F378600

General Info

Members Datasets Scaffolds Average Seq Length
272 162 544 150

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0539112|Ga0495645_0539112_67_615
Length 182
Sequence VHSERELTVEIVSGQDVVVLFLYVIAVALGGSMAQTGKESAAAVHETRSSGKEGQSFVLGFWGVRYQVKDVSRSVDFYTRQLGFKLDQKTLPAFAQVSIGNLKLILSGPGPSGSRPLPDGHHQEPGGWNRVVLQVADLPARIEALKKAGLHFRNQMEVGPGGKQIQLEDPDGNPIELLEPAR

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
128 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
129 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
130 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
131 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
135 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
136 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
137 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
138 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
139 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
140 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
141 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
142 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
143 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
144 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
145 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
149 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
150 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
151 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
152 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 34.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0539112 3300046543 Bacteria 725
2 Ga0006778J45830_1057353 3300003162 Unclassified 520
3 Ga0007429J51699_1033617 3300003579 Unclassified 588
4 Ga0032354_1061373 3300003693 Bacteria 962
5 Ga0065704_10077562 3300005289 Bacteria 4694
6 Ga0065704_10253786 3300005289 Bacteria 982
7 Ga0065707_10090214 3300005295 Unclassified 4186
8 Ga0065707_10142283 3300005295 Bacteria 1757
9 Ga0068869_100150662 3300005334 Bacteria 1804
10 Ga0068869_101357265 3300005334 Unclassified 628
11 Ga0068869_101471590 3300005334 Bacteria 604
12 Ga0068868_101663167 3300005338 Unclassified 601
13 Ga0070689_100537786 3300005340 Unclassified 1005
14 Ga0070689_100782782 3300005340 Unclassified 838
15 Ga0070668_100203019 3300005347 Bacteria 1628
16 Ga0070669_100043263 3300005353 Bacteria 3280
17 Ga0070669_100246184 3300005353 Bacteria 1422
18 Ga0070673_100109177 3300005364 Unclassified 2292
19 Ga0070688_100322847 3300005365 Unclassified 1122
20 Ga0070703_10000105 3300005406 Bacteria 43523
21 Ga0070705_100868218 3300005440 Unclassified 723
22 Ga0070700_100002824 3300005441 Bacteria 8911
23 Ga0070700_100358513 3300005441 Bacteria 1083
24 Ga0070700_100543407 3300005441 Unclassified 901
25 Ga0070708_100078311 3300005445 Bacteria 2988
26 Ga0070678_100508470 3300005456 Unclassified 1064
27 Ga0070662_100152943 3300005457 Bacteria 1798
28 Ga0068867_100398574 3300005459 Bacteria 1160
29 Ga0070685_11094110 3300005466 Unclassified 602
30 Ga0070707_100114359 3300005468 Bacteria 2618
31 Ga0070707_100370360 3300005468 Bacteria 1392
32 Ga0070699_100000123 3300005518 Bacteria 71157
33 Ga0070699_100087474 3300005518 Bacteria 2720
34 Ga0070699_100430808 3300005518 Bacteria 1195
35 Ga0070699_101859499 3300005518 Bacteria 551
36 Ga0070684_100439405 3300005535 Bacteria 1205
37 Ga0070684_101596373 3300005535 Unclassified 615
38 Ga0068853_100404078 3300005539 Bacteria 1279
39 Ga0068853_100694206 3300005539 Bacteria 970
40 Ga0070686_100011843 3300005544 Bacteria 4956
41 Ga0070686_100170002 3300005544 Bacteria 1541
42 Ga0070686_100176618 3300005544 Bacteria 1514
43 Ga0070686_100665482 3300005544 Unclassified 827
44 Ga0070696_100309034 3300005546 Bacteria 1213
45 Ga0070696_100968559 3300005546 Unclassified 709
46 Ga0070693_100156063 3300005547 Bacteria 1449
47 Ga0068855_100049789 3300005563 Bacteria 4940
48 Ga0068855_100381935 3300005563 Bacteria 1546
49 Ga0068857_100048319 3300005577 Bacteria 3778
50 Ga0068857_100630275 3300005577 Bacteria 1015
51 Ga0068857_100729163 3300005577 Unclassified 943
52 Ga0068856_102001998 3300005614 Unclassified 590
53 Ga0070702_100506917 3300005615 Bacteria 887
54 Ga0070702_100935295 3300005615 Unclassified 681
55 Ga0068859_100011670 3300005617 Bacteria 8830
56 Ga0068859_100125107 3300005617 Bacteria 2640
57 Ga0068859_100248768 3300005617 Bacteria 1868
58 Ga0068864_100937941 3300005618 Bacteria 856
59 Ga0068864_101281552 3300005618 Unclassified 733
60 Ga0068861_100159091 3300005719 Bacteria 1861
61 Ga0068861_101259307 3300005719 Unclassified 718
62 Ga0068858_101730523 3300005842 Unclassified 617
63 Ga0068860_100028286 3300005843 Bacteria 5395
64 Ga0068860_100769207 3300005843 Unclassified 975
65 Ga0068862_100159309 3300005844 Bacteria 2014
66 Ga0068862_101395404 3300005844 Unclassified 704
67 Ga0068871_100038013 3300006358 Bacteria 3841
68 Ga0075428_100278424 3300006844 Bacteria 1800
69 Ga0075428_100541132 3300006844 Bacteria 1245
70 Ga0075428_100668641 3300006844 Bacteria 1107
71 Ga0075428_100783609 3300006844 Bacteria 1014
72 Ga0075430_100293399 3300006846 Bacteria 1345
73 Ga0075431_100100357 3300006847 Bacteria 2986
74 Ga0075431_100367544 3300006847 Bacteria 1444
75 Ga0075431_100539703 3300006847 Unclassified 1154
76 Ga0075431_100630530 3300006847 Bacteria 1054
77 Ga0075431_100782731 3300006847 Bacteria 928
78 Ga0075434_100050142 3300006871 Bacteria 4146
79 Ga0075434_100571874 3300006871 Bacteria 1149
80 Ga0075429_100000044 3300006880 Bacteria 56916
81 Ga0075429_100038829 3300006880 Bacteria 4145
82 Ga0075429_100087885 3300006880 Archaea 2709
83 Ga0075429_100803833 3300006880 Unclassified 824
84 Ga0075436_100061453 3300006914 Bacteria 2595
85 Ga0097620_100011669 3300006931 Bacteria 8830
86 Ga0097620_100125098 3300006931 Bacteria 2640
87 Ga0097620_100248775 3300006931 Bacteria 1868
88 Ga0075435_101156178 3300007076 Unclassified 677
89 Ga0099794_10054822 3300007265 Bacteria 1925
90 Ga0111539_10034876 3300009094 Bacteria 6096
91 Ga0111539_10153813 3300009094 Bacteria 2692
92 Ga0111539_10687581 3300009094 Unclassified 1191
93 Ga0111539_11445631 3300009094 Unclassified 797
94 Ga0105245_10004531 3300009098 Bacteria 12270
95 Ga0105245_10189750 3300009098 Bacteria 1968
96 Ga0105245_11997499 3300009098 Bacteria 633
97 Ga0105245_12536874 3300009098 Unclassified 566
98 Ga0114129_10120947 3300009147 Bacteria 3604
99 Ga0114129_10261513 3300009147 Unclassified 2319
100 Ga0114129_10270693 3300009147 Bacteria 2272
101 Ga0114129_10301618 3300009147 Bacteria 2135
102 Ga0114129_10338559 3300009147 Bacteria 1996
103 Ga0114129_10626613 3300009147 Bacteria 1391
104 Ga0114129_11410594 3300009147 Bacteria 859
105 Ga0114129_11802406 3300009147 Unclassified 744
106 Ga0105243_10088556 3300009148 Bacteria 2543
107 Ga0105241_10136641 3300009174 Bacteria 1991
108 Ga0105241_10883371 3300009174 Bacteria 829
109 Ga0105241_11053782 3300009174 Unclassified 763
110 Ga0105241_11161080 3300009174 Unclassified 730
111 Ga0105242_10178489 3300009176 Unclassified 1872
112 Ga0105248_10063595 3300009177 Bacteria 4142
113 Ga0105248_10835293 3300009177 Unclassified 1040
114 Ga0105238_10160433 3300009551 Bacteria 2224
115 Ga0105249_10021320 3300009553 Bacteria 5800
116 Ga0105249_10559522 3300009553 Unclassified 1195
117 Ga0105239_10462475 3300010375 Bacteria 1440
118 Ga0105246_10016683 3300011119 Bacteria 4654
119 Ga0105246_10168441 3300011119 Bacteria 1675
120 Ga0157374_11341264 3300013296 Unclassified 738
121 Ga0157374_11639969 3300013296 Bacteria 667
122 Ga0157378_10000515 3300013297 Bacteria 36830
123 Ga0157378_10002349 3300013297 Bacteria 16815
124 Ga0157378_10046197 3300013297 Bacteria 3871
125 Ga0157378_10256767 3300013297 Bacteria 1675
126 Ga0157378_10636099 3300013297 Bacteria 1081
127 Ga0163162_10051175 3300013306 Bacteria 4143
128 Ga0163162_10908899 3300013306 Unclassified 993
129 Ga0163162_11071799 3300013306 Bacteria 912
130 Ga0157375_10900111 3300013308 Unclassified 1029
131 Ga0157375_11241838 3300013308 Unclassified 875
132 Ga0163163_10000049 3300014325 Bacteria 130036
133 Ga0163163_10224345 3300014325 Bacteria 1928
134 Ga0157380_10354422 3300014326 Bacteria 1374
135 Ga0163161_10346340 3300017792 Bacteria 1180
136 Ga0207653_10000031 3300025885 Bacteria 111372
137 Ga0207710_10059148 3300025900 Bacteria 1734
138 Ga0207643_10003396 3300025908 Bacteria 8584
139 Ga0207684_10741439 3300025910 Unclassified 833
140 Ga0207654_10441993 3300025911 Bacteria 911
141 Ga0207695_10841385 3300025913 Bacteria 797
142 Ga0207646_10186022 3300025922 Bacteria 1876
143 Ga0207646_11114408 3300025922 Unclassified 694
144 Ga0207681_10090753 3300025923 Bacteria 2181
145 Ga0207681_10150017 3300025923 Bacteria 1746
146 Ga0207694_10361163 3300025924 Unclassified 1204
147 Ga0207650_10042718 3300025925 Unclassified 3326
148 Ga0207687_10021777 3300025927 Plasmid 4260
149 Ga0207687_11407484 3300025927 Unclassified 599
150 Ga0207706_10536917 3300025933 Bacteria 1008
151 Ga0207686_10001716 3300025934 Bacteria 12210
152 Ga0207686_10579238 3300025934 Unclassified 881
153 Ga0207670_10529854 3300025936 Unclassified 960
154 Ga0207704_10147981 3300025938 Bacteria 1653
155 Ga0207704_11001366 3300025938 Unclassified 707
156 Ga0207711_10053456 3300025941 Unclassified 3464
157 Ga0207711_10191540 3300025941 Bacteria 1864
158 Ga0207689_10028289 3300025942 Bacteria 4690
159 Ga0207689_10133951 3300025942 Unclassified 2040
160 Ga0207689_10179743 3300025942 Bacteria 1745
161 Ga0207689_10516565 3300025942 Bacteria 1001
162 Ga0207689_11177921 3300025942 Unclassified 645
163 Ga0207661_11179106 3300025944 Unclassified 705
164 Ga0207661_11516116 3300025944 Unclassified 614
165 Ga0207667_10163412 3300025949 Bacteria 2289
166 Ga0207667_10316877 3300025949 Bacteria 1593
167 Ga0207640_10033728 3300025981 Bacteria 3188
168 Ga0207703_10525256 3300026035 Bacteria 1114
169 Ga0207639_10443215 3300026041 Unclassified 1178
170 Ga0207708_10028068 3300026075 Bacteria 4261
171 Ga0207708_11011249 3300026075 Unclassified 722
172 Ga0207708_11487568 3300026075 Unclassified 595
173 Ga0207641_11231886 3300026088 Unclassified 748
174 Ga0207648_10952048 3300026089 Unclassified 803
175 Ga0207676_12600076 3300026095 Unclassified 502
176 Ga0207674_10032778 3300026116 Bacteria 5446
177 Ga0207674_10569042 3300026116 Bacteria 1095
178 Ga0207675_100131942 3300026118 Unclassified 2369
179 Ga0207675_100695344 3300026118 Bacteria 1025
180 Ga0207675_101479355 3300026118 Unclassified 700
181 Ga0207698_10313040 3300026142 Unclassified 1467
182 Ga0209588_1142252 3300027671 Unclassified 762
183 Ga0207428_10437762 3300027907 Unclassified 954
184 Ga0207428_10780030 3300027907 Unclassified 680
185 Ga0207428_10922294 3300027907 Unclassified 616
186 Ga0268265_11004524 3300028380 Unclassified 824
187 Ga0268264_10077452 3300028381 Unclassified 2832
188 Ga0307408_100880535 3300031548 Bacteria 818
189 Ga0307406_11730871 3300031901 Bacteria 555
190 Ga0307412_11965573 3300031911 Bacteria 541
191 Ga0307414_10110256 3300032004 Bacteria 2093
192 Ga0307411_10167333 3300032005 Bacteria 1654
193 Ga0373934_0436467 3300035086 Unclassified 548
194 Ga0373953_0474917 3300035117 Unclassified 553
195 Ga0373957_0315287 3300035120 Bacteria 665
196 Ga0373931_0268372 3300035691 Unclassified 1044
197 Ga0373933_0189692 3300035724 Bacteria 1313
198 Ga0373947_0080104 3300035725 Bacteria 2020
199 Ga0395900_0659857 3300037418 Unclassified 982
200 Ga0395898_0349847 3300037466 Unclassified 1409
201 Ga0395901_0194154 3300038443 Bacteria 2129
202 Ga0395901_0336578 3300038443 Unclassified 1560
203 Ga0395901_0615294 3300038443 Bacteria 1094
204 Ga0436365_1541144 3300039437 Bacteria 1552
205 Ga0453683_0740657 3300044673 Unclassified 645
206 Ga0495580_0501842 3300046472 Bacteria 810
207 Ga0495580_0526426 3300046472 Unclassified 787
208 Ga0495582_0286103 3300046473 Unclassified 947
209 Ga0495594_0348608 3300046499 Unclassified 843
210 Ga0495594_0361978 3300046499 Unclassified 826
211 Ga0495652_1100898 3300046529 Unclassified 516
212 Ga0495665_0099810 3300046531 Bacteria 1524
213 Ga0495613_0121595 3300046689 Bacteria 1875
214 Ga0495674_0292093 3300047319 Bacteria 1333
215 Ga0495684_0085352 3300047471 Bacteria 2394
216 Ga0495602_0335682 3300048088 Bacteria 1095
217 Ga0496102_0093231 3300048905 Plasmid 2790
218 Ga0496112_0659576 3300048915 Bacteria 976
219 Ga0501291_005300 3300049514 Bacteria 1678
220 Ga0501296_077597 3300049519 Bacteria 522
221 Ga0501298_003803 3300049521 Bacteria 2354
222 Ga0501299_031047 3300049522 Bacteria 1031
223 Ga0501303_003569 3300049526 Unclassified 1254
224 Ga0501040_0247247 3300049576 Unclassified 1272
225 Ga0501075_1048820 3300049591 Unclassified 619
226 Ga0501199_018412 3300049650 Bacteria 797
227 Ga0501209_001929 3300049656 Bacteria 3067
228 Ga0501223_003335 3300049663 Bacteria 3510
229 Ga0501227_072848 3300049665 Bacteria 893
230 Ga0501230_002021 3300049667 Bacteria 2538
231 Ga0501233_075481 3300049668 Bacteria 860
232 Ga0501235_002612 3300049669 Bacteria 3876
233 Ga0501243_002076 3300049675 Bacteria 2914
234 Ga0501246_015110 3300049676 Bacteria 749
235 Ga0501251_011302 3300049681 Bacteria 1062
236 Ga0501257_027574 3300049686 Bacteria 1359
237 Ga0501260_016660 3300049689 Bacteria 774
238 Ga0501221_151145 3300049704 Bacteria 615
239 Ga0501225_0059264 3300049705 Bacteria 1075
240 Ga0501225_0089481 3300049705 Bacteria 891
241 Ga0501234_026605 3300049707 Bacteria 929
242 Ga0501234_040899 3300049707 Unclassified 759
243 Ga0501271_021642 3300049768 Bacteria 749
244 Ga0501275_070144 3300049772 Unclassified 550
245 Ga0501204_067052 3300049850 Bacteria 583
246 Ga0501226_001517 3300049853 Bacteria 2964
247 nmdc:mga05p37_190215_c1 3300050507 Bacteria 2493
248 nmdc:mga05p37_2039973_c1 3300050507 Unclassified 541
249 nmdc:mga09592_121945_c1 3300050508 Archaea 2239
250 nmdc:mga09592_5051_c1 3300050508 Bacteria 10708
251 nmdc:mga09592_922405_c1 3300050508 Unclassified 733
252 nmdc:mga0qj67_1083977_c1 3300050509 Unclassified 626
253 nmdc:mga0qj67_185791_c1 3300050509 Bacteria 1688
254 nmdc:mga0qj67_315964_c1 3300050509 Bacteria 1265
255 nmdc:mga0qj67_352380_c1 3300050509 Bacteria 1190
256 nmdc:mga0qj67_716409_c1 3300050509 Bacteria 795
257 nmdc:mga06r32_206406_c1 3300050510 Bacteria 1953
258 nmdc:mga06r32_603752_c1 3300050510 Bacteria 1068
259 nmdc:mga06r32_60729_c1 3300050510 Bacteria 3638
260 nmdc:mga06r32_61797_c1 3300050510 Bacteria 3607
261 nmdc:mga06r32_91310_c1 3300050510 Bacteria 2976
262 nmdc:mga08y16_1368378_c1 3300050511 Unclassified 672
263 nmdc:mga08y16_446536_c1 3300050511 Unclassified 1319
264 nmdc:mga08y16_572994_c1 3300050511 Unclassified 1140
265 nmdc:mga08y16_90119_c1 3300050511 Bacteria 3196
266 nmdc:mga08y16_953023_c1 3300050511 Unclassified 841
267 nmdc:mga0n895_241080_c1 3300050512 Bacteria 1835
268 nmdc:mga0rr50_252130_c1 3300050513 Bacteria 1466
269 nmdc:mga08x19_355697_c1 3300050514 Bacteria 1023
270 nmdc:mga0a205_1521411_c1 3300050515 Unclassified 517
271 nmdc:mga0a205_361675_c1 3300050515 Bacteria 1318
272 Ga0501084_0356421 3300054114 Unclassified 1236
273 Ga0495645_0539112
274 Ga0006778J45830_1057353
275 Ga0007429J51699_1033617
276 Ga0032354_1061373
277 Ga0065704_10077562
278 Ga0065704_10253786
279 Ga0065707_10090214
280 Ga0065707_10142283
281 Ga0068869_100150662
282 Ga0068869_101357265
283 Ga0068869_101471590
284 Ga0068868_101663167
285 Ga0070689_100537786
286 Ga0070689_100782782
287 Ga0070668_100203019
288 Ga0070669_100043263
289 Ga0070669_100246184
290 Ga0070673_100109177
291 Ga0070688_100322847
292 Ga0070703_10000105
293 Ga0070705_100868218
294 Ga0070700_100002824
295 Ga0070700_100358513
296 Ga0070700_100543407
297 Ga0070708_100078311
298 Ga0070678_100508470
299 Ga0070662_100152943
300 Ga0068867_100398574
301 Ga0070685_11094110
302 Ga0070707_100114359
303 Ga0070707_100370360
304 Ga0070699_100000123
305 Ga0070699_100087474
306 Ga0070699_100430808
307 Ga0070699_101859499
308 Ga0070684_100439405
309 Ga0070684_101596373
310 Ga0068853_100404078
311 Ga0068853_100694206
312 Ga0070686_100011843
313 Ga0070686_100170002
314 Ga0070686_100176618
315 Ga0070686_100665482
316 Ga0070696_100309034
317 Ga0070696_100968559
318 Ga0070693_100156063
319 Ga0068855_100049789
320 Ga0068855_100381935
321 Ga0068857_100048319
322 Ga0068857_100630275
323 Ga0068857_100729163
324 Ga0068856_102001998
325 Ga0070702_100506917
326 Ga0070702_100935295
327 Ga0068859_100011670
328 Ga0068859_100125107
329 Ga0068859_100248768
330 Ga0068864_100937941
331 Ga0068864_101281552
332 Ga0068861_100159091
333 Ga0068861_101259307
334 Ga0068858_101730523
335 Ga0068860_100028286
336 Ga0068860_100769207
337 Ga0068862_100159309
338 Ga0068862_101395404
339 Ga0068871_100038013
340 Ga0075428_100278424
341 Ga0075428_100541132
342 Ga0075428_100668641
343 Ga0075428_100783609
344 Ga0075430_100293399
345 Ga0075431_100100357
346 Ga0075431_100367544
347 Ga0075431_100539703
348 Ga0075431_100630530
349 Ga0075431_100782731
350 Ga0075434_100050142
351 Ga0075434_100571874
352 Ga0075429_100000044
353 Ga0075429_100038829
354 Ga0075429_100087885
355 Ga0075429_100803833
356 Ga0075436_100061453
357 Ga0097620_100011669
358 Ga0097620_100125098
359 Ga0097620_100248775
360 Ga0075435_101156178
361 Ga0099794_10054822
362 Ga0111539_10034876
363 Ga0111539_10153813
364 Ga0111539_10687581
365 Ga0111539_11445631
366 Ga0105245_10004531
367 Ga0105245_10189750
368 Ga0105245_11997499
369 Ga0105245_12536874
370 Ga0114129_10120947
371 Ga0114129_10261513
372 Ga0114129_10270693
373 Ga0114129_10301618
374 Ga0114129_10338559
375 Ga0114129_10626613
376 Ga0114129_11410594
377 Ga0114129_11802406
378 Ga0105243_10088556
379 Ga0105241_10136641
380 Ga0105241_10883371
381 Ga0105241_11053782
382 Ga0105241_11161080
383 Ga0105242_10178489
384 Ga0105248_10063595
385 Ga0105248_10835293
386 Ga0105238_10160433
387 Ga0105249_10021320
388 Ga0105249_10559522
389 Ga0105239_10462475
390 Ga0105246_10016683
391 Ga0105246_10168441
392 Ga0157374_11341264
393 Ga0157374_11639969
394 Ga0157378_10000515
395 Ga0157378_10002349
396 Ga0157378_10046197
397 Ga0157378_10256767
398 Ga0157378_10636099
399 Ga0163162_10051175
400 Ga0163162_10908899
401 Ga0163162_11071799
402 Ga0157375_10900111
403 Ga0157375_11241838
404 Ga0163163_10000049
405 Ga0163163_10224345
406 Ga0157380_10354422
407 Ga0163161_10346340
408 Ga0207653_10000031
409 Ga0207710_10059148
410 Ga0207643_10003396
411 Ga0207684_10741439
412 Ga0207654_10441993
413 Ga0207695_10841385
414 Ga0207646_10186022
415 Ga0207646_11114408
416 Ga0207681_10090753
417 Ga0207681_10150017
418 Ga0207694_10361163
419 Ga0207650_10042718
420 Ga0207687_10021777
421 Ga0207687_11407484
422 Ga0207706_10536917
423 Ga0207686_10001716
424 Ga0207686_10579238
425 Ga0207670_10529854
426 Ga0207704_10147981
427 Ga0207704_11001366
428 Ga0207711_10053456
429 Ga0207711_10191540
430 Ga0207689_10028289
431 Ga0207689_10133951
432 Ga0207689_10179743
433 Ga0207689_10516565
434 Ga0207689_11177921
435 Ga0207661_11179106
436 Ga0207661_11516116
437 Ga0207667_10163412
438 Ga0207667_10316877
439 Ga0207640_10033728
440 Ga0207703_10525256
441 Ga0207639_10443215
442 Ga0207708_10028068
443 Ga0207708_11011249
444 Ga0207708_11487568
445 Ga0207641_11231886
446 Ga0207648_10952048
447 Ga0207676_12600076
448 Ga0207674_10032778
449 Ga0207674_10569042
450 Ga0207675_100131942
451 Ga0207675_100695344
452 Ga0207675_101479355
453 Ga0207698_10313040
454 Ga0209588_1142252
455 Ga0207428_10437762
456 Ga0207428_10780030
457 Ga0207428_10922294
458 Ga0268265_11004524
459 Ga0268264_10077452
460 Ga0307408_100880535
461 Ga0307406_11730871
462 Ga0307412_11965573
463 Ga0307414_10110256
464 Ga0307411_10167333
465 Ga0373934_0436467
466 Ga0373953_0474917
467 Ga0373957_0315287
468 Ga0373931_0268372
469 Ga0373933_0189692
470 Ga0373947_0080104
471 Ga0395900_0659857
472 Ga0395898_0349847
473 Ga0395901_0194154
474 Ga0395901_0336578
475 Ga0395901_0615294
476 Ga0436365_1541144
477 Ga0453683_0740657
478 Ga0495580_0501842
479 Ga0495580_0526426
480 Ga0495582_0286103
481 Ga0495594_0348608
482 Ga0495594_0361978
483 Ga0495652_1100898
484 Ga0495665_0099810
485 Ga0495613_0121595
486 Ga0495674_0292093
487 Ga0495684_0085352
488 Ga0495602_0335682
489 Ga0496102_0093231
490 Ga0496112_0659576
491 Ga0501291_005300
492 Ga0501296_077597
493 Ga0501298_003803
494 Ga0501299_031047
495 Ga0501303_003569
496 Ga0501040_0247247
497 Ga0501075_1048820
498 Ga0501199_018412
499 Ga0501209_001929
500 Ga0501223_003335
501 Ga0501227_072848
502 Ga0501230_002021
503 Ga0501233_075481
504 Ga0501235_002612
505 Ga0501243_002076
506 Ga0501246_015110
507 Ga0501251_011302
508 Ga0501257_027574
509 Ga0501260_016660
510 Ga0501221_151145
511 Ga0501225_0059264
512 Ga0501225_0089481
513 Ga0501234_026605
514 Ga0501234_040899
515 Ga0501271_021642
516 Ga0501275_070144
517 Ga0501204_067052
518 Ga0501226_001517
519 nmdc:mga05p37_190215_c1
520 nmdc:mga05p37_2039973_c1
521 nmdc:mga09592_121945_c1
522 nmdc:mga09592_5051_c1
523 nmdc:mga09592_922405_c1
524 nmdc:mga0qj67_1083977_c1
525 nmdc:mga0qj67_185791_c1
526 nmdc:mga0qj67_315964_c1
527 nmdc:mga0qj67_352380_c1
528 nmdc:mga0qj67_716409_c1
529 nmdc:mga06r32_206406_c1
530 nmdc:mga06r32_603752_c1
531 nmdc:mga06r32_60729_c1
532 nmdc:mga06r32_61797_c1
533 nmdc:mga06r32_91310_c1
534 nmdc:mga08y16_1368378_c1
535 nmdc:mga08y16_446536_c1
536 nmdc:mga08y16_572994_c1
537 nmdc:mga08y16_90119_c1
538 nmdc:mga08y16_953023_c1
539 nmdc:mga0n895_241080_c1
540 nmdc:mga0rr50_252130_c1
541 nmdc:mga08x19_355697_c1
542 nmdc:mga0a205_1521411_c1
543 nmdc:mga0a205_361675_c1
544 Ga0501084_0356421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

62

177

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8455 30 149
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8259 30 149
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8074 30 149
2i7r-assembly1.cif.gz_B conserved domain protein 0.804 28 149
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8035 24 149
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9129 98 146 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8669 97 149 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8476 98 146 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8309 97 150 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8156 98 150 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2G9P4Y4-F1-model_v4 Methylmalonyl-CoA epimerase 0.9638 97 150
AF-A0A1M7GLS1-F1-model_v4 VOC domain-containing protein 0.9452 97 150
AF-A0A2V7LAV6-F1-model_v4 Glyoxalase 0.9446 26 150 GO:0004493
GO:0046491
GO:0046872
AF-A0A538D3E7-F1-model_v4 VOC family protein 0.9388 31 149 GO:0004493
GO:0046491
GO:0046872
AF-A0A2V7LAV6-F1-model_v4 Glyoxalase 0.9374 26 150 GO:0004493
GO:0046491
GO:0046872

Map