F379007

General Info

Members Datasets Scaffolds Average Seq Length
273 172 546 284

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10070862|Ga0105243_100708622
Length 298
Sequence MAQIGVNAWVWTSPVNTEAFAKLAPRVKEMGFDLIEFGVEGTGDLDYTRAAAIARDLGLGASVCAAMGPDRDLIHPDENIRKSSAEYVRHCIDAAHVLGGANVIGPLYSSVGRCWQQTPDDRAKDLDILVTQLKALSKYAGDRGVTLAVEPLNRFETSFLNLAEQAIEVVDRVDSPSCGILLDTFHMNIEEKSIGDAIRAAGPRLKHLHTCENDRGAPGSGHVPWDEVAAACHDIGFDGPFVIESFTSAVKSIARAAAIWRAFAPTQDALAQDGLRYLRGLLASSHSQAGSQSAVRRA

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
156 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
161 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 4.76
Rhizosphere 91.58
Stem 0
Stem Tuber 0
Unclassified 12.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10070862 3300009148 Bacteria 2816
2 MRS1b_contig_2607832 2162886011 Unclassified 1055
3 Ga0065712_10070888 3300005290 Bacteria 5627
4 Ga0065712_10093538 3300005290 Bacteria 2288
5 Ga0065715_10089902 3300005293 Bacteria 8182
6 Ga0065715_10091003 3300005293 Bacteria 6225
7 Ga0065715_10095748 3300005293 Bacteria 4015
8 Ga0065707_10085636 3300005295 Bacteria 5987
9 Ga0070683_100064332 3300005329 Bacteria 3414
10 Ga0070683_100319264 3300005329 Bacteria 1478
11 Ga0070670_100001651 3300005331 Bacteria 18068
12 Ga0070670_100003280 3300005331 Bacteria 13382
13 Ga0070670_100014347 3300005331 Bacteria 6799
14 Ga0068869_100078195 3300005334 Bacteria 2463
15 Ga0070666_10079982 3300005335 Unclassified 2233
16 Ga0070680_100016737 3300005336 Bacteria 5771
17 Ga0070660_100024425 3300005339 Unclassified 4482
18 Ga0070687_100319642 3300005343 Bacteria 991
19 Ga0070661_100027210 3300005344 Bacteria 4116
20 Ga0070668_100155397 3300005347 Bacteria 1853
21 Ga0070669_100001018 3300005353 Bacteria 20415
22 Ga0070675_100168458 3300005354 Bacteria 1888
23 Ga0070675_100355864 3300005354 Bacteria 1299
24 Ga0070675_100566470 3300005354 Bacteria 1028
25 Ga0070674_100096754 3300005356 Bacteria 2143
26 Ga0070673_100077111 3300005364 Bacteria 2693
27 Ga0070673_100155411 3300005364 Bacteria 1941
28 Ga0070659_100025473 3300005366 Bacteria 4543
29 Ga0070711_100495885 3300005439 Bacteria 1006
30 Ga0070700_100048633 3300005441 Bacteria 2629
31 Ga0070700_100139178 3300005441 Bacteria 1647
32 Ga0070663_100096307 3300005455 Unclassified 2201
33 Ga0070663_100102484 3300005455 Bacteria 2138
34 Ga0070678_100078421 3300005456 Bacteria 2495
35 Ga0070662_100175180 3300005457 Bacteria 1687
36 Ga0070681_10047457 3300005458 Bacteria 4293
37 Ga0070685_10234202 3300005466 Bacteria 1209
38 Ga0070698_100000628 3300005471 Bacteria 38055
39 Ga0070679_100016442 3300005530 Bacteria 7136
40 Ga0070684_100001901 3300005535 Bacteria 15296
41 Ga0070684_100075868 3300005535 Bacteria 2966
42 Ga0070684_100110906 3300005535 Bacteria 2460
43 Ga0068853_100023201 3300005539 Bacteria 5192
44 Ga0070672_100275010 3300005543 Unclassified 1423
45 Ga0070672_100277841 3300005543 Bacteria 1415
46 Ga0070672_100297307 3300005543 Bacteria 1368
47 Ga0070693_100037176 3300005547 Bacteria 2713
48 Ga0068855_100039340 3300005563 Bacteria 5614
49 Ga0070664_100010150 3300005564 Bacteria 7637
50 Ga0070664_100030192 3300005564 Bacteria 4522
51 Ga0070664_100561569 3300005564 Bacteria 1056
52 Ga0068857_100014547 3300005577 Bacteria 6864
53 Ga0068857_100102996 3300005577 Bacteria 2563
54 Ga0068857_100356820 3300005577 Bacteria 1355
55 Ga0068854_100105516 3300005578 Bacteria 2118
56 Ga0068852_100539060 3300005616 Bacteria 1166
57 Ga0068859_100430226 3300005617 Unclassified 1416
58 Ga0068864_100456293 3300005618 Unclassified 1223
59 Ga0068863_100055121 3300005841 Bacteria 3765
60 Ga0068863_100368766 3300005841 Bacteria 1401
61 Ga0068862_100034599 3300005844 Bacteria 4276
62 Ga0068862_100159444 3300005844 Bacteria 2013
63 Ga0081455_10318828 3300005937 Bacteria 1108
64 Ga0075365_10025071 3300006038 Bacteria 3772
65 Ga0075368_10014273 3300006042 Bacteria 2931
66 Ga0075364_10006054 3300006051 Bacteria 7080
67 Ga0075364_10025493 3300006051 Bacteria 3764
68 Ga0075370_10088088 3300006353 Bacteria 1789
69 Ga0075428_100000769 3300006844 Bacteria 33377
70 Ga0075428_100049638 3300006844 Bacteria 4604
71 Ga0075428_100261529 3300006844 Bacteria 1863
72 Ga0075428_100766479 3300006844 Bacteria 1026
73 Ga0075430_100095171 3300006846 Bacteria 2489
74 Ga0075431_100002371 3300006847 Bacteria 18103
75 Ga0075431_100155021 3300006847 Bacteria 2357
76 Ga0075431_100224268 3300006847 Bacteria 1917
77 Ga0075433_10018363 3300006852 Bacteria 5812
78 Ga0075433_10025551 3300006852 Bacteria 4994
79 Ga0075433_10058658 3300006852 Bacteria 3367
80 Ga0075433_10125779 3300006852 Bacteria 2277
81 Ga0075434_100003831 3300006871 Bacteria 13453
82 Ga0075434_100054044 3300006871 Bacteria 3990
83 Ga0075434_100142826 3300006871 Bacteria 2414
84 Ga0075429_100006769 3300006880 Bacteria 9938
85 Ga0075429_100018302 3300006880 Bacteria 6065
86 Ga0075429_100139878 3300006880 Bacteria 2119
87 Ga0075429_100296878 3300006880 Bacteria 1415
88 Ga0097620_100430250 3300006931 Unclassified 1416
89 Ga0075435_100371556 3300007076 Bacteria 1228
90 Ga0105240_10075671 3300009093 Unclassified 4152
91 Ga0111539_10001612 3300009094 Bacteria 30141
92 Ga0111539_10053954 3300009094 Bacteria 4785
93 Ga0111539_10057949 3300009094 Bacteria 4597
94 Ga0111539_10058067 3300009094 Bacteria 4592
95 Ga0111539_10271918 3300009094 Bacteria 1972
96 Ga0111539_10681391 3300009094 Bacteria 1197
97 Ga0111539_10701184 3300009094 Bacteria 1178
98 Ga0105245_10103867 3300009098 Bacteria 2634
99 Ga0114129_10000241 3300009147 Bacteria 61333
100 Ga0114129_10059611 3300009147 Bacteria 5336
101 Ga0114129_10215239 3300009147 Bacteria 2595
102 Ga0105248_10034409 3300009177 Bacteria 5665
103 Ga0105237_10082540 3300009545 Unclassified 3204
104 Ga0105238_10016548 3300009551 Bacteria 7465
105 Ga0105238_10915637 3300009551 Bacteria 896
106 Ga0105249_10086097 3300009553 Bacteria 2930
107 Ga0105249_10193616 3300009553 Bacteria 1986
108 Ga0157371_10060619 3300013102 Bacteria 2683
109 Ga0157370_10115505 3300013104 Bacteria 2507
110 Ga0157374_10021261 3300013296 Bacteria 5770
111 Ga0163162_10236176 3300013306 Unclassified 1958
112 Ga0163163_10111323 3300014325 Unclassified 2767
113 Ga0157380_10255012 3300014326 Bacteria 1590
114 Ga0157377_10061031 3300014745 Bacteria 2154
115 Ga0213876_10083730 3300021384 Bacteria 1688
116 Ga0207697_10000685 3300025315 Bacteria 19294
117 Ga0207697_10031825 3300025315 Bacteria 2158
118 Ga0207697_10067421 3300025315 Unclassified 1496
119 Ga0207688_10211989 3300025901 Bacteria 1164
120 Ga0207680_10240724 3300025903 Unclassified 1247
121 Ga0207647_10003063 3300025904 Bacteria 12562
122 Ga0207705_10009541 3300025909 Bacteria 7062
123 Ga0207707_10029129 3300025912 Bacteria 4825
124 Ga0207671_10101984 3300025914 Bacteria 2175
125 Ga0207663_10391454 3300025916 Bacteria 1061
126 Ga0207660_10152016 3300025917 Unclassified 1779
127 Ga0207657_10001188 3300025919 Bacteria 27666
128 Ga0207649_10035342 3300025920 Bacteria 3002
129 Ga0207649_10194553 3300025920 Unclassified 1428
130 Ga0207652_10021169 3300025921 Bacteria 5366
131 Ga0207652_10545160 3300025921 Bacteria 1043
132 Ga0207681_10008748 3300025923 Bacteria 6185
133 Ga0207694_10064746 3300025924 Unclassified 2849
134 Ga0207650_10034333 3300025925 Bacteria 3678
135 Ga0207650_10053465 3300025925 Unclassified 2993
136 Ga0207650_10197781 3300025925 Bacteria 1609
137 Ga0207659_10191664 3300025926 Unclassified 1627
138 Ga0207659_10241866 3300025926 Bacteria 1460
139 Ga0207659_10478797 3300025926 Bacteria 1052
140 Ga0207644_10048350 3300025931 Unclassified 3041
141 Ga0207644_10209988 3300025931 Bacteria 1539
142 Ga0207690_10016030 3300025932 Unclassified 4555
143 Ga0207706_10256697 3300025933 Unclassified 1526
144 Ga0207709_10124198 3300025935 Bacteria 1748
145 Ga0207669_10029423 3300025937 Bacteria 3038
146 Ga0207669_10070898 3300025937 Bacteria 2187
147 Ga0207691_10079777 3300025940 Bacteria 2945
148 Ga0207691_10159886 3300025940 Bacteria 1977
149 Ga0207711_10134400 3300025941 Unclassified 2220
150 Ga0207661_10008309 3300025944 Bacteria 7415
151 Ga0207661_10044895 3300025944 Bacteria 3495
152 Ga0207661_10229470 3300025944 Unclassified 1643
153 Ga0207661_10254600 3300025944 Bacteria 1562
154 Ga0207679_10010653 3300025945 Bacteria 5927
155 Ga0207679_10013971 3300025945 Bacteria 5266
156 Ga0207667_10039741 3300025949 Bacteria 5011
157 Ga0207651_10109754 3300025960 Bacteria 2068
158 Ga0207640_10134176 3300025981 Bacteria 1794
159 Ga0207703_10476384 3300026035 Unclassified 1169
160 Ga0207678_10000939 3300026067 Bacteria 26562
161 Ga0207678_10116429 3300026067 Unclassified 2280
162 Ga0207648_10312105 3300026089 Bacteria 1412
163 Ga0207674_10001500 3300026116 Bacteria 30118
164 Ga0207674_10322564 3300026116 Bacteria 1494
165 Ga0207674_10351004 3300026116 Bacteria 1426
166 Ga0207683_10085809 3300026121 Bacteria 2799
167 Ga0207428_10007151 3300027907 Bacteria 10211
168 Ga0207428_10007767 3300027907 Bacteria 9760
169 Ga0207428_10169304 3300027907 Bacteria 1655
170 Ga0268265_10068027 3300028380 Bacteria 2760
171 Ga0268265_10117250 3300028380 Bacteria 2186
172 Ga0265319_1006554 3300028563 Bacteria 5376
173 Ga0265318_10000753 3300028577 Bacteria 21576
174 Ga0265336_10014922 3300028666 Bacteria 2564
175 Ga0265338_10012898 3300028800 Bacteria 9493
176 Ga0265324_10014124 3300029957 Bacteria 2964
177 Ga0265330_10006146 3300031235 Bacteria 5945
178 Ga0265328_10003485 3300031239 Bacteria 6944
179 Ga0265325_10001477 3300031241 Bacteria 16563
180 Ga0265331_10019059 3300031250 Bacteria 3546
181 Ga0265327_10020521 3300031251 Bacteria 4021
182 Ga0265327_10154793 3300031251 Bacteria 1063
183 Ga0265316_10068676 3300031344 Bacteria 2736
184 Ga0307408_100007136 3300031548 Bacteria 7395
185 Ga0265313_10010564 3300031595 Bacteria 5822
186 Ga0265314_10005854 3300031711 Bacteria 11006
187 Ga0265342_10107257 3300031712 Bacteria 1584
188 Ga0307405_10059889 3300031731 Bacteria 2401
189 Ga0307406_10159400 3300031901 Bacteria 1620
190 Ga0307412_10044211 3300031911 Bacteria 2905
191 Ga0307412_10367360 3300031911 Bacteria 1161
192 Ga0307409_100196609 3300031995 Bacteria 1800
193 Ga0307409_100218468 3300031995 Bacteria 1719
194 Ga0307416_100018008 3300032002 Bacteria 4962
195 Ga0307416_100082862 3300032002 Bacteria 2719
196 Ga0307416_100371350 3300032002 Bacteria 1456
197 Ga0307414_10000037 3300032004 Bacteria 164474
198 Ga0307411_10021489 3300032005 Bacteria 3778
199 Ga0307411_10324133 3300032005 Unclassified 1245
200 Ga0316582_0017347 3300036647 Bacteria 4165
201 Ga0316584_0020366 3300036712 Bacteria 4809
202 Ga0316581_0028776 3300037588 Bacteria 1666
203 Ga0436364_1163545 3300037853 Unclassified 959
204 Ga0451795_1677715 3300041456 Bacteria 1714
205 Ga0439431_0013886 3300041997 Bacteria 1862
206 Ga0439433_0038256 3300041999 Unclassified 1112
207 Ga0439445_0020036 3300042004 Bacteria 1671
208 Ga0439446_0030244 3300042156 Bacteria 1565
209 Ga0439435_0025662 3300042436 Bacteria 1564
210 Ga0451577_0000490 3300042876 Bacteria 67079
211 Ga0451577_0106115 3300042876 Bacteria 2511
212 Ga0451577_0416536 3300042876 Bacteria 1220
213 Ga0453684_0000987 3300044712 Bacteria 92919
214 Ga0466971_0015135 3300044719 Bacteria 3394
215 Ga0466957_0003689 3300044842 Bacteria 8455
216 Ga0451576_0112699 3300045051 Unclassified 2831
217 Ga0466967_0032324 3300045976 Bacteria 4417
218 Ga0466967_0036676 3300045976 Bacteria 4188
219 Ga0495603_0039784 3300046455 Bacteria 2816
220 Ga0495656_0209385 3300046615 Bacteria 971
221 Ga0496104_0012906 3300048907 Bacteria 7524
222 Ga0496105_0040325 3300048908 Bacteria 3850
223 Ga0496106_0306581 3300048909 Unclassified 1274
224 Ga0496108_0021396 3300048911 Bacteria 5316
225 Ga0496109_0056938 3300048912 Bacteria 3567
226 Ga0496109_0256374 3300048912 Unclassified 1647
227 Ga0496110_0086090 3300048913 Bacteria 2805
228 Ga0496110_0204289 3300048913 Bacteria 1795
229 Ga0496112_0000263 3300048915 Bacteria 33684
230 Ga0496112_0041216 3300048915 Bacteria 4517
231 Ga0496113_0057554 3300048916 Unclassified 2922
232 Ga0496114_0345536 3300048917 Bacteria 1316
233 Ga0501292_007157 3300049515 Bacteria 1607
234 Ga0501299_003036 3300049522 Bacteria 2393
235 Ga0501299_009036 3300049522 Bacteria 1634
236 Ga0501073_0215001 3300049589 Bacteria 1328
237 Ga0501075_0247816 3300049591 Bacteria 1358
238 Ga0501077_0161916 3300049593 Bacteria 1421
239 Ga0501208_007901 3300049655 Bacteria 1415
240 Ga0501245_010692 3300049708 Bacteria 1328
241 nmdc:mga0yw44_24625_c1 3300050492 Bacteria 3409
242 nmdc:mga07m45_51121_c1 3300050496 Bacteria 2330
243 nmdc:mga05p37_126778_c1 3300050507 Bacteria 3134
244 nmdc:mga05p37_23864_c1 3300050507 Bacteria 7427
245 nmdc:mga05p37_4803_c1 3300050507 Bacteria 15802
246 nmdc:mga05p37_533_c2 3300050507 Bacteria 23842
247 nmdc:mga09592_166920_c1 3300050508 Bacteria 1903
248 nmdc:mga09592_181008_c1 3300050508 Bacteria 1823
249 nmdc:mga09592_40564_c1 3300050508 Bacteria 3911
250 nmdc:mga09592_5280_c2 3300050508 Bacteria 3245
251 nmdc:mga09592_9354_c1 3300050508 Bacteria 7970
252 nmdc:mga0qj67_18875_c1 3300050509 Bacteria 5261
253 nmdc:mga0qj67_77916_c1 3300050509 Bacteria 2652
254 nmdc:mga06r32_18891_c1 3300050510 Bacteria 6320
255 nmdc:mga06r32_198496_c1 3300050510 Bacteria 1994
256 nmdc:mga06r32_267813_c1 3300050510 Bacteria 1696
257 nmdc:mga06r32_97814_c1 3300050510 Unclassified 2876
258 nmdc:mga08y16_227531_c1 3300050511 Bacteria 1930
259 nmdc:mga08y16_46214_c1 3300050511 Bacteria 4558
260 nmdc:mga08y16_527547_c1 3300050511 Bacteria 1197
261 nmdc:mga08y16_558996_c1 3300050511 Bacteria 1157
262 nmdc:mga08y16_756079_c1 3300050511 Unclassified 968
263 nmdc:mga08y16_8217_c1 3300050511 Bacteria 10916
264 nmdc:mga08y16_9009_c1 3300050511 Bacteria 10482
265 nmdc:mga0n895_172698_c1 3300050512 Bacteria 2193
266 nmdc:mga0n895_495_c1 3300050512 Bacteria 26696
267 nmdc:mga0n895_631937_c1 3300050512 Bacteria 1071
268 nmdc:mga0rr50_78637_c1 3300050513 Bacteria 2538
269 nmdc:mga0a205_12988_c1 3300050515 Bacteria 7731
270 nmdc:mga0a205_63711_c1 3300050515 Bacteria 3561
271 nmdc:mga0a205_66544_c1 3300050515 Bacteria 3482
272 nmdc:mga0a205_70861_c1 3300050515 Bacteria 3366
273 2896088054 2896085136 Bacteria 6129793
274 Ga0105243_10070862
275 MRS1b_contig_2607832
276 Ga0065712_10070888
277 Ga0065712_10093538
278 Ga0065715_10089902
279 Ga0065715_10091003
280 Ga0065715_10095748
281 Ga0065707_10085636
282 Ga0070683_100064332
283 Ga0070683_100319264
284 Ga0070670_100001651
285 Ga0070670_100003280
286 Ga0070670_100014347
287 Ga0068869_100078195
288 Ga0070666_10079982
289 Ga0070680_100016737
290 Ga0070660_100024425
291 Ga0070687_100319642
292 Ga0070661_100027210
293 Ga0070668_100155397
294 Ga0070669_100001018
295 Ga0070675_100168458
296 Ga0070675_100355864
297 Ga0070675_100566470
298 Ga0070674_100096754
299 Ga0070673_100077111
300 Ga0070673_100155411
301 Ga0070659_100025473
302 Ga0070711_100495885
303 Ga0070700_100048633
304 Ga0070700_100139178
305 Ga0070663_100096307
306 Ga0070663_100102484
307 Ga0070678_100078421
308 Ga0070662_100175180
309 Ga0070681_10047457
310 Ga0070685_10234202
311 Ga0070698_100000628
312 Ga0070679_100016442
313 Ga0070684_100001901
314 Ga0070684_100075868
315 Ga0070684_100110906
316 Ga0068853_100023201
317 Ga0070672_100275010
318 Ga0070672_100277841
319 Ga0070672_100297307
320 Ga0070693_100037176
321 Ga0068855_100039340
322 Ga0070664_100010150
323 Ga0070664_100030192
324 Ga0070664_100561569
325 Ga0068857_100014547
326 Ga0068857_100102996
327 Ga0068857_100356820
328 Ga0068854_100105516
329 Ga0068852_100539060
330 Ga0068859_100430226
331 Ga0068864_100456293
332 Ga0068863_100055121
333 Ga0068863_100368766
334 Ga0068862_100034599
335 Ga0068862_100159444
336 Ga0081455_10318828
337 Ga0075365_10025071
338 Ga0075368_10014273
339 Ga0075364_10006054
340 Ga0075364_10025493
341 Ga0075370_10088088
342 Ga0075428_100000769
343 Ga0075428_100049638
344 Ga0075428_100261529
345 Ga0075428_100766479
346 Ga0075430_100095171
347 Ga0075431_100002371
348 Ga0075431_100155021
349 Ga0075431_100224268
350 Ga0075433_10018363
351 Ga0075433_10025551
352 Ga0075433_10058658
353 Ga0075433_10125779
354 Ga0075434_100003831
355 Ga0075434_100054044
356 Ga0075434_100142826
357 Ga0075429_100006769
358 Ga0075429_100018302
359 Ga0075429_100139878
360 Ga0075429_100296878
361 Ga0097620_100430250
362 Ga0075435_100371556
363 Ga0105240_10075671
364 Ga0111539_10001612
365 Ga0111539_10053954
366 Ga0111539_10057949
367 Ga0111539_10058067
368 Ga0111539_10271918
369 Ga0111539_10681391
370 Ga0111539_10701184
371 Ga0105245_10103867
372 Ga0114129_10000241
373 Ga0114129_10059611
374 Ga0114129_10215239
375 Ga0105248_10034409
376 Ga0105237_10082540
377 Ga0105238_10016548
378 Ga0105238_10915637
379 Ga0105249_10086097
380 Ga0105249_10193616
381 Ga0157371_10060619
382 Ga0157370_10115505
383 Ga0157374_10021261
384 Ga0163162_10236176
385 Ga0163163_10111323
386 Ga0157380_10255012
387 Ga0157377_10061031
388 Ga0213876_10083730
389 Ga0207697_10000685
390 Ga0207697_10031825
391 Ga0207697_10067421
392 Ga0207688_10211989
393 Ga0207680_10240724
394 Ga0207647_10003063
395 Ga0207705_10009541
396 Ga0207707_10029129
397 Ga0207671_10101984
398 Ga0207663_10391454
399 Ga0207660_10152016
400 Ga0207657_10001188
401 Ga0207649_10035342
402 Ga0207649_10194553
403 Ga0207652_10021169
404 Ga0207652_10545160
405 Ga0207681_10008748
406 Ga0207694_10064746
407 Ga0207650_10034333
408 Ga0207650_10053465
409 Ga0207650_10197781
410 Ga0207659_10191664
411 Ga0207659_10241866
412 Ga0207659_10478797
413 Ga0207644_10048350
414 Ga0207644_10209988
415 Ga0207690_10016030
416 Ga0207706_10256697
417 Ga0207709_10124198
418 Ga0207669_10029423
419 Ga0207669_10070898
420 Ga0207691_10079777
421 Ga0207691_10159886
422 Ga0207711_10134400
423 Ga0207661_10008309
424 Ga0207661_10044895
425 Ga0207661_10229470
426 Ga0207661_10254600
427 Ga0207679_10010653
428 Ga0207679_10013971
429 Ga0207667_10039741
430 Ga0207651_10109754
431 Ga0207640_10134176
432 Ga0207703_10476384
433 Ga0207678_10000939
434 Ga0207678_10116429
435 Ga0207648_10312105
436 Ga0207674_10001500
437 Ga0207674_10322564
438 Ga0207674_10351004
439 Ga0207683_10085809
440 Ga0207428_10007151
441 Ga0207428_10007767
442 Ga0207428_10169304
443 Ga0268265_10068027
444 Ga0268265_10117250
445 Ga0265319_1006554
446 Ga0265318_10000753
447 Ga0265336_10014922
448 Ga0265338_10012898
449 Ga0265324_10014124
450 Ga0265330_10006146
451 Ga0265328_10003485
452 Ga0265325_10001477
453 Ga0265331_10019059
454 Ga0265327_10020521
455 Ga0265327_10154793
456 Ga0265316_10068676
457 Ga0307408_100007136
458 Ga0265313_10010564
459 Ga0265314_10005854
460 Ga0265342_10107257
461 Ga0307405_10059889
462 Ga0307406_10159400
463 Ga0307412_10044211
464 Ga0307412_10367360
465 Ga0307409_100196609
466 Ga0307409_100218468
467 Ga0307416_100018008
468 Ga0307416_100082862
469 Ga0307416_100371350
470 Ga0307414_10000037
471 Ga0307411_10021489
472 Ga0307411_10324133
473 Ga0316582_0017347
474 Ga0316584_0020366
475 Ga0316581_0028776
476 Ga0436364_1163545
477 Ga0451795_1677715
478 Ga0439431_0013886
479 Ga0439433_0038256
480 Ga0439445_0020036
481 Ga0439446_0030244
482 Ga0439435_0025662
483 Ga0451577_0000490
484 Ga0451577_0106115
485 Ga0451577_0416536
486 Ga0453684_0000987
487 Ga0466971_0015135
488 Ga0466957_0003689
489 Ga0451576_0112699
490 Ga0466967_0032324
491 Ga0466967_0036676
492 Ga0495603_0039784
493 Ga0495656_0209385
494 Ga0496104_0012906
495 Ga0496105_0040325
496 Ga0496106_0306581
497 Ga0496108_0021396
498 Ga0496109_0056938
499 Ga0496109_0256374
500 Ga0496110_0086090
501 Ga0496110_0204289
502 Ga0496112_0000263
503 Ga0496112_0041216
504 Ga0496113_0057554
505 Ga0496114_0345536
506 Ga0501292_007157
507 Ga0501299_003036
508 Ga0501299_009036
509 Ga0501073_0215001
510 Ga0501075_0247816
511 Ga0501077_0161916
512 Ga0501208_007901
513 Ga0501245_010692
514 nmdc:mga0yw44_24625_c1
515 nmdc:mga07m45_51121_c1
516 nmdc:mga05p37_126778_c1
517 nmdc:mga05p37_23864_c1
518 nmdc:mga05p37_4803_c1
519 nmdc:mga05p37_533_c2
520 nmdc:mga09592_166920_c1
521 nmdc:mga09592_181008_c1
522 nmdc:mga09592_40564_c1
523 nmdc:mga09592_5280_c2
524 nmdc:mga09592_9354_c1
525 nmdc:mga0qj67_18875_c1
526 nmdc:mga0qj67_77916_c1
527 nmdc:mga06r32_18891_c1
528 nmdc:mga06r32_198496_c1
529 nmdc:mga06r32_267813_c1
530 nmdc:mga06r32_97814_c1
531 nmdc:mga08y16_227531_c1
532 nmdc:mga08y16_46214_c1
533 nmdc:mga08y16_527547_c1
534 nmdc:mga08y16_558996_c1
535 nmdc:mga08y16_756079_c1
536 nmdc:mga08y16_8217_c1
537 nmdc:mga08y16_9009_c1
538 nmdc:mga0n895_172698_c1
539 nmdc:mga0n895_495_c1
540 nmdc:mga0n895_631937_c1
541 nmdc:mga0rr50_78637_c1
542 nmdc:mga0a205_12988_c1
543 nmdc:mga0a205_63711_c1
544 nmdc:mga0a205_66544_c1
545 nmdc:mga0a205_70861_c1
546 2896088054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

24

281

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vyl-assembly2.cif.gz_H structure of l-ribulose 3-epimerase 0.9285 1 282
7cj4-assembly1.cif.gz_A crystal structure of homo dimeric d-allulose 3-epimerase from methylomonas sp. 0.9249 1 283
4xsl-assembly2.cif.gz_C crystal strcutre of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with glycerol 0.9233 1 282
2qum-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii with d-tagatose 0.9226 1 283
7cj4-assembly1.cif.gz_A crystal structure of homo dimeric d-allulose 3-epimerase from methylomonas sp. 0.9217 1 283
ID Description Score Start End Superfamily
3vylH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9285 1 282 3.20.20.150
4xslC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9233 1 282 3.20.20.150
3vylH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9191 1 282 3.20.20.150
4xslC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9171 1 282 3.20.20.150
5zfsB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9139 3 282 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A3M1HKL6-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9991 3 188 GO:0016853
AF-A0A3M1HKL6-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9885 3 188 GO:0016853
AF-A0A523UIG7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9826 3 223 GO:0016853
AF-A0A0L8L9J9-F1-model_v4 Sugar phosphate isomerase 0.9801 1 132 GO:0016853
AF-A0A371QQF7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9794 3 283 GO:0016853

Map