |
| 233 | Ga0501206_003564 | 3300049653 | Bacteria | 1978 |
| 234 | Ga0501233_043358 | 3300049668 | Bacteria | 1065 |
| 235 | Ga0501235_018118 | 3300049669 | Bacteria | 1559 |
| 236 | Ga0501249_000065 | 3300049679 | Bacteria | 38092 |
| 237 | Ga0501257_001004 | 3300049686 | Bacteria | 5686 |
| 238 | Ga0501261_000635 | 3300049690 | Bacteria | 4456 |
| 239 | Ga0501225_0004441 | 3300049705 | Bacteria | 4176 |
| 240 | Ga0501245_011516 | 3300049708 | Bacteria | 1288 |
| 241 | Ga0501241_004057 | 3300049758 | Bacteria | 2754 |
| 242 | Ga0501279_000051 | 3300049775 | Bacteria | 22449 |
| 243 | Ga0501280_000167 | 3300049776 | Bacteria | 16933 |
| 244 | Ga0501280_002714 | 3300049776 | Bacteria | 2878 |
| 245 | Ga0501281_02608 | 3300049777 | Bacteria | 1311 |
| 246 | Ga0501044_0003361 | 3300049823 | Bacteria | 18041 |
| 247 | Ga0500643_000151 | 3300053087 | Bacteria | 70674 |
| 248 | Ga0500643_000348 | 3300053087 | Bacteria | 36744 |
| 249 | Ga0500643_000789 | 3300053087 | Bacteria | 20521 |
| 250 | Ga0500647_0009783 | 3300053091 | Bacteria | 4219 |
| 251 | Ga0500641_0055817 | 3300053096 | Bacteria | 1636 |
| 252 | Ga0500592_000037 | 3300053116 | Bacteria | 42549 |
| 253 | Ga0500618_003727 | 3300053125 | Bacteria | 5114 |
| 254 | Ga0500655_000037 | 3300053133 | Bacteria | 38087 |
| 255 | Ga0500568_0001282 | 3300053139 | Bacteria | 16541 |
| 256 | Ga0500573_0058395 | 3300053140 | Bacteria | 2212 |
| 257 | Ga0500590_002839 | 3300053148 | Bacteria | 7830 |
| 258 | Ga0500604_0000061 | 3300053151 | Bacteria | 39582 |
| 259 | Ga0500604_0023545 | 3300053151 | Bacteria | 1757 |
| 260 | Ga0500604_0052991 | 3300053151 | Bacteria | 1257 |
| 261 | Ga0500616_0000119 | 3300053153 | Bacteria | 143264 |
| 262 | Ga0500616_0019831 | 3300053153 | Bacteria | 3786 |
| 263 | Ga0500622_0002120 | 3300053156 | Bacteria | 14766 |
| 264 | Ga0500627_0000411 | 3300053158 | Bacteria | 11566 |
| 265 | Ga0500627_0000593 | 3300053158 | Bacteria | 9708 |
| 266 | Ga0500570_027171 | 3300053724 | Bacteria | 3128 |
| 267 | Ga0500645_013347 | 3300053730 | Bacteria | 2638 |
| 268 | Ga0500596_006327 | 3300053735 | Bacteria | 2015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046694 | Ga0495649_0108708 | Ga0495649_0108708_304_1443 | 313 |
| 2 | 3300005843 | Ga0068860_100024461 | Ga0068860_1000244616 | 314 |
| 3 | 3300028381 | Ga0268264_10049664 | Ga0268264_100496643 | 314 |
| 4 | 3300049668 | Ga0501233_043358 | Ga0501233_043358_38_1015 | 317 |
| 5 | 3300049777 | Ga0501281_02608 | Ga0501281_02608_24_1001 | 317 |
| 6 | 3300006871 | Ga0075434_100020512 | Ga0075434_1000205121 | 319 |
| 7 | 3300046660 | Ga0495625_0160977 | Ga0495625_0160977_136_1275 | 321 |
| 8 | 3300049758 | Ga0501241_004057 | Ga0501241_004057_935_2059 | 323 |
| 9 | 3300049571 | Ga0501034_0037966 | Ga0501034_0037966_940_2073 | 324 |
| 10 | 3300049585 | Ga0501069_0012752 | Ga0501069_0012752_2086_3219 | 324 |
| 11 | 3300031456 | Ga0307513_10043653 | Ga0307513_100436534 | 326 |
| 12 | 3300042011 | Ga0439454_001760 | Ga0439454_001760_1161_2144 | 326 |
| 13 | 3300053096 | Ga0500641_0055817 | Ga0500641_0055817_481_1530 | 328 |
| 14 | 3300049523 | Ga0501300_001248 | Ga0501300_001248_216_1235 | 331 |
| 15 | 3300049776 | Ga0501280_002714 | Ga0501280_002714_748_1776 | 342 |
| 16 | 3300048929 | Ga0496126_0100277 | Ga0496126_0100277_807_1946 | 344 |
| 17 | 3300053140 | Ga0500573_0058395 | Ga0500573_0058395_964_2100 | 347 |
| 18 | 3300049686 | Ga0501257_001004 | Ga0501257_001004_3719_4858 | 354 |
| 19 | 3300012513 | Ga0157326_1000348 | Ga0157326_10003485 | 355 |
| 20 | 3300046522 | Ga0495643_0035047 | Ga0495643_0035047_625_1764 | 356 |
| 21 | 3300046522 | Ga0495643_0130315 | Ga0495643_0130315_82_1221 | 358 |
| 22 | 3300046542 | Ga0495597_0027513 | Ga0495597_0027513_586_1725 | 358 |
| 23 | 3300053091 | Ga0500647_0009783 | Ga0500647_0009783_2875_4014 | 358 |
| 24 | 3300053125 | Ga0500618_003727 | Ga0500618_003727_436_1575 | 358 |
| 25 | 3300053133 | Ga0500655_000037 | Ga0500655_000037_20094_21233 | 358 |
| 26 | 3300053148 | Ga0500590_002839 | Ga0500590_002839_4700_5839 | 358 |
| 27 | 3300053156 | Ga0500622_0002120 | Ga0500622_0002120_13172_14311 | 358 |
| 28 | 3300053724 | Ga0500570_027171 | Ga0500570_027171_1900_3039 | 358 |
| 29 | 3300005548 | Ga0070665_100000238 | Ga0070665_10000023815 | 359 |
| 30 | 3300028379 | Ga0268266_10000061 | Ga0268266_1000006166 | 359 |
| 31 | 3300017792 | Ga0163161_10126096 | Ga0163161_101260963 | 360 |
| 32 | 3300026116 | Ga0207674_10174513 | Ga0207674_101745132 | 360 |
| 33 | 3300049708 | Ga0501245_011516 | Ga0501245_011516_154_1260 | 360 |
| 34 | 3300005544 | Ga0070686_100000577 | Ga0070686_1000005774 | 364 |
| 35 | 3300049569 | Ga0501032_0017948 | Ga0501032_0017948_2108_3247 | 365 |
| 36 | 3300049579 | Ga0501043_0018815 | Ga0501043_0018815_3173_4312 | 365 |
| 37 | 3300049580 | Ga0501046_0058657 | Ga0501046_0058657_1128_2267 | 365 |
| 38 | 3300049581 | Ga0501047_0003521 | Ga0501047_0003521_4744_5883 | 365 |
| 39 | 3300044659 | Ga0466973_0088490 | Ga0466973_0088490_464_1603 | 369 |
| 40 | 3300031911 | Ga0307412_10195798 | Ga0307412_101957981 | 370 |
| 41 | 3300049513 | Ga0501290_000348 | Ga0501290_000348_4700_5836 | 370 |
| 42 | 3300049515 | Ga0501292_000096 | Ga0501292_000096_207_1343 | 370 |
| 43 | 3300049653 | Ga0501206_003564 | Ga0501206_003564_71_1207 | 370 |
| 44 | 3300049669 | Ga0501235_018118 | Ga0501235_018118_389_1525 | 370 |
| 45 | 3300049690 | Ga0501261_000635 | Ga0501261_000635_47_1183 | 370 |
| 46 | 3300049705 | Ga0501225_0004441 | Ga0501225_0004441_1380_2516 | 370 |
| 47 | 3300049775 | Ga0501279_000051 | Ga0501279_000051_14095_15231 | 370 |
| 48 | 3300049776 | Ga0501280_000167 | Ga0501280_000167_1686_2822 | 370 |
| 49 | 3300046530 | Ga0495654_0048311 | Ga0495654_0048311_17_1156 | 371 |
| 50 | 3300053116 | Ga0500592_000037 | Ga0500592_000037_35932_37071 | 371 |
| 51 | 3300053151 | Ga0500604_0052991 | Ga0500604_0052991_75_1214 | 371 |
| 52 | 3300053158 | Ga0500627_0000593 | Ga0500627_0000593_8551_9690 | 371 |
| 53 | 3300005616 | Ga0068852_100135898 | Ga0068852_1001358982 | 372 |
| 54 | 3300026142 | Ga0207698_10196324 | Ga0207698_101963242 | 372 |
| 55 | 3300053139 | Ga0500568_0001282 | Ga0500568_0001282_13725_14864 | 373 |
| 56 | 3300053151 | Ga0500604_0000061 | Ga0500604_0000061_5570_6709 | 373 |
| 57 | 3300053153 | Ga0500616_0000119 | Ga0500616_0000119_1807_2946 | 373 |
| 58 | iso_pu_bacteria | 2582581305 | 2585262351 | 375 |
| 59 | iso_pu_bacteria | 2643221541 | 2643730387 | 375 |
| 60 | iso_pu_bacteria | 2643221605 | 2644037199 | 375 |
| 61 | iso_pu_bacteria | 2643221606 | 2644043556 | 375 |
| 62 | iso_pu_bacteria | 2643221671 | 2644393715 | 375 |
| 63 | 3300037312 | Ga0395899_0000530 | Ga0395899_0000530_25096_26232 | 377 |
| 64 | 3300037418 | Ga0395900_0001531 | Ga0395900_0001531_20633_21769 | 377 |
| 65 | 3300037466 | Ga0395898_0000315 | Ga0395898_0000315_74619_75755 | 377 |
| 66 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_435393_436529 | 377 |
| 67 | 3300038443 | Ga0395901_0011646 | Ga0395901_0011646_2092_3228 | 377 |
| 68 | 3300005347 | Ga0070668_100000004 | Ga0070668_10000000427 | 378 |
| 69 | 3300005355 | Ga0070671_100000951 | Ga0070671_1000009512 | 378 |
| 70 | 3300005367 | Ga0070667_100000037 | Ga0070667_10000003725 | 378 |
| 71 | 3300005617 | Ga0068859_100007063 | Ga0068859_1000070638 | 378 |
| 72 | 3300005719 | Ga0068861_100119446 | Ga0068861_1001194461 | 378 |
| 73 | 3300005841 | Ga0068863_100493636 | Ga0068863_1004936361 | 378 |
| 74 | 3300005842 | Ga0068858_100000466 | Ga0068858_10000046626 | 378 |
| 75 | 3300005843 | Ga0068860_100000002 | Ga0068860_100000002581 | 378 |
| 76 | 3300005844 | Ga0068862_100000580 | Ga0068862_1000005806 | 378 |
| 77 | 3300006931 | Ga0097620_100007063 | Ga0097620_1000070632 | 378 |
| 78 | 3300010375 | Ga0105239_10000451 | Ga0105239_100004516 | 378 |
| 79 | 3300021388 | Ga0213875_10000269 | Ga0213875_1000026941 | 378 |
| 80 | 3300025913 | Ga0207695_10019005 | Ga0207695_100190056 | 378 |
| 81 | 3300025914 | Ga0207671_10000740 | Ga0207671_100007408 | 378 |
| 82 | 3300025925 | Ga0207650_10183917 | Ga0207650_101839171 | 378 |
| 83 | 3300025931 | Ga0207644_10012210 | Ga0207644_100122102 | 378 |
| 84 | 3300025949 | Ga0207667_10094612 | Ga0207667_100946124 | 378 |
| 85 | 3300025972 | Ga0207668_10000122 | Ga0207668_1000012227 | 378 |
| 86 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002864 | 378 |
| 87 | 3300026035 | Ga0207703_10001057 | Ga0207703_1000105712 | 378 |
| 88 | 3300026118 | Ga0207675_100053012 | Ga0207675_1000530123 | 378 |
| 89 | 3300028380 | Ga0268265_10000849 | Ga0268265_1000084922 | 378 |
| 90 | 3300028381 | Ga0268264_10000001 | Ga0268264_100000011189 | 378 |
| 91 | 3300037853 | Ga0436364_1538936 | Ga0436364_1538936_12245_13381 | 378 |
| 92 | 3300039437 | Ga0436365_0813034 | Ga0436365_0813034_86_1222 | 378 |
| 93 | 3300044735 | Ga0466968_0011259 | Ga0466968_0011259_1526_2662 | 378 |
| 94 | 3300047469 | Ga0495673_0030270 | Ga0495673_0030270_759_1895 | 378 |
| 95 | 3300047472 | Ga0495686_0000141 | Ga0495686_0000141_124636_125772 | 378 |
| 96 | 3300048920 | Ga0496117_0056776 | Ga0496117_0056776_1363_2499 | 378 |
| 97 | 3300048921 | Ga0496118_0055734 | Ga0496118_0055734_1261_2397 | 378 |
| 98 | 3300048924 | Ga0496121_0000880 | Ga0496121_0000880_41238_42374 | 378 |
| 99 | 3300049579 | Ga0501043_0052610 | Ga0501043_0052610_346_1482 | 378 |
| 100 | 3300049823 | Ga0501044_0003361 | Ga0501044_0003361_2846_3982 | 378 |
| 101 | 3300001904 | JGI24736J21556_1000015 | JGI24736J21556_100001522 | 379 |
| 102 | 3300001979 | JGI24740J21852_10015927 | JGI24740J21852_100159272 | 379 |
| 103 | 3300001979 | JGI24740J21852_10024674 | JGI24740J21852_100246742 | 379 |
| 104 | 3300002067 | JGI24735J21928_10019158 | JGI24735J21928_100191582 | 379 |
| 105 | 3300002070 | JGI24750J21931_1000259 | JGI24750J21931_10002595 | 379 |
| 106 | 3300002074 | JGI24748J21848_1000023 | JGI24748J21848_100002364 | 379 |
| 107 | 3300002075 | JGI24738J21930_10003014 | JGI24738J21930_100030142 | 379 |
| 108 | 3300002239 | JGI24034J26672_10000010 | JGI24034J26672_1000001044 | 379 |
| 109 | 3300002459 | JGI24751J29686_10003999 | JGI24751J29686_100039991 | 379 |
| 110 | 3300005289 | Ga0065704_10075029 | Ga0065704_100750296 | 379 |
| 111 | 3300005295 | Ga0065707_10082699 | Ga0065707_100826996 | 379 |
| 112 | 3300005327 | Ga0070658_10108690 | Ga0070658_101086901 | 379 |
| 113 | 3300005330 | Ga0070690_100000055 | Ga0070690_10000005544 | 379 |
| 114 | 3300005331 | Ga0070670_100000012 | Ga0070670_10000001234 | 379 |
| 115 | 3300005331 | Ga0070670_100000135 | Ga0070670_10000013511 | 379 |
| 116 | 3300005335 | Ga0070666_10000009 | Ga0070666_10000009214 | 379 |
| 117 | 3300005340 | Ga0070689_100028360 | Ga0070689_1000283604 | 379 |
| 118 | 3300005344 | Ga0070661_100149775 | Ga0070661_1001497752 | 379 |
| 119 | 3300005347 | Ga0070668_100012073 | Ga0070668_1000120735 | 379 |
| 120 | 3300005353 | Ga0070669_100000017 | Ga0070669_10000001782 | 379 |
| 121 | 3300005353 | Ga0070669_100000041 | Ga0070669_10000004174 | 379 |
| 122 | 3300005355 | Ga0070671_100022673 | Ga0070671_1000226736 | 379 |
| 123 | 3300005365 | Ga0070688_100001642 | Ga0070688_1000016422 | 379 |
| 124 | 3300005366 | Ga0070659_100087537 | Ga0070659_1000875372 | 379 |
| 125 | 3300005367 | Ga0070667_100000969 | Ga0070667_10000096917 | 379 |
| 126 | 3300005367 | Ga0070667_100001215 | Ga0070667_1000012159 | 379 |
| 127 | 3300005367 | Ga0070667_100062510 | Ga0070667_1000625102 | 379 |
| 128 | 3300005455 | Ga0070663_100023270 | Ga0070663_1000232702 | 379 |
| 129 | 3300005466 | Ga0070685_10004021 | Ga0070685_100040217 | 379 |
| 130 | 3300005539 | Ga0068853_100031344 | Ga0068853_1000313445 | 379 |
| 131 | 3300005539 | Ga0068853_100213797 | Ga0068853_1002137972 | 379 |
| 132 | 3300005544 | Ga0070686_100000041 | Ga0070686_10000004152 | 379 |
| 133 | 3300005548 | Ga0070665_100000368 | Ga0070665_10000036814 | 379 |
| 134 | 3300005564 | Ga0070664_100109249 | Ga0070664_1001092492 | 379 |
| 135 | 3300005577 | Ga0068857_100211400 | Ga0068857_1002114002 | 379 |
| 136 | 3300005616 | Ga0068852_100275756 | Ga0068852_1002757562 | 379 |
| 137 | 3300005617 | Ga0068859_100002580 | Ga0068859_1000025804 | 379 |
| 138 | 3300005618 | Ga0068864_100000010 | Ga0068864_100000010130 | 379 |
| 139 | 3300005618 | Ga0068864_100000798 | Ga0068864_10000079817 | 379 |
| 140 | 3300005719 | Ga0068861_100025636 | Ga0068861_1000256364 | 379 |
| 141 | 3300005719 | Ga0068861_100127445 | Ga0068861_1001274452 | 379 |
| 142 | 3300005841 | Ga0068863_100000132 | Ga0068863_10000013213 | 379 |
| 143 | 3300005841 | Ga0068863_100000705 | Ga0068863_1000007054 | 379 |
| 144 | 3300005841 | Ga0068863_100068031 | Ga0068863_1000680312 | 379 |
| 145 | 3300005843 | Ga0068860_100000022 | Ga0068860_100000022214 | 379 |
| 146 | 3300005844 | Ga0068862_100000016 | Ga0068862_10000001624 | 379 |
| 147 | 3300005844 | Ga0068862_100000151 | Ga0068862_10000015113 | 379 |
| 148 | 3300005844 | Ga0068862_100000596 | Ga0068862_1000005969 | 379 |
| 149 | 3300005937 | Ga0081455_10000049 | Ga0081455_1000004966 | 379 |
| 150 | 3300006195 | Ga0075366_10139805 | Ga0075366_101398051 | 379 |
| 151 | 3300006931 | Ga0097620_100002581 | Ga0097620_1000025814 | 379 |
| 152 | 3300009011 | Ga0105251_10000264 | Ga0105251_1000026412 | 379 |
| 153 | 3300009101 | Ga0105247_10003404 | Ga0105247_100034044 | 379 |
| 154 | 3300009177 | Ga0105248_10000012 | Ga0105248_1000001284 | 379 |
| 155 | 3300009177 | Ga0105248_10007162 | Ga0105248_1000716211 | 379 |
| 156 | 3300009177 | Ga0105248_10086299 | Ga0105248_100862994 | 379 |
| 157 | 3300009545 | Ga0105237_10254739 | Ga0105237_102547391 | 379 |
| 158 | 3300009553 | Ga0105249_10000014 | Ga0105249_10000014216 | 379 |
| 159 | 3300009553 | Ga0105249_10000099 | Ga0105249_1000009955 | 379 |
| 160 | 3300013100 | Ga0157373_10008588 | Ga0157373_100085889 | 379 |
| 161 | 3300013102 | Ga0157371_10145038 | Ga0157371_101450382 | 379 |
| 162 | 3300013104 | Ga0157370_10003119 | Ga0157370_1000311917 | 379 |
| 163 | 3300013297 | Ga0157378_10190535 | Ga0157378_101905352 | 379 |
| 164 | 3300013306 | Ga0163162_10213751 | Ga0163162_102137514 | 379 |
| 165 | 3300013307 | Ga0157372_10099337 | Ga0157372_100993372 | 379 |
| 166 | 3300014325 | Ga0163163_10021759 | Ga0163163_100217594 | 379 |
| 167 | 3300014325 | Ga0163163_10166180 | Ga0163163_101661802 | 379 |
| 168 | 3300014326 | Ga0157380_10000120 | Ga0157380_1000012011 | 379 |
| 169 | 3300014326 | Ga0157380_10000350 | Ga0157380_1000035010 | 379 |
| 170 | 3300014326 | Ga0157380_10001483 | Ga0157380_100014833 | 379 |
| 171 | 3300014968 | Ga0157379_10077734 | Ga0157379_100777344 | 379 |
| 172 | 3300017792 | Ga0163161_10000860 | Ga0163161_1000086026 | 379 |
| 173 | 3300020070 | Ga0206356_10211798 | Ga0206356_102117982 | 379 |
| 174 | 3300025321 | Ga0207656_10002482 | Ga0207656_100024825 | 379 |
| 175 | 3300025735 | Ga0207713_1001017 | Ga0207713_100101717 | 379 |
| 176 | 3300025900 | Ga0207710_10010312 | Ga0207710_100103124 | 379 |
| 177 | 3300025903 | Ga0207680_10000007 | Ga0207680_1000000764 | 379 |
| 178 | 3300025904 | Ga0207647_10000323 | Ga0207647_100003235 | 379 |
| 179 | 3300025904 | Ga0207647_10003168 | Ga0207647_100031686 | 379 |
| 180 | 3300025911 | Ga0207654_10000521 | Ga0207654_1000052124 | 379 |
| 181 | 3300025913 | Ga0207695_10004592 | Ga0207695_1000459214 | 379 |
| 182 | 3300025914 | Ga0207671_10001130 | Ga0207671_1000113016 | 379 |
| 183 | 3300025919 | Ga0207657_10023543 | Ga0207657_100235436 | 379 |
| 184 | 3300025920 | Ga0207649_10049935 | Ga0207649_100499352 | 379 |
| 185 | 3300025923 | Ga0207681_10000013 | Ga0207681_10000013116 | 379 |
| 186 | 3300025923 | Ga0207681_10000029 | Ga0207681_10000029111 | 379 |
| 187 | 3300025924 | Ga0207694_10002569 | Ga0207694_1000256917 | 379 |
| 188 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008196 | 379 |
| 189 | 3300025925 | Ga0207650_10000182 | Ga0207650_1000018230 | 379 |
| 190 | 3300025932 | Ga0207690_10114333 | Ga0207690_101143331 | 379 |
| 191 | 3300025933 | Ga0207706_10087440 | Ga0207706_100874402 | 379 |
| 192 | 3300025936 | Ga0207670_10016382 | Ga0207670_100163824 | 379 |
| 193 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004591 | 379 |
| 194 | 3300025941 | Ga0207711_10002001 | Ga0207711_1000200114 | 379 |
| 195 | 3300025941 | Ga0207711_10082610 | Ga0207711_100826102 | 379 |
| 196 | 3300025949 | Ga0207667_10000825 | Ga0207667_1000082541 | 379 |
| 197 | 3300025961 | Ga0207712_10000004 | Ga0207712_1000000452 | 379 |
| 198 | 3300025961 | Ga0207712_10000161 | Ga0207712_100001617 | 379 |
| 199 | 3300025972 | Ga0207668_10007659 | Ga0207668_100076595 | 379 |
| 200 | 3300025981 | Ga0207640_10024429 | Ga0207640_100244292 | 379 |
| 201 | 3300025981 | Ga0207640_10260822 | Ga0207640_102608222 | 379 |
| 202 | 3300025986 | Ga0207658_10000405 | Ga0207658_1000040538 | 379 |
| 203 | 3300025986 | Ga0207658_10000462 | Ga0207658_100004629 | 379 |
| 204 | 3300025986 | Ga0207658_10002864 | Ga0207658_100028649 | 379 |
| 205 | 3300026035 | Ga0207703_10003457 | Ga0207703_100034579 | 379 |
| 206 | 3300026041 | Ga0207639_10013785 | Ga0207639_100137853 | 379 |
| 207 | 3300026041 | Ga0207639_10250173 | Ga0207639_102501732 | 379 |
| 208 | 3300026041 | Ga0207639_10353945 | Ga0207639_103539451 | 379 |
| 209 | 3300026067 | Ga0207678_10015297 | Ga0207678_100152972 | 379 |
| 210 | 3300026078 | Ga0207702_10007703 | Ga0207702_1000770311 | 379 |
| 211 | 3300026088 | Ga0207641_10000010 | Ga0207641_10000010237 | 379 |
| 212 | 3300026088 | Ga0207641_10000263 | Ga0207641_1000026326 | 379 |
| 213 | 3300026088 | Ga0207641_10054970 | Ga0207641_100549703 | 379 |
| 214 | 3300026095 | Ga0207676_10000012 | Ga0207676_10000012201 | 379 |
| 215 | 3300026095 | Ga0207676_10000046 | Ga0207676_1000004680 | 379 |
| 216 | 3300026095 | Ga0207676_10009645 | Ga0207676_100096453 | 379 |
| 217 | 3300026116 | Ga0207674_10171188 | Ga0207674_101711882 | 379 |
| 218 | 3300026118 | Ga0207675_100000131 | Ga0207675_10000013124 | 379 |
| 219 | 3300026118 | Ga0207675_100001041 | Ga0207675_1000010414 | 379 |
| 220 | 3300026142 | Ga0207698_10085878 | Ga0207698_100858781 | 379 |
| 221 | 3300028379 | Ga0268266_10000117 | Ga0268266_10000117150 | 379 |
| 222 | 3300028380 | Ga0268265_10000006 | Ga0268265_10000006223 | 379 |
| 223 | 3300028380 | Ga0268265_10000026 | Ga0268265_10000026164 | 379 |
| 224 | 3300028380 | Ga0268265_10000266 | Ga0268265_1000026645 | 379 |
| 225 | 3300028381 | Ga0268264_10000003 | Ga0268264_1000000366 | 379 |
| 226 | 3300031548 | Ga0307408_100003396 | Ga0307408_1000033961 | 379 |
| 227 | 3300031731 | Ga0307405_10043244 | Ga0307405_100432441 | 379 |
| 228 | 3300031901 | Ga0307406_10020843 | Ga0307406_100208433 | 379 |
| 229 | 3300031911 | Ga0307412_10000933 | Ga0307412_1000093317 | 379 |
| 230 | 3300031911 | Ga0307412_10225500 | Ga0307412_102255002 | 379 |
| 231 | 3300032002 | Ga0307416_100018226 | Ga0307416_1000182264 | 379 |
| 232 | 3300032004 | Ga0307414_10037901 | Ga0307414_100379013 | 379 |
| 233 | 3300032004 | Ga0307414_10166848 | Ga0307414_101668481 | 379 |
| 234 | 3300042005 | Ga0439448_0005114 | Ga0439448_0005114_74_1216 | 379 |
| 235 | 3300042005 | Ga0439448_0023592 | Ga0439448_0023592_109_1251 | 379 |
| 236 | 3300042012 | Ga0439455_0001942 | Ga0439455_0001942_890_2032 | 379 |
| 237 | 3300042157 | Ga0439458_0003996 | Ga0439458_0003996_1781_2923 | 379 |
| 238 | 3300042157 | Ga0439458_0004673 | Ga0439458_0004673_1955_3094 | 379 |
| 239 | 3300046460 | Ga0495638_0066410 | Ga0495638_0066410_438_1580 | 379 |
| 240 | 3300046616 | Ga0495668_0020625 | Ga0495668_0020625_1768_2907 | 379 |
| 241 | 3300046616 | Ga0495668_0021025 | Ga0495668_0021025_992_2131 | 379 |
| 242 | 3300046616 | Ga0495668_0026327 | Ga0495668_0026327_290_1429 | 379 |
| 243 | 3300046794 | Ga0495589_0045141 | Ga0495589_0045141_287_1426 | 379 |
| 244 | 3300047447 | Ga0495685_058251 | Ga0495685_058251_109_1248 | 379 |
| 245 | 3300048904 | Ga0496101_0154134 | Ga0496101_0154134_509_1648 | 379 |
| 246 | 3300048904 | Ga0496101_0216298 | Ga0496101_0216298_316_1455 | 379 |
| 247 | 3300048905 | Ga0496102_0000036 | Ga0496102_0000036_32381_33520 | 379 |
| 248 | 3300048905 | Ga0496102_0009074 | Ga0496102_0009074_5929_7068 | 379 |
| 249 | 3300048906 | Ga0496103_0000074 | Ga0496103_0000074_32355_33494 | 379 |
| 250 | 3300048906 | Ga0496103_0004026 | Ga0496103_0004026_1207_2346 | 379 |
| 251 | 3300048906 | Ga0496103_0107531 | Ga0496103_0107531_64_1203 | 379 |
| 252 | 3300048908 | Ga0496105_0020591 | Ga0496105_0020591_3143_4282 | 379 |
| 253 | 3300048909 | Ga0496106_0046477 | Ga0496106_0046477_212_1351 | 379 |
| 254 | 3300048910 | Ga0496107_0008992 | Ga0496107_0008992_1538_2677 | 379 |
| 255 | 3300048919 | Ga0496116_0001569 | Ga0496116_0001569_22466_23605 | 379 |
| 256 | 3300048919 | Ga0496116_0011962 | Ga0496116_0011962_5138_6277 | 379 |
| 257 | 3300048920 | Ga0496117_0000093 | Ga0496117_0000093_32347_33486 | 379 |
| 258 | 3300048920 | Ga0496117_0008800 | Ga0496117_0008800_8085_9224 | 379 |
| 259 | 3300048920 | Ga0496117_0039453 | Ga0496117_0039453_383_1522 | 379 |
| 260 | 3300048921 | Ga0496118_0000070 | Ga0496118_0000070_32351_33490 | 379 |
| 261 | 3300048921 | Ga0496118_0000416 | Ga0496118_0000416_10439_11578 | 379 |
| 262 | 3300048921 | Ga0496118_0008773 | Ga0496118_0008773_3091_4230 | 379 |
| 263 | 3300048927 | Ga0496124_0000225 | Ga0496124_0000225_32258_33397 | 379 |
| 264 | 3300049459 | Ga0495678_030206 | Ga0495678_030206_666_1805 | 379 |
| 265 | 3300049679 | Ga0501249_000065 | Ga0501249_000065_18745_19884 | 379 |
| 266 | 3300053087 | Ga0500643_000151 | Ga0500643_000151_54699_55838 | 379 |
| 267 | 3300053087 | Ga0500643_000348 | Ga0500643_000348_2996_4135 | 379 |
| 268 | 3300053087 | Ga0500643_000789 | Ga0500643_000789_2134_3273 | 379 |
| 269 | 3300053151 | Ga0500604_0023545 | Ga0500604_0023545_161_1300 | 379 |
| 270 | 3300053153 | Ga0500616_0019831 | Ga0500616_0019831_504_1646 | 379 |
| 271 | 3300053158 | Ga0500627_0000411 | Ga0500627_0000411_8305_9444 | 379 |
| 272 | 3300053730 | Ga0500645_013347 | Ga0500645_013347_864_2003 | 379 |
| 273 | 3300053735 | Ga0500596_006327 | Ga0500596_006327_149_1288 | 379 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar