F379116

General Info

Members Datasets Scaffolds Average Seq Length
273 182 268 373

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100003396|Ga0307408_1000033961
Length 382
Sequence MTDTPDRDQKTEAPTEKRRRDAAQKGDVLQSRELGTALVVLGGAAWFALAGPWMMEALERMLVRSLSFDDGALEAFDPGGAVMGMIGAIAIPLASLFAVTLIAAIGTPALLGSLGFRWSAVAFKGGKLNPLSGIKRIFGAQGLIELAKSMAKVVLLGAVGVWLLAGQADELMTLGRQDIGPALGQLGHSFIIAVLVMAXXXXVIALIDIPAQIFQRGGRLRMTKQEVKDEHKQTEGSPELKAAIRRKQHETLRGSARTAIAEASVVLVNPTHFAVALRYRPGLDAAPIVVARGRGATAQAIRDLADEHTVPVLSYPQLTRAIYYTARAGQVIREDLYIAVATVLAFVFNLDRAMAEGVAQPNVEVPPEARFDENGRPTPPPA

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
117 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
146 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
147 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
155 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
156 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
157 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
158 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
159 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
162 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
163 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
164 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
165 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
169 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
170 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
175 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
180 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
181 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
182 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 0.37
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 0
Rhizoplane 3.66
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000015 3300001904 Bacteria 28999
2 JGI24740J21852_10015927 3300001979 Bacteria 2730
3 JGI24740J21852_10024674 3300001979 Bacteria 2038
4 JGI24735J21928_10019158 3300002067 Unclassified 2104
5 JGI24750J21931_1000259 3300002070 Bacteria 9019
6 JGI24748J21848_1000023 3300002074 Bacteria 106523
7 JGI24738J21930_10003014 3300002075 Bacteria 4303
8 JGI24034J26672_10000010 3300002239 Bacteria 150746
9 JGI24751J29686_10003999 3300002459 Bacteria 2981
10 Ga0065704_10075029 3300005289 Bacteria 5834
11 Ga0065707_10082699 3300005295 Bacteria 12652
12 Ga0070658_10108690 3300005327 Bacteria 2296
13 Ga0070690_100000055 3300005330 Bacteria 55023
14 Ga0070670_100000012 3300005331 Bacteria 256314
15 Ga0070670_100000135 3300005331 Bacteria 69478
16 Ga0070666_10000009 3300005335 Bacteria 279209
17 Ga0070689_100028360 3300005340 Bacteria 4231
18 Ga0070661_100149775 3300005344 Bacteria 1763
19 Ga0070668_100000004 3300005347 Bacteria 189408
20 Ga0070668_100012073 3300005347 Bacteria 6435
21 Ga0070669_100000017 3300005353 Bacteria 195995
22 Ga0070669_100000041 3300005353 Bacteria 127426
23 Ga0070671_100000951 3300005355 Bacteria 21207
24 Ga0070671_100022673 3300005355 Bacteria 5129
25 Ga0070688_100001642 3300005365 Bacteria 11198
26 Ga0070659_100087537 3300005366 Bacteria 2494
27 Ga0070667_100000037 3300005367 Bacteria 172343
28 Ga0070667_100000969 3300005367 Bacteria 26391
29 Ga0070667_100001215 3300005367 Bacteria 23486
30 Ga0070667_100062510 3300005367 Bacteria 3154
31 Ga0070663_100023270 3300005455 Bacteria 4150
32 Ga0070685_10004021 3300005466 Bacteria 7423
33 Ga0068853_100031344 3300005539 Bacteria 4497
34 Ga0068853_100213797 3300005539 Bacteria 1758
35 Ga0070686_100000041 3300005544 Bacteria 104174
36 Ga0070686_100000577 3300005544 Bacteria 21790
37 Ga0070665_100000238 3300005548 Bacteria 91410
38 Ga0070665_100000368 3300005548 Bacteria 67541
39 Ga0070664_100109249 3300005564 Bacteria 2412
40 Ga0068857_100211400 3300005577 Bacteria 1770
41 Ga0068852_100135898 3300005616 Bacteria 2270
42 Ga0068852_100275756 3300005616 Bacteria 1620
43 Ga0068859_100002580 3300005617 Bacteria 18427
44 Ga0068859_100007063 3300005617 Bacteria 11405
45 Ga0068864_100000010 3300005618 Bacteria 358723
46 Ga0068864_100000798 3300005618 Bacteria 26391
47 Ga0068861_100025636 3300005719 Bacteria 4278
48 Ga0068861_100119446 3300005719 Bacteria 2124
49 Ga0068861_100127445 3300005719 Bacteria 2062
50 Ga0068863_100000132 3300005841 Bacteria 78811
51 Ga0068863_100000705 3300005841 Bacteria 33651
52 Ga0068863_100068031 3300005841 Bacteria 3369
53 Ga0068863_100493636 3300005841 Bacteria 1205
54 Ga0068858_100000466 3300005842 Bacteria 42207
55 Ga0068860_100000002 3300005843 Bacteria 627849
56 Ga0068860_100000022 3300005843 Bacteria 279209
57 Ga0068860_100024461 3300005843 Bacteria 5835
58 Ga0068862_100000016 3300005844 Bacteria 250031
59 Ga0068862_100000151 3300005844 Bacteria 78811
60 Ga0068862_100000580 3300005844 Bacteria 38040
61 Ga0068862_100000596 3300005844 Bacteria 37603
62 Ga0081455_10000049 3300005937 Bacteria 126459
63 Ga0075366_10139805 3300006195 Bacteria 1464
64 Ga0075434_100020512 3300006871 Bacteria 6410
65 Ga0097620_100002581 3300006931 Bacteria 18427
66 Ga0097620_100007063 3300006931 Bacteria 11405
67 Ga0105251_10000264 3300009011 Bacteria 52208
68 Ga0105247_10003404 3300009101 Bacteria 10393
69 Ga0105248_10000012 3300009177 Bacteria 333963
70 Ga0105248_10007162 3300009177 Bacteria 12236
71 Ga0105248_10086299 3300009177 Bacteria 3532
72 Ga0105237_10254739 3300009545 Bacteria 1757
73 Ga0105249_10000014 3300009553 Bacteria 283274
74 Ga0105249_10000099 3300009553 Bacteria 119885
75 Ga0105239_10000451 3300010375 Bacteria 59882
76 Ga0157326_1000348 3300012513 Bacteria 5467
77 Ga0157373_10008588 3300013100 Bacteria 7586
78 Ga0157371_10145038 3300013102 Bacteria 1691
79 Ga0157370_10003119 3300013104 Bacteria 19629
80 Ga0157378_10190535 3300013297 Bacteria 1934
81 Ga0163162_10213751 3300013306 Bacteria 2058
82 Ga0157372_10099337 3300013307 Bacteria 3320
83 Ga0163163_10021759 3300014325 Bacteria 6058
84 Ga0163163_10166180 3300014325 Bacteria 2253
85 Ga0157380_10000120 3300014326 Bacteria 43644
86 Ga0157380_10000350 3300014326 Bacteria 27615
87 Ga0157380_10001483 3300014326 Bacteria 15349
88 Ga0157379_10077734 3300014968 Bacteria 2972
89 Ga0163161_10000860 3300017792 Bacteria 23679
90 Ga0163161_10126096 3300017792 Bacteria 1928
91 Ga0206356_10211798 3300020070 Bacteria 6317
92 Ga0213875_10000269 3300021388 Bacteria 51323
93 Ga0207656_10002482 3300025321 Bacteria 6228
94 Ga0207713_1001017 3300025735 Bacteria 24423
95 Ga0207710_10010312 3300025900 Bacteria 3933
96 Ga0207680_10000007 3300025903 Bacteria 623574
97 Ga0207647_10000323 3300025904 Bacteria 39393
98 Ga0207647_10003168 3300025904 Bacteria 12342
99 Ga0207654_10000521 3300025911 Bacteria 22010
100 Ga0207695_10004592 3300025913 Bacteria 18760
101 Ga0207695_10019005 3300025913 Bacteria 7924
102 Ga0207671_10000740 3300025914 Bacteria 41467
103 Ga0207671_10001130 3300025914 Bacteria 32130
104 Ga0207657_10023543 3300025919 Bacteria 5732
105 Ga0207649_10049935 3300025920 Bacteria 2586
106 Ga0207681_10000013 3300025923 Bacteria 357411
107 Ga0207681_10000029 3300025923 Bacteria 177260
108 Ga0207694_10002569 3300025924 Bacteria 14737
109 Ga0207650_10000008 3300025925 Bacteria 498534
110 Ga0207650_10000182 3300025925 Bacteria 73032
111 Ga0207650_10183917 3300025925 Bacteria 1667
112 Ga0207644_10012210 3300025931 Bacteria 5700
113 Ga0207690_10114333 3300025932 Bacteria 1949
114 Ga0207706_10087440 3300025933 Bacteria 2740
115 Ga0207670_10016382 3300025936 Bacteria 4454
116 Ga0207711_10000004 3300025941 Bacteria 870636
117 Ga0207711_10002001 3300025941 Bacteria 18440
118 Ga0207711_10082610 3300025941 Bacteria 2809
119 Ga0207667_10000825 3300025949 Bacteria 40050
120 Ga0207667_10094612 3300025949 Bacteria 3085
121 Ga0207712_10000004 3300025961 Bacteria 614655
122 Ga0207712_10000161 3300025961 Bacteria 69260
123 Ga0207668_10000122 3300025972 Bacteria 54614
124 Ga0207668_10007659 3300025972 Bacteria 6426
125 Ga0207640_10024429 3300025981 Bacteria 3646
126 Ga0207640_10260822 3300025981 Bacteria 1350
127 Ga0207658_10000002 3300025986 Bacteria 1364188
128 Ga0207658_10000405 3300025986 Bacteria 41161
129 Ga0207658_10000462 3300025986 Bacteria 38001
130 Ga0207658_10002864 3300025986 Bacteria 12353
131 Ga0207703_10001057 3300026035 Bacteria 26252
132 Ga0207703_10003457 3300026035 Bacteria 13224
133 Ga0207639_10013785 3300026041 Bacteria 5667
134 Ga0207639_10250173 3300026041 Bacteria 1545
135 Ga0207639_10353945 3300026041 Bacteria 1312
136 Ga0207678_10015297 3300026067 Bacteria 6749
137 Ga0207702_10007703 3300026078 Bacteria 9147
138 Ga0207641_10000010 3300026088 Bacteria 402193
139 Ga0207641_10000263 3300026088 Bacteria 66525
140 Ga0207641_10054970 3300026088 Bacteria 3380
141 Ga0207676_10000012 3300026095 Bacteria 353971
142 Ga0207676_10000046 3300026095 Bacteria 149037
143 Ga0207676_10009645 3300026095 Bacteria 6869
144 Ga0207674_10171188 3300026116 Bacteria 2125
145 Ga0207674_10174513 3300026116 Bacteria 2102
146 Ga0207675_100000131 3300026118 Bacteria 62791
147 Ga0207675_100001041 3300026118 Bacteria 27481
148 Ga0207675_100053012 3300026118 Bacteria 3785
149 Ga0207698_10085878 3300026142 Bacteria 2557
150 Ga0207698_10196324 3300026142 Bacteria 1803
151 Ga0268266_10000061 3300028379 Bacteria 255207
152 Ga0268266_10000117 3300028379 Bacteria 163515
153 Ga0268265_10000006 3300028380 Bacteria 466482
154 Ga0268265_10000026 3300028380 Bacteria 246653
155 Ga0268265_10000266 3300028380 Bacteria 59618
156 Ga0268265_10000849 3300028380 Bacteria 28736
157 Ga0268264_10000001 3300028381 Bacteria 1221000
158 Ga0268264_10000003 3300028381 Bacteria 1141976
159 Ga0268264_10049664 3300028381 Bacteria 3491
160 Ga0307513_10043653 3300031456 Bacteria 4921
161 Ga0307408_100003396 3300031548 Bacteria 10921
162 Ga0307405_10043244 3300031731 Bacteria 2747
163 Ga0307406_10020843 3300031901 Bacteria 3868
164 Ga0307412_10000933 3300031911 Bacteria 16724
165 Ga0307412_10195798 3300031911 Bacteria 1531
166 Ga0307412_10225500 3300031911 Bacteria 1439
167 Ga0307416_100018226 3300032002 Bacteria 4940
168 Ga0307414_10037901 3300032004 Bacteria 3232
169 Ga0307414_10166848 3300032004 Bacteria 1756
170 Ga0395899_0000530 3300037312 Bacteria 41828
171 Ga0395900_0001531 3300037418 Bacteria 27485
172 Ga0395898_0000315 3300037466 Bacteria 111811
173 Ga0395905_0000005 3300037471 Bacteria 557808
174 Ga0436364_1538936 3300037853 Bacteria 27273
175 Ga0395901_0011646 3300038443 Bacteria 8907
176 Ga0436365_0813034 3300039437 Bacteria 2012
177 Ga0439448_0005114 3300042005 Bacteria 3730
178 Ga0439448_0023592 3300042005 Bacteria 1920
179 Ga0439454_001760 3300042011 Bacteria 2158
180 Ga0439455_0001942 3300042012 Bacteria 3641
181 Ga0439458_0003996 3300042157 Bacteria 3408
182 Ga0439458_0004673 3300042157 Bacteria 3125
183 Ga0466973_0088490 3300044659 Bacteria 2678
184 Ga0466968_0011259 3300044735 Bacteria 3483
185 Ga0495638_0066410 3300046460 Bacteria 2217
186 Ga0495643_0035047 3300046522 Bacteria 2765
187 Ga0495643_0130315 3300046522 Bacteria 1263
188 Ga0495654_0048311 3300046530 Bacteria 2089
189 Ga0495597_0027513 3300046542 Bacteria 2607
190 Ga0495668_0020625 3300046616 Bacteria 3788
191 Ga0495668_0021025 3300046616 Bacteria 3747
192 Ga0495668_0026327 3300046616 Bacteria 3301
193 Ga0495625_0160977 3300046660 Bacteria 1504
194 Ga0495649_0108708 3300046694 Bacteria 1471
195 Ga0495589_0045141 3300046794 Bacteria 2190
196 Ga0495685_058251 3300047447 Bacteria 1304
197 Ga0495673_0030270 3300047469 Bacteria 2544
198 Ga0495686_0000141 3300047472 Bacteria 144510
199 Ga0496101_0154134 3300048904 Bacteria 1759
200 Ga0496101_0216298 3300048904 Bacteria 1486
201 Ga0496102_0000036 3300048905 Bacteria 201896
202 Ga0496102_0009074 3300048905 Bacteria 8532
203 Ga0496103_0000074 3300048906 Bacteria 116385
204 Ga0496103_0004026 3300048906 Bacteria 8927
205 Ga0496103_0107531 3300048906 Bacteria 1769
206 Ga0496105_0020591 3300048908 Bacteria 5332
207 Ga0496106_0046477 3300048909 Bacteria 3264
208 Ga0496107_0008992 3300048910 Bacteria 6925
209 Ga0496116_0001569 3300048919 Bacteria 25208
210 Ga0496116_0011962 3300048919 Bacteria 7130
211 Ga0496117_0000093 3300048920 Bacteria 201862
212 Ga0496117_0008800 3300048920 Bacteria 9525
213 Ga0496117_0039453 3300048920 Bacteria 3485
214 Ga0496117_0056776 3300048920 Bacteria 2724
215 Ga0496118_0000070 3300048921 Bacteria 201866
216 Ga0496118_0000416 3300048921 Bacteria 70809
217 Ga0496118_0008773 3300048921 Bacteria 10365
218 Ga0496118_0055734 3300048921 Bacteria 2979
219 Ga0496121_0000880 3300048924 Bacteria 54384
220 Ga0496124_0000225 3300048927 Bacteria 110516
221 Ga0496126_0100277 3300048929 Bacteria 2535
222 Ga0495678_030206 3300049459 Bacteria 2269
223 Ga0501290_000348 3300049513 Bacteria 7544
224 Ga0501292_000096 3300049515 Bacteria 15530
225 Ga0501300_001248 3300049523 Bacteria 3850
226 Ga0501032_0017948 3300049569 Bacteria 4964
227 Ga0501034_0037966 3300049571 Bacteria 4878
228 Ga0501043_0018815 3300049579 Bacteria 5422
229 Ga0501043_0052610 3300049579 Bacteria 3198
230 Ga0501046_0058657 3300049580 Bacteria 3017
231 Ga0501047_0003521 3300049581 Bacteria 14779
232 Ga0501069_0012752 3300049585 Bacteria 4474
233 Ga0501206_003564 3300049653 Bacteria 1978
234 Ga0501233_043358 3300049668 Bacteria 1065
235 Ga0501235_018118 3300049669 Bacteria 1559
236 Ga0501249_000065 3300049679 Bacteria 38092
237 Ga0501257_001004 3300049686 Bacteria 5686
238 Ga0501261_000635 3300049690 Bacteria 4456
239 Ga0501225_0004441 3300049705 Bacteria 4176
240 Ga0501245_011516 3300049708 Bacteria 1288
241 Ga0501241_004057 3300049758 Bacteria 2754
242 Ga0501279_000051 3300049775 Bacteria 22449
243 Ga0501280_000167 3300049776 Bacteria 16933
244 Ga0501280_002714 3300049776 Bacteria 2878
245 Ga0501281_02608 3300049777 Bacteria 1311
246 Ga0501044_0003361 3300049823 Bacteria 18041
247 Ga0500643_000151 3300053087 Bacteria 70674
248 Ga0500643_000348 3300053087 Bacteria 36744
249 Ga0500643_000789 3300053087 Bacteria 20521
250 Ga0500647_0009783 3300053091 Bacteria 4219
251 Ga0500641_0055817 3300053096 Bacteria 1636
252 Ga0500592_000037 3300053116 Bacteria 42549
253 Ga0500618_003727 3300053125 Bacteria 5114
254 Ga0500655_000037 3300053133 Bacteria 38087
255 Ga0500568_0001282 3300053139 Bacteria 16541
256 Ga0500573_0058395 3300053140 Bacteria 2212
257 Ga0500590_002839 3300053148 Bacteria 7830
258 Ga0500604_0000061 3300053151 Bacteria 39582
259 Ga0500604_0023545 3300053151 Bacteria 1757
260 Ga0500604_0052991 3300053151 Bacteria 1257
261 Ga0500616_0000119 3300053153 Bacteria 143264
262 Ga0500616_0019831 3300053153 Bacteria 3786
263 Ga0500622_0002120 3300053156 Bacteria 14766
264 Ga0500627_0000411 3300053158 Bacteria 11566
265 Ga0500627_0000593 3300053158 Bacteria 9708
266 Ga0500570_027171 3300053724 Bacteria 3128
267 Ga0500645_013347 3300053730 Bacteria 2638
268 Ga0500596_006327 3300053735 Bacteria 2015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0108708 Ga0495649_0108708_304_1443 313
2 3300005843 Ga0068860_100024461 Ga0068860_1000244616 314
3 3300028381 Ga0268264_10049664 Ga0268264_100496643 314
4 3300049668 Ga0501233_043358 Ga0501233_043358_38_1015 317
5 3300049777 Ga0501281_02608 Ga0501281_02608_24_1001 317
6 3300006871 Ga0075434_100020512 Ga0075434_1000205121 319
7 3300046660 Ga0495625_0160977 Ga0495625_0160977_136_1275 321
8 3300049758 Ga0501241_004057 Ga0501241_004057_935_2059 323
9 3300049571 Ga0501034_0037966 Ga0501034_0037966_940_2073 324
10 3300049585 Ga0501069_0012752 Ga0501069_0012752_2086_3219 324
11 3300031456 Ga0307513_10043653 Ga0307513_100436534 326
12 3300042011 Ga0439454_001760 Ga0439454_001760_1161_2144 326
13 3300053096 Ga0500641_0055817 Ga0500641_0055817_481_1530 328
14 3300049523 Ga0501300_001248 Ga0501300_001248_216_1235 331
15 3300049776 Ga0501280_002714 Ga0501280_002714_748_1776 342
16 3300048929 Ga0496126_0100277 Ga0496126_0100277_807_1946 344
17 3300053140 Ga0500573_0058395 Ga0500573_0058395_964_2100 347
18 3300049686 Ga0501257_001004 Ga0501257_001004_3719_4858 354
19 3300012513 Ga0157326_1000348 Ga0157326_10003485 355
20 3300046522 Ga0495643_0035047 Ga0495643_0035047_625_1764 356
21 3300046522 Ga0495643_0130315 Ga0495643_0130315_82_1221 358
22 3300046542 Ga0495597_0027513 Ga0495597_0027513_586_1725 358
23 3300053091 Ga0500647_0009783 Ga0500647_0009783_2875_4014 358
24 3300053125 Ga0500618_003727 Ga0500618_003727_436_1575 358
25 3300053133 Ga0500655_000037 Ga0500655_000037_20094_21233 358
26 3300053148 Ga0500590_002839 Ga0500590_002839_4700_5839 358
27 3300053156 Ga0500622_0002120 Ga0500622_0002120_13172_14311 358
28 3300053724 Ga0500570_027171 Ga0500570_027171_1900_3039 358
29 3300005548 Ga0070665_100000238 Ga0070665_10000023815 359
30 3300028379 Ga0268266_10000061 Ga0268266_1000006166 359
31 3300017792 Ga0163161_10126096 Ga0163161_101260963 360
32 3300026116 Ga0207674_10174513 Ga0207674_101745132 360
33 3300049708 Ga0501245_011516 Ga0501245_011516_154_1260 360
34 3300005544 Ga0070686_100000577 Ga0070686_1000005774 364
35 3300049569 Ga0501032_0017948 Ga0501032_0017948_2108_3247 365
36 3300049579 Ga0501043_0018815 Ga0501043_0018815_3173_4312 365
37 3300049580 Ga0501046_0058657 Ga0501046_0058657_1128_2267 365
38 3300049581 Ga0501047_0003521 Ga0501047_0003521_4744_5883 365
39 3300044659 Ga0466973_0088490 Ga0466973_0088490_464_1603 369
40 3300031911 Ga0307412_10195798 Ga0307412_101957981 370
41 3300049513 Ga0501290_000348 Ga0501290_000348_4700_5836 370
42 3300049515 Ga0501292_000096 Ga0501292_000096_207_1343 370
43 3300049653 Ga0501206_003564 Ga0501206_003564_71_1207 370
44 3300049669 Ga0501235_018118 Ga0501235_018118_389_1525 370
45 3300049690 Ga0501261_000635 Ga0501261_000635_47_1183 370
46 3300049705 Ga0501225_0004441 Ga0501225_0004441_1380_2516 370
47 3300049775 Ga0501279_000051 Ga0501279_000051_14095_15231 370
48 3300049776 Ga0501280_000167 Ga0501280_000167_1686_2822 370
49 3300046530 Ga0495654_0048311 Ga0495654_0048311_17_1156 371
50 3300053116 Ga0500592_000037 Ga0500592_000037_35932_37071 371
51 3300053151 Ga0500604_0052991 Ga0500604_0052991_75_1214 371
52 3300053158 Ga0500627_0000593 Ga0500627_0000593_8551_9690 371
53 3300005616 Ga0068852_100135898 Ga0068852_1001358982 372
54 3300026142 Ga0207698_10196324 Ga0207698_101963242 372
55 3300053139 Ga0500568_0001282 Ga0500568_0001282_13725_14864 373
56 3300053151 Ga0500604_0000061 Ga0500604_0000061_5570_6709 373
57 3300053153 Ga0500616_0000119 Ga0500616_0000119_1807_2946 373
58 iso_pu_bacteria 2582581305 2585262351 375
59 iso_pu_bacteria 2643221541 2643730387 375
60 iso_pu_bacteria 2643221605 2644037199 375
61 iso_pu_bacteria 2643221606 2644043556 375
62 iso_pu_bacteria 2643221671 2644393715 375
63 3300037312 Ga0395899_0000530 Ga0395899_0000530_25096_26232 377
64 3300037418 Ga0395900_0001531 Ga0395900_0001531_20633_21769 377
65 3300037466 Ga0395898_0000315 Ga0395898_0000315_74619_75755 377
66 3300037471 Ga0395905_0000005 Ga0395905_0000005_435393_436529 377
67 3300038443 Ga0395901_0011646 Ga0395901_0011646_2092_3228 377
68 3300005347 Ga0070668_100000004 Ga0070668_10000000427 378
69 3300005355 Ga0070671_100000951 Ga0070671_1000009512 378
70 3300005367 Ga0070667_100000037 Ga0070667_10000003725 378
71 3300005617 Ga0068859_100007063 Ga0068859_1000070638 378
72 3300005719 Ga0068861_100119446 Ga0068861_1001194461 378
73 3300005841 Ga0068863_100493636 Ga0068863_1004936361 378
74 3300005842 Ga0068858_100000466 Ga0068858_10000046626 378
75 3300005843 Ga0068860_100000002 Ga0068860_100000002581 378
76 3300005844 Ga0068862_100000580 Ga0068862_1000005806 378
77 3300006931 Ga0097620_100007063 Ga0097620_1000070632 378
78 3300010375 Ga0105239_10000451 Ga0105239_100004516 378
79 3300021388 Ga0213875_10000269 Ga0213875_1000026941 378
80 3300025913 Ga0207695_10019005 Ga0207695_100190056 378
81 3300025914 Ga0207671_10000740 Ga0207671_100007408 378
82 3300025925 Ga0207650_10183917 Ga0207650_101839171 378
83 3300025931 Ga0207644_10012210 Ga0207644_100122102 378
84 3300025949 Ga0207667_10094612 Ga0207667_100946124 378
85 3300025972 Ga0207668_10000122 Ga0207668_1000012227 378
86 3300025986 Ga0207658_10000002 Ga0207658_10000002864 378
87 3300026035 Ga0207703_10001057 Ga0207703_1000105712 378
88 3300026118 Ga0207675_100053012 Ga0207675_1000530123 378
89 3300028380 Ga0268265_10000849 Ga0268265_1000084922 378
90 3300028381 Ga0268264_10000001 Ga0268264_100000011189 378
91 3300037853 Ga0436364_1538936 Ga0436364_1538936_12245_13381 378
92 3300039437 Ga0436365_0813034 Ga0436365_0813034_86_1222 378
93 3300044735 Ga0466968_0011259 Ga0466968_0011259_1526_2662 378
94 3300047469 Ga0495673_0030270 Ga0495673_0030270_759_1895 378
95 3300047472 Ga0495686_0000141 Ga0495686_0000141_124636_125772 378
96 3300048920 Ga0496117_0056776 Ga0496117_0056776_1363_2499 378
97 3300048921 Ga0496118_0055734 Ga0496118_0055734_1261_2397 378
98 3300048924 Ga0496121_0000880 Ga0496121_0000880_41238_42374 378
99 3300049579 Ga0501043_0052610 Ga0501043_0052610_346_1482 378
100 3300049823 Ga0501044_0003361 Ga0501044_0003361_2846_3982 378
101 3300001904 JGI24736J21556_1000015 JGI24736J21556_100001522 379
102 3300001979 JGI24740J21852_10015927 JGI24740J21852_100159272 379
103 3300001979 JGI24740J21852_10024674 JGI24740J21852_100246742 379
104 3300002067 JGI24735J21928_10019158 JGI24735J21928_100191582 379
105 3300002070 JGI24750J21931_1000259 JGI24750J21931_10002595 379
106 3300002074 JGI24748J21848_1000023 JGI24748J21848_100002364 379
107 3300002075 JGI24738J21930_10003014 JGI24738J21930_100030142 379
108 3300002239 JGI24034J26672_10000010 JGI24034J26672_1000001044 379
109 3300002459 JGI24751J29686_10003999 JGI24751J29686_100039991 379
110 3300005289 Ga0065704_10075029 Ga0065704_100750296 379
111 3300005295 Ga0065707_10082699 Ga0065707_100826996 379
112 3300005327 Ga0070658_10108690 Ga0070658_101086901 379
113 3300005330 Ga0070690_100000055 Ga0070690_10000005544 379
114 3300005331 Ga0070670_100000012 Ga0070670_10000001234 379
115 3300005331 Ga0070670_100000135 Ga0070670_10000013511 379
116 3300005335 Ga0070666_10000009 Ga0070666_10000009214 379
117 3300005340 Ga0070689_100028360 Ga0070689_1000283604 379
118 3300005344 Ga0070661_100149775 Ga0070661_1001497752 379
119 3300005347 Ga0070668_100012073 Ga0070668_1000120735 379
120 3300005353 Ga0070669_100000017 Ga0070669_10000001782 379
121 3300005353 Ga0070669_100000041 Ga0070669_10000004174 379
122 3300005355 Ga0070671_100022673 Ga0070671_1000226736 379
123 3300005365 Ga0070688_100001642 Ga0070688_1000016422 379
124 3300005366 Ga0070659_100087537 Ga0070659_1000875372 379
125 3300005367 Ga0070667_100000969 Ga0070667_10000096917 379
126 3300005367 Ga0070667_100001215 Ga0070667_1000012159 379
127 3300005367 Ga0070667_100062510 Ga0070667_1000625102 379
128 3300005455 Ga0070663_100023270 Ga0070663_1000232702 379
129 3300005466 Ga0070685_10004021 Ga0070685_100040217 379
130 3300005539 Ga0068853_100031344 Ga0068853_1000313445 379
131 3300005539 Ga0068853_100213797 Ga0068853_1002137972 379
132 3300005544 Ga0070686_100000041 Ga0070686_10000004152 379
133 3300005548 Ga0070665_100000368 Ga0070665_10000036814 379
134 3300005564 Ga0070664_100109249 Ga0070664_1001092492 379
135 3300005577 Ga0068857_100211400 Ga0068857_1002114002 379
136 3300005616 Ga0068852_100275756 Ga0068852_1002757562 379
137 3300005617 Ga0068859_100002580 Ga0068859_1000025804 379
138 3300005618 Ga0068864_100000010 Ga0068864_100000010130 379
139 3300005618 Ga0068864_100000798 Ga0068864_10000079817 379
140 3300005719 Ga0068861_100025636 Ga0068861_1000256364 379
141 3300005719 Ga0068861_100127445 Ga0068861_1001274452 379
142 3300005841 Ga0068863_100000132 Ga0068863_10000013213 379
143 3300005841 Ga0068863_100000705 Ga0068863_1000007054 379
144 3300005841 Ga0068863_100068031 Ga0068863_1000680312 379
145 3300005843 Ga0068860_100000022 Ga0068860_100000022214 379
146 3300005844 Ga0068862_100000016 Ga0068862_10000001624 379
147 3300005844 Ga0068862_100000151 Ga0068862_10000015113 379
148 3300005844 Ga0068862_100000596 Ga0068862_1000005969 379
149 3300005937 Ga0081455_10000049 Ga0081455_1000004966 379
150 3300006195 Ga0075366_10139805 Ga0075366_101398051 379
151 3300006931 Ga0097620_100002581 Ga0097620_1000025814 379
152 3300009011 Ga0105251_10000264 Ga0105251_1000026412 379
153 3300009101 Ga0105247_10003404 Ga0105247_100034044 379
154 3300009177 Ga0105248_10000012 Ga0105248_1000001284 379
155 3300009177 Ga0105248_10007162 Ga0105248_1000716211 379
156 3300009177 Ga0105248_10086299 Ga0105248_100862994 379
157 3300009545 Ga0105237_10254739 Ga0105237_102547391 379
158 3300009553 Ga0105249_10000014 Ga0105249_10000014216 379
159 3300009553 Ga0105249_10000099 Ga0105249_1000009955 379
160 3300013100 Ga0157373_10008588 Ga0157373_100085889 379
161 3300013102 Ga0157371_10145038 Ga0157371_101450382 379
162 3300013104 Ga0157370_10003119 Ga0157370_1000311917 379
163 3300013297 Ga0157378_10190535 Ga0157378_101905352 379
164 3300013306 Ga0163162_10213751 Ga0163162_102137514 379
165 3300013307 Ga0157372_10099337 Ga0157372_100993372 379
166 3300014325 Ga0163163_10021759 Ga0163163_100217594 379
167 3300014325 Ga0163163_10166180 Ga0163163_101661802 379
168 3300014326 Ga0157380_10000120 Ga0157380_1000012011 379
169 3300014326 Ga0157380_10000350 Ga0157380_1000035010 379
170 3300014326 Ga0157380_10001483 Ga0157380_100014833 379
171 3300014968 Ga0157379_10077734 Ga0157379_100777344 379
172 3300017792 Ga0163161_10000860 Ga0163161_1000086026 379
173 3300020070 Ga0206356_10211798 Ga0206356_102117982 379
174 3300025321 Ga0207656_10002482 Ga0207656_100024825 379
175 3300025735 Ga0207713_1001017 Ga0207713_100101717 379
176 3300025900 Ga0207710_10010312 Ga0207710_100103124 379
177 3300025903 Ga0207680_10000007 Ga0207680_1000000764 379
178 3300025904 Ga0207647_10000323 Ga0207647_100003235 379
179 3300025904 Ga0207647_10003168 Ga0207647_100031686 379
180 3300025911 Ga0207654_10000521 Ga0207654_1000052124 379
181 3300025913 Ga0207695_10004592 Ga0207695_1000459214 379
182 3300025914 Ga0207671_10001130 Ga0207671_1000113016 379
183 3300025919 Ga0207657_10023543 Ga0207657_100235436 379
184 3300025920 Ga0207649_10049935 Ga0207649_100499352 379
185 3300025923 Ga0207681_10000013 Ga0207681_10000013116 379
186 3300025923 Ga0207681_10000029 Ga0207681_10000029111 379
187 3300025924 Ga0207694_10002569 Ga0207694_1000256917 379
188 3300025925 Ga0207650_10000008 Ga0207650_10000008196 379
189 3300025925 Ga0207650_10000182 Ga0207650_1000018230 379
190 3300025932 Ga0207690_10114333 Ga0207690_101143331 379
191 3300025933 Ga0207706_10087440 Ga0207706_100874402 379
192 3300025936 Ga0207670_10016382 Ga0207670_100163824 379
193 3300025941 Ga0207711_10000004 Ga0207711_10000004591 379
194 3300025941 Ga0207711_10002001 Ga0207711_1000200114 379
195 3300025941 Ga0207711_10082610 Ga0207711_100826102 379
196 3300025949 Ga0207667_10000825 Ga0207667_1000082541 379
197 3300025961 Ga0207712_10000004 Ga0207712_1000000452 379
198 3300025961 Ga0207712_10000161 Ga0207712_100001617 379
199 3300025972 Ga0207668_10007659 Ga0207668_100076595 379
200 3300025981 Ga0207640_10024429 Ga0207640_100244292 379
201 3300025981 Ga0207640_10260822 Ga0207640_102608222 379
202 3300025986 Ga0207658_10000405 Ga0207658_1000040538 379
203 3300025986 Ga0207658_10000462 Ga0207658_100004629 379
204 3300025986 Ga0207658_10002864 Ga0207658_100028649 379
205 3300026035 Ga0207703_10003457 Ga0207703_100034579 379
206 3300026041 Ga0207639_10013785 Ga0207639_100137853 379
207 3300026041 Ga0207639_10250173 Ga0207639_102501732 379
208 3300026041 Ga0207639_10353945 Ga0207639_103539451 379
209 3300026067 Ga0207678_10015297 Ga0207678_100152972 379
210 3300026078 Ga0207702_10007703 Ga0207702_1000770311 379
211 3300026088 Ga0207641_10000010 Ga0207641_10000010237 379
212 3300026088 Ga0207641_10000263 Ga0207641_1000026326 379
213 3300026088 Ga0207641_10054970 Ga0207641_100549703 379
214 3300026095 Ga0207676_10000012 Ga0207676_10000012201 379
215 3300026095 Ga0207676_10000046 Ga0207676_1000004680 379
216 3300026095 Ga0207676_10009645 Ga0207676_100096453 379
217 3300026116 Ga0207674_10171188 Ga0207674_101711882 379
218 3300026118 Ga0207675_100000131 Ga0207675_10000013124 379
219 3300026118 Ga0207675_100001041 Ga0207675_1000010414 379
220 3300026142 Ga0207698_10085878 Ga0207698_100858781 379
221 3300028379 Ga0268266_10000117 Ga0268266_10000117150 379
222 3300028380 Ga0268265_10000006 Ga0268265_10000006223 379
223 3300028380 Ga0268265_10000026 Ga0268265_10000026164 379
224 3300028380 Ga0268265_10000266 Ga0268265_1000026645 379
225 3300028381 Ga0268264_10000003 Ga0268264_1000000366 379
226 3300031548 Ga0307408_100003396 Ga0307408_1000033961 379
227 3300031731 Ga0307405_10043244 Ga0307405_100432441 379
228 3300031901 Ga0307406_10020843 Ga0307406_100208433 379
229 3300031911 Ga0307412_10000933 Ga0307412_1000093317 379
230 3300031911 Ga0307412_10225500 Ga0307412_102255002 379
231 3300032002 Ga0307416_100018226 Ga0307416_1000182264 379
232 3300032004 Ga0307414_10037901 Ga0307414_100379013 379
233 3300032004 Ga0307414_10166848 Ga0307414_101668481 379
234 3300042005 Ga0439448_0005114 Ga0439448_0005114_74_1216 379
235 3300042005 Ga0439448_0023592 Ga0439448_0023592_109_1251 379
236 3300042012 Ga0439455_0001942 Ga0439455_0001942_890_2032 379
237 3300042157 Ga0439458_0003996 Ga0439458_0003996_1781_2923 379
238 3300042157 Ga0439458_0004673 Ga0439458_0004673_1955_3094 379
239 3300046460 Ga0495638_0066410 Ga0495638_0066410_438_1580 379
240 3300046616 Ga0495668_0020625 Ga0495668_0020625_1768_2907 379
241 3300046616 Ga0495668_0021025 Ga0495668_0021025_992_2131 379
242 3300046616 Ga0495668_0026327 Ga0495668_0026327_290_1429 379
243 3300046794 Ga0495589_0045141 Ga0495589_0045141_287_1426 379
244 3300047447 Ga0495685_058251 Ga0495685_058251_109_1248 379
245 3300048904 Ga0496101_0154134 Ga0496101_0154134_509_1648 379
246 3300048904 Ga0496101_0216298 Ga0496101_0216298_316_1455 379
247 3300048905 Ga0496102_0000036 Ga0496102_0000036_32381_33520 379
248 3300048905 Ga0496102_0009074 Ga0496102_0009074_5929_7068 379
249 3300048906 Ga0496103_0000074 Ga0496103_0000074_32355_33494 379
250 3300048906 Ga0496103_0004026 Ga0496103_0004026_1207_2346 379
251 3300048906 Ga0496103_0107531 Ga0496103_0107531_64_1203 379
252 3300048908 Ga0496105_0020591 Ga0496105_0020591_3143_4282 379
253 3300048909 Ga0496106_0046477 Ga0496106_0046477_212_1351 379
254 3300048910 Ga0496107_0008992 Ga0496107_0008992_1538_2677 379
255 3300048919 Ga0496116_0001569 Ga0496116_0001569_22466_23605 379
256 3300048919 Ga0496116_0011962 Ga0496116_0011962_5138_6277 379
257 3300048920 Ga0496117_0000093 Ga0496117_0000093_32347_33486 379
258 3300048920 Ga0496117_0008800 Ga0496117_0008800_8085_9224 379
259 3300048920 Ga0496117_0039453 Ga0496117_0039453_383_1522 379
260 3300048921 Ga0496118_0000070 Ga0496118_0000070_32351_33490 379
261 3300048921 Ga0496118_0000416 Ga0496118_0000416_10439_11578 379
262 3300048921 Ga0496118_0008773 Ga0496118_0008773_3091_4230 379
263 3300048927 Ga0496124_0000225 Ga0496124_0000225_32258_33397 379
264 3300049459 Ga0495678_030206 Ga0495678_030206_666_1805 379
265 3300049679 Ga0501249_000065 Ga0501249_000065_18745_19884 379
266 3300053087 Ga0500643_000151 Ga0500643_000151_54699_55838 379
267 3300053087 Ga0500643_000348 Ga0500643_000348_2996_4135 379
268 3300053087 Ga0500643_000789 Ga0500643_000789_2134_3273 379
269 3300053151 Ga0500604_0023545 Ga0500604_0023545_161_1300 379
270 3300053153 Ga0500616_0019831 Ga0500616_0019831_504_1646 379
271 3300053158 Ga0500627_0000411 Ga0500627_0000411_8305_9444 379
272 3300053730 Ga0500645_013347 Ga0500645_013347_864_2003 379
273 3300053735 Ga0500596_006327 Ga0500596_006327_149_1288 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01312

Bac_export_2

FlhB HrpN YscU SpaS Family

8

347

0.97

Feature Viewer

pLDDT pTM Quality
70.5 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map