F378482

General Info

Members Datasets Scaffolds Average Seq Length
272 123 544 283

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10200195|Ga0307414_102001952
Length 298
Sequence MMRAVVLTPAPDFWEPWGWAYDVEAAALEAAGFSVEPRPWTDIGDLAGVDVVLPLVAWGYHLRFAEWCALLDRMAQPHPFVPSDVEGRCAPLMLNPPALLRWNSDKAYLEQLAAAGVPTVASRTVQALDGQALAAARETFGTELVVKPLVSASADDTYRIGPDDPVPASVRGKRMLVQPFMPSIASHGEYSLMLFGGVFSHAIVKRPKPGDFRVQPHLGGSETPCPPPEGAIPLAQAALAAAPAPATYARVDMVADEAGTLRIMELELIEPALWLQHAPDAGAAFGKAVKAAIGVRSH

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
99 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
100 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
117 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
118 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
119 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
120 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.41
Rhizosphere 95.22
Stem 0
Stem Tuber 0.37
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10200195 3300032004 Bacteria 1624
2 JGI24746J21847_1000892 3300001977 Bacteria 4656
3 JGI24749J21850_1011433 3300002076 Bacteria 1246
4 Ga0065715_10089241 3300005293 Bacteria 12017
5 Ga0065715_10095621 3300005293 Bacteria 4030
6 Ga0065715_10097308 3300005293 Bacteria 3725
7 Ga0065707_10035309 3300005295 Bacteria 1105
8 Ga0070676_10013437 3300005328 Bacteria 4488
9 Ga0070676_10030942 3300005328 Bacteria 3056
10 Ga0070670_100002141 3300005331 Bacteria 16210
11 Ga0070670_100003136 3300005331 Bacteria 13672
12 Ga0070670_100013540 3300005331 Bacteria 6990
13 Ga0070670_100189587 3300005331 Bacteria 1786
14 Ga0070677_10000502 3300005333 Bacteria 13491
15 Ga0068868_100524615 3300005338 Bacteria 1040
16 Ga0070661_100001040 3300005344 Bacteria 19629
17 Ga0070668_100003514 3300005347 Bacteria 11553
18 Ga0070668_100097712 3300005347 Bacteria 2323
19 Ga0070668_100385932 3300005347 Bacteria 1193
20 Ga0070669_100000194 3300005353 Bacteria 53799
21 Ga0070669_100036411 3300005353 Bacteria 3566
22 Ga0070669_100075799 3300005353 Bacteria 2495
23 Ga0070675_100000470 3300005354 Bacteria 27586
24 Ga0070675_100000491 3300005354 Bacteria 27031
25 Ga0070671_100010515 3300005355 Bacteria 7427
26 Ga0070671_100048542 3300005355 Bacteria 3530
27 Ga0070671_100143391 3300005355 Bacteria 2016
28 Ga0070674_100026421 3300005356 Bacteria 3792
29 Ga0070674_100325187 3300005356 Bacteria 1234
30 Ga0070673_100001863 3300005364 Bacteria 12603
31 Ga0070673_100104858 3300005364 Bacteria 2335
32 Ga0070667_100007835 3300005367 Bacteria 8860
33 Ga0070667_100045153 3300005367 Bacteria 3704
34 Ga0070700_100130447 3300005441 Bacteria 1696
35 Ga0070663_100105097 3300005455 Bacteria 2113
36 Ga0070663_100229204 3300005455 Unclassified 1462
37 Ga0070678_100134254 3300005456 Bacteria 1971
38 Ga0070678_100228360 3300005456 Bacteria 1550
39 Ga0070662_100002532 3300005457 Bacteria 11266
40 Ga0070662_100018202 3300005457 Bacteria 4749
41 Ga0068867_100223992 3300005459 Bacteria 1517
42 Ga0070679_100057277 3300005530 Bacteria 3884
43 Ga0068853_100147986 3300005539 Bacteria 2112
44 Ga0070672_100002617 3300005543 Bacteria 11503
45 Ga0070672_100018027 3300005543 Bacteria 5096
46 Ga0070672_100193110 3300005543 Bacteria 1701
47 Ga0070665_100275542 3300005548 Bacteria 1684
48 Ga0070664_100006391 3300005564 Bacteria 9500
49 Ga0070664_100021478 3300005564 Bacteria 5320
50 Ga0068857_100077669 3300005577 Bacteria 2963
51 Ga0068859_100005060 3300005617 Bacteria 13383
52 Ga0068864_100010857 3300005618 Bacteria 7528
53 Ga0068864_100094388 3300005618 Bacteria 2644
54 Ga0068861_100008730 3300005719 Bacteria 6974
55 Ga0068863_100095557 3300005841 Bacteria 2821
56 Ga0068860_100355208 3300005843 Bacteria 1443
57 Ga0068862_100007412 3300005844 Bacteria 9098
58 Ga0081539_10009834 3300005985 Bacteria 7897
59 Ga0097621_100113264 3300006237 Bacteria 2295
60 Ga0068871_100058986 3300006358 Bacteria 3126
61 Ga0075431_100001190 3300006847 Bacteria 23475
62 Ga0097620_100005060 3300006931 Bacteria 13383
63 Ga0111539_10060111 3300009094 Bacteria 4505
64 Ga0111539_10065099 3300009094 Bacteria 4310
65 Ga0105248_10062626 3300009177 Bacteria 4176
66 Ga0105248_10095242 3300009177 Bacteria 3352
67 Ga0105249_10043228 3300009553 Bacteria 4099
68 Ga0157373_10080008 3300013100 Bacteria 2304
69 Ga0157373_10243842 3300013100 Bacteria 1270
70 Ga0157375_10010940 3300013308 Bacteria 8003
71 Ga0157375_10553976 3300013308 Bacteria 1311
72 Ga0163163_10094491 3300014325 Bacteria 3008
73 Ga0163163_10218930 3300014325 Bacteria 1952
74 Ga0157380_10000643 3300014326 Bacteria 21584
75 Ga0157380_10008485 3300014326 Bacteria 7339
76 Ga0157380_10114243 3300014326 Bacteria 2275
77 Ga0157380_10152932 3300014326 Bacteria 1997
78 Ga0157380_10251199 3300014326 Bacteria 1601
79 Ga0163161_10002820 3300017792 Bacteria 12331
80 Ga0163161_10003908 3300017792 Bacteria 10452
81 Ga0163161_10101247 3300017792 Bacteria 2145
82 Ga0207697_10000539 3300025315 Bacteria 21478
83 Ga0207697_10093955 3300025315 Bacteria 1273
84 Ga0207682_10000642 3300025893 Bacteria 16290
85 Ga0207688_10121426 3300025901 Bacteria 1525
86 Ga0207645_10020188 3300025907 Bacteria 4363
87 Ga0207645_10024521 3300025907 Bacteria 3909
88 Ga0207643_10051091 3300025908 Bacteria 2346
89 Ga0207705_10011406 3300025909 Bacteria 6433
90 Ga0207649_10011384 3300025920 Bacteria 4906
91 Ga0207681_10001014 3300025923 Bacteria 18328
92 Ga0207681_10042200 3300025923 Bacteria 3046
93 Ga0207681_10056534 3300025923 Bacteria 2677
94 Ga0207650_10001051 3300025925 Bacteria 20526
95 Ga0207650_10005098 3300025925 Bacteria 8968
96 Ga0207650_10006463 3300025925 Bacteria 7982
97 Ga0207659_10001071 3300025926 Bacteria 16223
98 Ga0207664_10273057 3300025929 Bacteria 1481
99 Ga0207644_10005252 3300025931 Bacteria 8454
100 Ga0207644_10008002 3300025931 Bacteria 6914
101 Ga0207644_10124328 3300025931 Bacteria 1967
102 Ga0207706_10000181 3300025933 Bacteria 70177
103 Ga0207706_10023663 3300025933 Bacteria 5515
104 Ga0207691_10003746 3300025940 Bacteria 14746
105 Ga0207691_10012756 3300025940 Bacteria 8045
106 Ga0207691_10058755 3300025940 Bacteria 3497
107 Ga0207711_10126558 3300025941 Bacteria 2286
108 Ga0207679_10027281 3300025945 Bacteria 3948
109 Ga0207679_10039920 3300025945 Bacteria 3356
110 Ga0207651_10018495 3300025960 Bacteria 4149
111 Ga0207651_10226931 3300025960 Bacteria 1513
112 Ga0207712_10037129 3300025961 Bacteria 3322
113 Ga0207668_10001579 3300025972 Bacteria 13311
114 Ga0207668_10053362 3300025972 Bacteria 2801
115 Ga0207668_10066628 3300025972 Bacteria 2553
116 Ga0207658_10012416 3300025986 Bacteria 5819
117 Ga0207658_10191850 3300025986 Bacteria 1699
118 Ga0207639_10160791 3300026041 Bacteria 1892
119 Ga0207708_10163756 3300026075 Bacteria 1757
120 Ga0207641_10088751 3300026088 Bacteria 2701
121 Ga0207648_10067398 3300026089 Bacteria 3120
122 Ga0207676_10022573 3300026095 Bacteria 4629
123 Ga0207676_10031972 3300026095 Bacteria 3961
124 Ga0207675_100006262 3300026118 Bacteria 11294
125 Ga0207683_10042153 3300026121 Bacteria 3986
126 Ga0207683_10081922 3300026121 Bacteria 2865
127 Ga0209974_10000342 3300027876 Bacteria 15244
128 Ga0268265_10007446 3300028380 Bacteria 7394
129 Ga0268264_10209879 3300028381 Bacteria 1787
130 Ga0316182_1061787 3300030745 Bacteria 3346
131 Ga0307408_100037379 3300031548 Bacteria 3420
132 Ga0307408_100055060 3300031548 Bacteria 2878
133 Ga0307408_100063110 3300031548 Bacteria 2709
134 Ga0307408_100257180 3300031548 Bacteria 1443
135 Ga0307405_10004282 3300031731 Bacteria 6721
136 Ga0307405_10012416 3300031731 Bacteria 4508
137 Ga0307405_10040084 3300031731 Bacteria 2835
138 Ga0307405_10191861 3300031731 Bacteria 1476
139 Ga0307405_10221938 3300031731 Bacteria 1387
140 Ga0307413_10000992 3300031824 Bacteria 10213
141 Ga0307413_10003159 3300031824 Bacteria 6878
142 Ga0307413_10006575 3300031824 Bacteria 5324
143 Ga0307413_10014664 3300031824 Bacteria 3990
144 Ga0307413_10031304 3300031824 Bacteria 3001
145 Ga0307413_10136533 3300031824 Bacteria 1687
146 Ga0307413_10138363 3300031824 Bacteria 1678
147 Ga0307413_10331566 3300031824 Unclassified 1167
148 Ga0307413_10349034 3300031824 Bacteria 1141
149 Ga0307410_10007992 3300031852 Bacteria 5833
150 Ga0307410_10010794 3300031852 Bacteria 5196
151 Ga0307410_10037676 3300031852 Bacteria 3161
152 Ga0307410_10072583 3300031852 Bacteria 2390
153 Ga0307410_10080402 3300031852 Bacteria 2286
154 Ga0307410_10082025 3300031852 Bacteria 2267
155 Ga0307410_10093534 3300031852 Bacteria 2139
156 Ga0307406_10009191 3300031901 Bacteria 5536
157 Ga0307406_10039814 3300031901 Bacteria 2918
158 Ga0307406_10058659 3300031901 Bacteria 2474
159 Ga0307406_10177590 3300031901 Bacteria 1547
160 Ga0307406_10285632 3300031901 Bacteria 1261
161 Ga0307407_10004822 3300031903 Bacteria 5781
162 Ga0307407_10016993 3300031903 Bacteria 3637
163 Ga0307407_10017837 3300031903 Bacteria 3573
164 Ga0307407_10039826 3300031903 Bacteria 2616
165 Ga0307407_10051098 3300031903 Bacteria 2368
166 Ga0307407_10070543 3300031903 Bacteria 2077
167 Ga0307407_10095952 3300031903 Bacteria 1829
168 Ga0307407_10167593 3300031903 Bacteria 1443
169 Ga0307407_10228172 3300031903 Bacteria 1263
170 Ga0307407_10252688 3300031903 Unclassified 1208
171 Ga0307412_10003806 3300031911 Bacteria 8389
172 Ga0307412_10021896 3300031911 Bacteria 3910
173 Ga0307412_10101088 3300031911 Bacteria 2039
174 Ga0307412_10103719 3300031911 Bacteria 2016
175 Ga0307409_100035009 3300031995 Bacteria 3675
176 Ga0307409_100099460 3300031995 Bacteria 2408
177 Ga0307409_100107848 3300031995 Bacteria 2327
178 Ga0307409_100131541 3300031995 Bacteria 2139
179 Ga0307409_100152799 3300031995 Bacteria 2007
180 Ga0307409_100428204 3300031995 Bacteria 1271
181 Ga0307409_100513310 3300031995 Bacteria 1169
182 Ga0307416_100002373 3300032002 Bacteria 10776
183 Ga0307416_100004810 3300032002 Bacteria 8206
184 Ga0307416_100063928 3300032002 Bacteria 3016
185 Ga0307416_100065567 3300032002 Bacteria 2985
186 Ga0307416_100075903 3300032002 Bacteria 2814
187 Ga0307416_100271964 3300032002 Bacteria 1664
188 Ga0307416_100416179 3300032002 Bacteria 1386
189 Ga0307416_100737780 3300032002 Bacteria 1077
190 Ga0307414_10000431 3300032004 Bacteria 22356
191 Ga0307414_10011041 3300032004 Bacteria 5280
192 Ga0307414_10020739 3300032004 Bacteria 4103
193 Ga0307414_10051715 3300032004 Bacteria 2853
194 Ga0307414_10052980 3300032004 Bacteria 2827
195 Ga0307414_10069737 3300032004 Bacteria 2528
196 Ga0307414_10079013 3300032004 Bacteria 2400
197 Ga0307414_10116705 3300032004 Bacteria 2044
198 Ga0307414_10135964 3300032004 Bacteria 1916
199 Ga0307414_10147268 3300032004 Bacteria 1852
200 Ga0307414_10165934 3300032004 Bacteria 1760
201 Ga0307414_10256245 3300032004 Bacteria 1457
202 Ga0307414_10299195 3300032004 Bacteria 1360
203 Ga0307414_10320334 3300032004 Unclassified 1319
204 Ga0307414_10324235 3300032004 Bacteria 1312
205 Ga0307414_10354552 3300032004 Bacteria 1260
206 Ga0307411_10001356 3300032005 Bacteria 9913
207 Ga0307411_10019170 3300032005 Bacteria 3945
208 Ga0307411_10027485 3300032005 Bacteria 3443
209 Ga0307411_10040111 3300032005 Bacteria 2967
210 Ga0307411_10089293 3300032005 Bacteria 2146
211 Ga0307411_10090294 3300032005 Bacteria 2137
212 Ga0307411_10106052 3300032005 Bacteria 1999
213 Ga0307411_10110967 3300032005 Bacteria 1962
214 Ga0307411_10146188 3300032005 Bacteria 1750
215 Ga0307411_10219274 3300032005 Bacteria 1475
216 Ga0307411_10232621 3300032005 Bacteria 1437
217 Ga0307411_10232648 3300032005 Bacteria 1437
218 Ga0307415_100004323 3300032126 Bacteria 7355
219 Ga0307415_100010597 3300032126 Bacteria 5227
220 Ga0307415_100053062 3300032126 Bacteria 2760
221 Ga0307415_100078803 3300032126 Bacteria 2345
222 Ga0307415_100084792 3300032126 Bacteria 2274
223 Ga0307415_100113768 3300032126 Bacteria 2013
224 Ga0307415_100125786 3300032126 Bacteria 1931
225 Ga0307415_100126603 3300032126 Bacteria 1926
226 Ga0307415_100141850 3300032126 Bacteria 1836
227 Ga0307415_100254566 3300032126 Bacteria 1429
228 Ga0395900_0007330 3300037418 Bacteria 11411
229 Ga0395905_0004777 3300037471 Bacteria 13996
230 Ga0395905_0063798 3300037471 Bacteria 3447
231 Ga0395901_0005600 3300038443 Bacteria 12711
232 Ga0439445_0000129 3300042004 Bacteria 13014
233 Ga0466963_0046787 3300044694 Bacteria 2854
234 Ga0495585_0027552 3300046492 Bacteria 3243
235 Ga0495663_0000577 3300046525 Bacteria 12891
236 Ga0495663_0009806 3300046525 Bacteria 2658
237 Ga0495663_0025835 3300046525 Bacteria 1715
238 Ga0495663_0055932 3300046525 Unclassified 1231
239 Ga0495642_0089133 3300046528 Bacteria 1305
240 Ga0495598_0000377 3300046537 Bacteria 7990
241 Ga0495621_0000215 3300046539 Bacteria 13482
242 Ga0495621_0000900 3300046539 Bacteria 7569
243 Ga0495633_0002531 3300046558 Bacteria 12828
244 Ga0495633_0033848 3300046558 Bacteria 2461
245 Ga0495668_0037334 3300046616 Bacteria 2718
246 Ga0495659_0009947 3300046664 Bacteria 3042
247 Ga0495661_0043585 3300046665 Bacteria 2757
248 Ga0495669_0002585 3300046684 Bacteria 7398
249 Ga0495670_0052632 3300046691 Bacteria 2038
250 Ga0495670_0158297 3300046691 Bacteria 1189
251 Ga0495677_0051767 3300047445 Bacteria 1512
252 Ga0496102_0587554 3300048905 Unclassified 1037
253 Ga0496103_0142624 3300048906 Bacteria 1533
254 Ga0496107_0008078 3300048910 Bacteria 7266
255 Ga0496107_0076231 3300048910 Bacteria 2442
256 Ga0496108_0031576 3300048911 Bacteria 4395
257 Ga0496109_0052141 3300048912 Bacteria 3728
258 Ga0496109_0109471 3300048912 Bacteria 2568
259 Ga0496110_0004539 3300048913 Bacteria 10775
260 Ga0496110_0027620 3300048913 Bacteria 4866
261 Ga0496111_0002167 3300048914 Bacteria 11754
262 Ga0496111_0037716 3300048914 Bacteria 3460
263 Ga0496114_0023321 3300048917 Bacteria 5049
264 Ga0501071_0192189 3300049587 Bacteria 1531
265 Ga0501233_007229 3300049668 Bacteria 2109
266 Ga0501242_003734 3300049674 Bacteria 1660
267 Ga0501249_001525 3300049679 Bacteria 4744
268 Ga0501225_0005489 3300049705 Bacteria 3720
269 Ga0501268_003791 3300049765 Bacteria 2093
270 nmdc:mga06r32_803_c1 3300050510 Bacteria 27838
271 nmdc:mga08y16_197984_c1 3300050511 Bacteria 2082
272 2885429011 2885427238 Bacteria 2291351
273 Ga0307414_10200195
274 JGI24746J21847_1000892
275 JGI24749J21850_1011433
276 Ga0065715_10089241
277 Ga0065715_10095621
278 Ga0065715_10097308
279 Ga0065707_10035309
280 Ga0070676_10013437
281 Ga0070676_10030942
282 Ga0070670_100002141
283 Ga0070670_100003136
284 Ga0070670_100013540
285 Ga0070670_100189587
286 Ga0070677_10000502
287 Ga0068868_100524615
288 Ga0070661_100001040
289 Ga0070668_100003514
290 Ga0070668_100097712
291 Ga0070668_100385932
292 Ga0070669_100000194
293 Ga0070669_100036411
294 Ga0070669_100075799
295 Ga0070675_100000470
296 Ga0070675_100000491
297 Ga0070671_100010515
298 Ga0070671_100048542
299 Ga0070671_100143391
300 Ga0070674_100026421
301 Ga0070674_100325187
302 Ga0070673_100001863
303 Ga0070673_100104858
304 Ga0070667_100007835
305 Ga0070667_100045153
306 Ga0070700_100130447
307 Ga0070663_100105097
308 Ga0070663_100229204
309 Ga0070678_100134254
310 Ga0070678_100228360
311 Ga0070662_100002532
312 Ga0070662_100018202
313 Ga0068867_100223992
314 Ga0070679_100057277
315 Ga0068853_100147986
316 Ga0070672_100002617
317 Ga0070672_100018027
318 Ga0070672_100193110
319 Ga0070665_100275542
320 Ga0070664_100006391
321 Ga0070664_100021478
322 Ga0068857_100077669
323 Ga0068859_100005060
324 Ga0068864_100010857
325 Ga0068864_100094388
326 Ga0068861_100008730
327 Ga0068863_100095557
328 Ga0068860_100355208
329 Ga0068862_100007412
330 Ga0081539_10009834
331 Ga0097621_100113264
332 Ga0068871_100058986
333 Ga0075431_100001190
334 Ga0097620_100005060
335 Ga0111539_10060111
336 Ga0111539_10065099
337 Ga0105248_10062626
338 Ga0105248_10095242
339 Ga0105249_10043228
340 Ga0157373_10080008
341 Ga0157373_10243842
342 Ga0157375_10010940
343 Ga0157375_10553976
344 Ga0163163_10094491
345 Ga0163163_10218930
346 Ga0157380_10000643
347 Ga0157380_10008485
348 Ga0157380_10114243
349 Ga0157380_10152932
350 Ga0157380_10251199
351 Ga0163161_10002820
352 Ga0163161_10003908
353 Ga0163161_10101247
354 Ga0207697_10000539
355 Ga0207697_10093955
356 Ga0207682_10000642
357 Ga0207688_10121426
358 Ga0207645_10020188
359 Ga0207645_10024521
360 Ga0207643_10051091
361 Ga0207705_10011406
362 Ga0207649_10011384
363 Ga0207681_10001014
364 Ga0207681_10042200
365 Ga0207681_10056534
366 Ga0207650_10001051
367 Ga0207650_10005098
368 Ga0207650_10006463
369 Ga0207659_10001071
370 Ga0207664_10273057
371 Ga0207644_10005252
372 Ga0207644_10008002
373 Ga0207644_10124328
374 Ga0207706_10000181
375 Ga0207706_10023663
376 Ga0207691_10003746
377 Ga0207691_10012756
378 Ga0207691_10058755
379 Ga0207711_10126558
380 Ga0207679_10027281
381 Ga0207679_10039920
382 Ga0207651_10018495
383 Ga0207651_10226931
384 Ga0207712_10037129
385 Ga0207668_10001579
386 Ga0207668_10053362
387 Ga0207668_10066628
388 Ga0207658_10012416
389 Ga0207658_10191850
390 Ga0207639_10160791
391 Ga0207708_10163756
392 Ga0207641_10088751
393 Ga0207648_10067398
394 Ga0207676_10022573
395 Ga0207676_10031972
396 Ga0207675_100006262
397 Ga0207683_10042153
398 Ga0207683_10081922
399 Ga0209974_10000342
400 Ga0268265_10007446
401 Ga0268264_10209879
402 Ga0316182_1061787
403 Ga0307408_100037379
404 Ga0307408_100055060
405 Ga0307408_100063110
406 Ga0307408_100257180
407 Ga0307405_10004282
408 Ga0307405_10012416
409 Ga0307405_10040084
410 Ga0307405_10191861
411 Ga0307405_10221938
412 Ga0307413_10000992
413 Ga0307413_10003159
414 Ga0307413_10006575
415 Ga0307413_10014664
416 Ga0307413_10031304
417 Ga0307413_10136533
418 Ga0307413_10138363
419 Ga0307413_10331566
420 Ga0307413_10349034
421 Ga0307410_10007992
422 Ga0307410_10010794
423 Ga0307410_10037676
424 Ga0307410_10072583
425 Ga0307410_10080402
426 Ga0307410_10082025
427 Ga0307410_10093534
428 Ga0307406_10009191
429 Ga0307406_10039814
430 Ga0307406_10058659
431 Ga0307406_10177590
432 Ga0307406_10285632
433 Ga0307407_10004822
434 Ga0307407_10016993
435 Ga0307407_10017837
436 Ga0307407_10039826
437 Ga0307407_10051098
438 Ga0307407_10070543
439 Ga0307407_10095952
440 Ga0307407_10167593
441 Ga0307407_10228172
442 Ga0307407_10252688
443 Ga0307412_10003806
444 Ga0307412_10021896
445 Ga0307412_10101088
446 Ga0307412_10103719
447 Ga0307409_100035009
448 Ga0307409_100099460
449 Ga0307409_100107848
450 Ga0307409_100131541
451 Ga0307409_100152799
452 Ga0307409_100428204
453 Ga0307409_100513310
454 Ga0307416_100002373
455 Ga0307416_100004810
456 Ga0307416_100063928
457 Ga0307416_100065567
458 Ga0307416_100075903
459 Ga0307416_100271964
460 Ga0307416_100416179
461 Ga0307416_100737780
462 Ga0307414_10000431
463 Ga0307414_10011041
464 Ga0307414_10020739
465 Ga0307414_10051715
466 Ga0307414_10052980
467 Ga0307414_10069737
468 Ga0307414_10079013
469 Ga0307414_10116705
470 Ga0307414_10135964
471 Ga0307414_10147268
472 Ga0307414_10165934
473 Ga0307414_10256245
474 Ga0307414_10299195
475 Ga0307414_10320334
476 Ga0307414_10324235
477 Ga0307414_10354552
478 Ga0307411_10001356
479 Ga0307411_10019170
480 Ga0307411_10027485
481 Ga0307411_10040111
482 Ga0307411_10089293
483 Ga0307411_10090294
484 Ga0307411_10106052
485 Ga0307411_10110967
486 Ga0307411_10146188
487 Ga0307411_10219274
488 Ga0307411_10232621
489 Ga0307411_10232648
490 Ga0307415_100004323
491 Ga0307415_100010597
492 Ga0307415_100053062
493 Ga0307415_100078803
494 Ga0307415_100084792
495 Ga0307415_100113768
496 Ga0307415_100125786
497 Ga0307415_100126603
498 Ga0307415_100141850
499 Ga0307415_100254566
500 Ga0395900_0007330
501 Ga0395905_0004777
502 Ga0395905_0063798
503 Ga0395901_0005600
504 Ga0439445_0000129
505 Ga0466963_0046787
506 Ga0495585_0027552
507 Ga0495663_0000577
508 Ga0495663_0009806
509 Ga0495663_0025835
510 Ga0495663_0055932
511 Ga0495642_0089133
512 Ga0495598_0000377
513 Ga0495621_0000215
514 Ga0495621_0000900
515 Ga0495633_0002531
516 Ga0495633_0033848
517 Ga0495668_0037334
518 Ga0495659_0009947
519 Ga0495661_0043585
520 Ga0495669_0002585
521 Ga0495670_0052632
522 Ga0495670_0158297
523 Ga0495677_0051767
524 Ga0496102_0587554
525 Ga0496103_0142624
526 Ga0496107_0008078
527 Ga0496107_0076231
528 Ga0496108_0031576
529 Ga0496109_0052141
530 Ga0496109_0109471
531 Ga0496110_0004539
532 Ga0496110_0027620
533 Ga0496111_0002167
534 Ga0496111_0037716
535 Ga0496114_0023321
536 Ga0501071_0192189
537 Ga0501233_007229
538 Ga0501242_003734
539 Ga0501249_001525
540 Ga0501225_0005489
541 Ga0501268_003791
542 nmdc:mga06r32_803_c1
543 nmdc:mga08y16_197984_c1
544 2885429011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jil-assembly1.cif.gz_A crystal structure of d-cycloserine synthetase dcsg 0.8633 1 280
6jil-assembly1.cif.gz_A crystal structure of d-cycloserine synthetase dcsg 0.8604 1 280
1gsa-assembly1.cif.gz_A structure of glutathione synthetase complexed with adp and glutathione 0.7843 1 280
1gsa-assembly1.cif.gz_A structure of glutathione synthetase complexed with adp and glutathione 0.7818 1 280
3vpb-assembly1.cif.gz_D argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate 0.7803 1 280
ID Description Score Start End Superfamily
3vpcC03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8148 176 264 3.30.470.20
af_Q58037_182_290_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8058 176 280 3.30.470.20
1gsaA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7971 170 255 3.30.470.20
af_A0A126GUX4_2_77_2.20.25.240 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7921 236 254 2.20.25.240
5uxyA03 Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3; 0.7914 236 253 3.30.1180.10
ID Description Score Start End GO Terms
AF-A0A6G7ZIQ4-F1-model_v4 ATP-grasp domain-containing protein 0.9823 1 280 GO:0003824
GO:0005524
GO:0046872
AF-A0A2S8B8C0-F1-model_v4 Transporter 0.982 2 278 GO:0003824
GO:0005524
AF-A0A6G7ZIQ4-F1-model_v4 ATP-grasp domain-containing protein 0.9788 1 280 GO:0003824
GO:0005524
GO:0046872
AF-A0A1E4JMM4-F1-model_v4 Transporter 0.9786 2 279 GO:0003824
GO:0005524
AF-A0A4Q2YQC8-F1-model_v4 ATP-grasp domain-containing protein 0.9775 2 214

Map