F378459

General Info

Members Datasets Scaffolds Average Seq Length
272 190 545 328

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10000506|Ga0307513_1000050651
Length 363
Sequence VKADLSRAHGENGCIGRHNPLVEERRNLGDHPMQTRRLGPFQVSTIGLGCMSLSHAYGVTPTPEEGARLLNRALDLGYTFLDTAAMYGLGGNETLLGDAISARRDEYILASKCGFVVNADGSREISGRPESLKQTCEDSLRRLRTDVIDLYYLHRWDRRVPIEECVGALADLVAAGKIRSIGLSEVSAPTLRRAHAAHPITALQTEYSPWTRNPEVAVLDACRDLGVTFVAFSPVGRGFLAGGVRDIAALPAADIRTSMPRFLGDNMTANLKLLDAYTALAKELDCTPAQLSLAWLLAKGEDIIPIPGTARIDHLEENLGASVIELDAASVARVDALINAKTVSGGRYTPAMQRTVDTEELAA

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
136 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
137 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
138 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
139 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
140 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
141 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
190 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 5.88
Rhizosphere 80.51
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10000506 3300031456 Bacteria 56167
2 JGI24736J21556_1000017 3300001904 Bacteria 28475
3 JGI24740J21852_10002559 3300001979 Bacteria 8203
4 JGI24740J21852_10036725 3300001979 Bacteria 1519
5 JGI24739J22299_10050478 3300001989 Bacteria 1345
6 JGI24737J22298_10007008 3300001990 Bacteria 3821
7 JGI24735J21928_10008987 3300002067 Bacteria 3220
8 JGI24750J21931_1001857 3300002070 Bacteria 2579
9 JGI24748J21848_1000015 3300002074 Bacteria 143883
10 JGI24738J21930_10001031 3300002075 Bacteria 7933
11 JGI24738J21930_10004336 3300002075 Bacteria 3491
12 JGI24738J21930_10006544 3300002075 Bacteria 2727
13 JGI24034J26672_10000006 3300002239 Bacteria 294495
14 JGI24751J29686_10022761 3300002459 Bacteria 1299
15 rootH1_10180912 3300003316 Bacteria 1047
16 rootH1_10180912 3300003323 Bacteria 3130
17 Ga0065704_10003869 3300005289 Bacteria 4433
18 Ga0070676_10045961 3300005328 Bacteria 2544
19 Ga0070690_100000074 3300005330 Bacteria 48493
20 Ga0070690_100084472 3300005330 Bacteria 2081
21 Ga0070666_10000014 3300005335 Bacteria 224479
22 Ga0070666_10000521 3300005335 Bacteria 23281
23 Ga0070666_10001519 3300005335 Bacteria 14089
24 Ga0068868_100051086 3300005338 Bacteria 3250
25 Ga0068868_100086716 3300005338 Bacteria 2517
26 Ga0070689_100025862 3300005340 Bacteria 4413
27 Ga0070661_100287676 3300005344 Bacteria 1276
28 Ga0070668_100006053 3300005347 Bacteria 8971
29 Ga0070669_100001247 3300005353 Bacteria 18439
30 Ga0070675_100094811 3300005354 Bacteria 2505
31 Ga0070675_100196677 3300005354 Bacteria 1749
32 Ga0070671_100038984 3300005355 Bacteria 3943
33 Ga0070671_100430986 3300005355 Bacteria 1130
34 Ga0070673_100032621 3300005364 Bacteria 3925
35 Ga0070688_100024704 3300005365 Bacteria 3550
36 Ga0070667_100003737 3300005367 Bacteria 12923
37 Ga0070667_100012483 3300005367 Bacteria 7029
38 Ga0070667_100127805 3300005367 Bacteria 2216
39 Ga0070711_100015421 3300005439 Bacteria 4836
40 Ga0070663_100144781 3300005455 Bacteria 1817
41 Ga0070678_100311799 3300005456 Bacteria 1341
42 Ga0070662_100084775 3300005457 Bacteria 2367
43 Ga0068867_100001878 3300005459 Bacteria 14605
44 Ga0070685_10000341 3300005466 Bacteria 28600
45 Ga0070707_100436286 3300005468 Bacteria 1270
46 Ga0070684_100208549 3300005535 Bacteria 1781
47 Ga0070672_100040583 3300005543 Bacteria 3572
48 Ga0070672_100305641 3300005543 Bacteria 1349
49 Ga0070686_100000002 3300005544 Bacteria 336303
50 Ga0070665_100000025 3300005548 Bacteria 367488
51 Ga0070665_100000043 3300005548 Bacteria 279774
52 Ga0070665_100043228 3300005548 Bacteria 4528
53 Ga0070665_100147244 3300005548 Bacteria 2358
54 Ga0068855_100123319 3300005563 Bacteria 2964
55 Ga0068857_100233316 3300005577 Bacteria 1683
56 Ga0068856_100248817 3300005614 Bacteria 1792
57 Ga0068852_100090892 3300005616 Bacteria 2731
58 Ga0068859_100011039 3300005617 Bacteria 9088
59 Ga0068859_100300462 3300005617 Bacteria 1698
60 Ga0068864_100007982 3300005618 Bacteria 8726
61 Ga0068861_100058289 3300005719 Bacteria 2953
62 Ga0068851_10069998 3300005834 Bacteria 1813
63 Ga0068870_10043632 3300005840 Bacteria 2339
64 Ga0068863_100000270 3300005841 Bacteria 54081
65 Ga0068863_100005225 3300005841 Bacteria 12813
66 Ga0068863_100092446 3300005841 Bacteria 2870
67 Ga0068858_100001777 3300005842 Bacteria 21988
68 Ga0068860_100000001 3300005843 Bacteria 703043
69 Ga0068860_100022212 3300005843 Bacteria 6142
70 Ga0068862_100000048 3300005844 Bacteria 150043
71 Ga0081455_10024246 3300005937 Bacteria 5623
72 Ga0097621_100095350 3300006237 Bacteria 2495
73 Ga0068871_100011094 3300006358 Bacteria 6604
74 Ga0075428_100008323 3300006844 Bacteria 11495
75 Ga0097620_100011039 3300006931 Bacteria 9088
76 Ga0097620_100300458 3300006931 Bacteria 1698
77 Ga0111539_10309267 3300009094 Bacteria 1839
78 Ga0105245_10019975 3300009098 Bacteria 5873
79 Ga0105247_10139058 3300009101 Bacteria 1590
80 Ga0114129_11115102 3300009147 Bacteria 987
81 Ga0105241_10222753 3300009174 Bacteria 1586
82 Ga0105242_10009816 3300009176 Bacteria 7334
83 Ga0105248_10052737 3300009177 Bacteria 4564
84 Ga0105248_10100557 3300009177 Bacteria 3258
85 Ga0105237_10218708 3300009545 Bacteria 1905
86 Ga0105238_10045368 3300009551 Bacteria 4440
87 Ga0105238_10048681 3300009551 Bacteria 4270
88 Ga0105238_10560882 3300009551 Bacteria 1147
89 Ga0105249_10000005 3300009553 Bacteria 362467
90 Ga0105249_10085707 3300009553 Bacteria 2936
91 Ga0157370_10051889 3300013104 Bacteria 3916
92 Ga0157369_10073338 3300013105 Bacteria 3672
93 Ga0157369_10101472 3300013105 Bacteria 3066
94 Ga0157374_10034165 3300013296 Bacteria 4642
95 Ga0157378_10042949 3300013297 Bacteria 4014
96 Ga0163162_10029309 3300013306 Bacteria 5446
97 Ga0157375_10020483 3300013308 Bacteria 6043
98 Ga0157375_10174720 3300013308 Bacteria 2297
99 Ga0163163_10001830 3300014325 Bacteria 17956
100 Ga0163163_10114804 3300014325 Bacteria 2724
101 Ga0157380_10000223 3300014326 Bacteria 33890
102 Ga0157380_10269109 3300014326 Bacteria 1552
103 Ga0157379_10016937 3300014968 Bacteria 6412
104 Ga0157376_10013769 3300014969 Bacteria 6047
105 Ga0163161_10001047 3300017792 Bacteria 21029
106 Ga0213876_10068490 3300021384 Bacteria 1875
107 Ga0207672_1000909 3300025223 Bacteria 2963
108 Ga0209026_1001075 3300025250 Bacteria 13193
109 Ga0209026_1004924 3300025250 Bacteria 3765
110 Ga0207680_10000004 3300025903 Bacteria 827324
111 Ga0207680_10024816 3300025903 Bacteria 3297
112 Ga0207680_10112019 3300025903 Bacteria 1771
113 Ga0207647_10002194 3300025904 Bacteria 14892
114 Ga0207645_10150373 3300025907 Bacteria 1519
115 Ga0207643_10101278 3300025908 Bacteria 1689
116 Ga0207654_10001265 3300025911 Bacteria 13469
117 Ga0207695_10009963 3300025913 Bacteria 11677
118 Ga0207671_10004774 3300025914 Bacteria 12777
119 Ga0207671_10242405 3300025914 Bacteria 1416
120 Ga0207693_10229292 3300025915 Bacteria 1458
121 Ga0207657_10010133 3300025919 Bacteria 9419
122 Ga0207649_10065054 3300025920 Bacteria 2307
123 Ga0207694_10038066 3300025924 Bacteria 3697
124 Ga0207694_10041873 3300025924 Bacteria 3531
125 Ga0207650_10231035 3300025925 Bacteria 1492
126 Ga0207644_10011809 3300025931 Bacteria 5783
127 Ga0207644_10025963 3300025931 Bacteria 4031
128 Ga0207706_10030727 3300025933 Bacteria 4790
129 Ga0207706_10121787 3300025933 Bacteria 2294
130 Ga0207706_10285868 3300025933 Bacteria 1438
131 Ga0207686_10058414 3300025934 Bacteria 2432
132 Ga0207691_10006862 3300025940 Bacteria 10987
133 Ga0207691_10216027 3300025940 Bacteria 1664
134 Ga0207691_10291076 3300025940 Bacteria 1404
135 Ga0207711_10019386 3300025941 Bacteria 5664
136 Ga0207711_10068803 3300025941 Bacteria 3067
137 Ga0207689_10007180 3300025942 Bacteria 9786
138 Ga0207661_10055458 3300025944 Bacteria 3179
139 Ga0207667_10000692 3300025949 Bacteria 43754
140 Ga0207651_10082054 3300025960 Bacteria 2326
141 Ga0207712_10000001 3300025961 Bacteria 750309
142 Ga0207712_10068606 3300025961 Bacteria 2541
143 Ga0207668_10040445 3300025972 Bacteria 3146
144 Ga0207658_10000483 3300025986 Bacteria 36812
145 Ga0207677_10040088 3300026023 Bacteria 3085
146 Ga0207703_10013241 3300026035 Bacteria 6423
147 Ga0207703_10165673 3300026035 Bacteria 1939
148 Ga0207639_10429176 3300026041 Bacteria 1196
149 Ga0207678_10020503 3300026067 Bacteria 5795
150 Ga0207708_10330973 3300026075 Bacteria 1245
151 Ga0207702_10000462 3300026078 Bacteria 45995
152 Ga0207702_10013293 3300026078 Bacteria 6846
153 Ga0207641_10000033 3300026088 Bacteria 219261
154 Ga0207641_10127131 3300026088 Bacteria 2283
155 Ga0207641_10133067 3300026088 Bacteria 2235
156 Ga0207648_10000984 3300026089 Bacteria 32138
157 Ga0207676_10005960 3300026095 Bacteria 8594
158 Ga0207676_10006890 3300026095 Bacteria 8051
159 Ga0207674_10021368 3300026116 Bacteria 6970
160 Ga0207674_10037739 3300026116 Bacteria 5021
161 Ga0207674_10047496 3300026116 Bacteria 4399
162 Ga0207675_100000171 3300026118 Bacteria 58198
163 Ga0207683_10028651 3300026121 Bacteria 4817
164 Ga0207698_10028527 3300026142 Bacteria 3981
165 Ga0207698_10037928 3300026142 Bacteria 3555
166 Ga0268266_10000002 3300028379 Bacteria 3059047
167 Ga0268266_10000028 3300028379 Bacteria 425294
168 Ga0268266_10130957 3300028379 Bacteria 2243
169 Ga0268266_10237444 3300028379 Bacteria 1681
170 Ga0268265_10000071 3300028380 Bacteria 132890
171 Ga0268264_10000006 3300028381 Bacteria 827324
172 Ga0268264_10011554 3300028381 Bacteria 7293
173 Ga0265337_1009759 3300028556 Bacteria 3407
174 Ga0307517_10001099 3300028786 Bacteria 45677
175 Ga0307517_10075680 3300028786 Bacteria 2950
176 Ga0265327_10000287 3300031251 Bacteria 99268
177 Ga0307513_10001617 3300031456 Bacteria 32329
178 Ga0307513_10001833 3300031456 Bacteria 30170
179 Ga0307513_10149885 3300031456 Bacteria 2243
180 Ga0316576_10010952 3300031727 Bacteria 5915
181 Ga0316576_10093532 3300031727 Bacteria 2241
182 Ga0307405_10269398 3300031731 Bacteria 1276
183 Ga0307412_10000470 3300031911 Bacteria 24167
184 Ga0307412_10004515 3300031911 Bacteria 7754
185 Ga0307416_100140489 3300032002 Bacteria 2194
186 Ga0307414_10007589 3300032004 Bacteria 6100
187 Ga0307411_10186851 3300032005 Bacteria 1578
188 Ga0316574_0007933 3300035398 Bacteria 5862
189 Ga0373931_0059299 3300035691 Bacteria 2058
190 Ga0316582_0366999 3300036647 Bacteria 991
191 Ga0395899_0133155 3300037312 Bacteria 1774
192 Ga0395898_0112320 3300037466 Bacteria 2611
193 Ga0395905_0012248 3300037471 Bacteria 8260
194 Ga0395905_0096813 3300037471 Bacteria 2770
195 Ga0400490_03017 3300038726 Bacteria 2193
196 Ga0400490_31337 3300038726 Bacteria 30266
197 Ga0400490_43165 3300038726 Bacteria 39854
198 Ga0400491_03881 3300038727 Bacteria 1473
199 Ga0400491_07448 3300038727 Bacteria 5994
200 Ga0400491_11075 3300038727 Unclassified 1989
201 Ga0400485_00695 3300038735 Bacteria 3705
202 Ga0400488_14976 3300038741 Bacteria 5186
203 Ga0400488_15301 3300038741 Bacteria 1770
204 Ga0400488_34208 3300038741 Bacteria 12154
205 Ga0400488_37177 3300038741 Bacteria 4157
206 Ga0400488_59611 3300038741 Bacteria 1753
207 Ga0400486_09841 3300038742 Bacteria 5616
208 Ga0400489_12251 3300039093 Bacteria 22707
209 Ga0400487_27113 3300039110 Bacteria 21813
210 Ga0400487_50257 3300039110 Bacteria 1715
211 Ga0400487_58927 3300039110 Bacteria 2045
212 Ga0436365_0361450 3300039437 Bacteria 1763
213 Ga0436365_1935191 3300039437 Bacteria 3504
214 Ga0451577_0077958 3300042876 Bacteria 2955
215 Ga0451576_0610559 3300045051 Bacteria 1146
216 Ga0495580_0052237 3300046472 Unclassified 2887
217 Ga0495607_0036056 3300046501 Bacteria 2985
218 Ga0495606_0012840 3300046507 Bacteria 6674
219 Ga0495642_0007511 3300046528 Bacteria 4175
220 Ga0495642_0091205 3300046528 Bacteria 1290
221 Ga0495668_0000018 3300046616 Bacteria 417480
222 Ga0495668_0017650 3300046616 Bacteria 4135
223 Ga0495611_0005298 3300046648 Bacteria 5522
224 Ga0495625_0044555 3300046660 Bacteria 3211
225 Ga0495661_0007603 3300046665 Bacteria 7551
226 Ga0495672_0033181 3300047320 Bacteria 3201
227 Ga0495672_0113667 3300047320 Bacteria 1449
228 Ga0495673_0005208 3300047469 Bacteria 7909
229 Ga0495686_0003011 3300047472 Bacteria 14965
230 Ga0495615_0010565 3300048090 Bacteria 1850
231 Ga0496102_0148532 3300048905 Bacteria 2201
232 Ga0496103_0007314 3300048906 Bacteria 6580
233 Ga0496104_0041443 3300048907 Bacteria 4317
234 Ga0496105_0027863 3300048908 Bacteria 4619
235 Ga0496105_0220522 3300048908 Bacteria 1544
236 Ga0496106_0239797 3300048909 Bacteria 1449
237 Ga0496107_0043715 3300048910 Bacteria 3219
238 Ga0496108_0020072 3300048911 Bacteria 5492
239 Ga0496109_0011159 3300048912 Bacteria 7707
240 Ga0496109_0033594 3300048912 Bacteria 4615
241 Ga0496110_0065989 3300048913 Bacteria 3200
242 Ga0496110_0324726 3300048913 Bacteria 1402
243 Ga0496111_0009936 3300048914 Bacteria 6363
244 Ga0496112_0031899 3300048915 Bacteria 5113
245 Ga0496114_0001979 3300048917 Bacteria 15572
246 Ga0496115_0036852 3300048918 Bacteria 3873
247 Ga0496121_0218500 3300048924 Bacteria 1344
248 Ga0496124_0000116 3300048927 Bacteria 164788
249 Ga0496124_0007436 3300048927 Bacteria 11641
250 Ga0496124_0163999 3300048927 Bacteria 1729
251 Ga0501034_0009151 3300049571 Bacteria 10393
252 Ga0501034_0180593 3300049571 Bacteria 2075
253 Ga0501047_0005115 3300049581 Bacteria 12305
254 Ga0501047_0149054 3300049581 Bacteria 2216
255 Ga0501223_003796 3300049663 Bacteria 3264
256 Ga0501224_000006 3300049664 Bacteria 149611
257 Ga0501235_017451 3300049669 Bacteria 1588
258 Ga0501225_0000177 3300049705 Bacteria 19642
259 Ga0501234_012420 3300049707 Bacteria 1334
260 Ga0501035_0388165 3300049822 Bacteria 1164
261 Ga0501226_000048 3300049853 Bacteria 53910
262 nmdc:mga05p37_856897_c1 3300050507 Bacteria 986
263 nmdc:mga0qj67_45205_c1 3300050509 Bacteria 3474
264 nmdc:mga06r32_7265_c1 3300050510 Bacteria 9978
265 nmdc:mga08y16_133771_c1 3300050511 Bacteria 2577
266 nmdc:mga08y16_144202_c1 3300050511 Bacteria 2475
267 nmdc:mga08y16_325211_c1 3300050511 Bacteria 1582
268 Ga0500641_0036749 3300053096 Bacteria 1960
269 Ga0500562_003878 3300053108 Bacteria 3770
270 Ga0500622_0028373 3300053156 Bacteria 2946
271 Ga0501082_0015291 3300060353 Bacteria 6607
272 2523107199 2522572158 Bacteria 6514390
273 2939632349 2939631187 Bacteria 6118131
274 Ga0307513_10000506
275 JGI24736J21556_1000017
276 JGI24740J21852_10002559
277 JGI24740J21852_10036725
278 JGI24739J22299_10050478
279 JGI24737J22298_10007008
280 JGI24735J21928_10008987
281 JGI24750J21931_1001857
282 JGI24748J21848_1000015
283 JGI24738J21930_10001031
284 JGI24738J21930_10004336
285 JGI24738J21930_10006544
286 JGI24034J26672_10000006
287 JGI24751J29686_10022761
288 rootH1_10180912
289 Ga0065704_10003869
290 Ga0070676_10045961
291 Ga0070690_100000074
292 Ga0070690_100084472
293 Ga0070666_10000014
294 Ga0070666_10000521
295 Ga0070666_10001519
296 Ga0068868_100051086
297 Ga0068868_100086716
298 Ga0070689_100025862
299 Ga0070661_100287676
300 Ga0070668_100006053
301 Ga0070669_100001247
302 Ga0070675_100094811
303 Ga0070675_100196677
304 Ga0070671_100038984
305 Ga0070671_100430986
306 Ga0070673_100032621
307 Ga0070688_100024704
308 Ga0070667_100003737
309 Ga0070667_100012483
310 Ga0070667_100127805
311 Ga0070711_100015421
312 Ga0070663_100144781
313 Ga0070678_100311799
314 Ga0070662_100084775
315 Ga0068867_100001878
316 Ga0070685_10000341
317 Ga0070707_100436286
318 Ga0070684_100208549
319 Ga0070672_100040583
320 Ga0070672_100305641
321 Ga0070686_100000002
322 Ga0070665_100000025
323 Ga0070665_100000043
324 Ga0070665_100043228
325 Ga0070665_100147244
326 Ga0068855_100123319
327 Ga0068857_100233316
328 Ga0068856_100248817
329 Ga0068852_100090892
330 Ga0068859_100011039
331 Ga0068859_100300462
332 Ga0068864_100007982
333 Ga0068861_100058289
334 Ga0068851_10069998
335 Ga0068870_10043632
336 Ga0068863_100000270
337 Ga0068863_100005225
338 Ga0068863_100092446
339 Ga0068858_100001777
340 Ga0068860_100000001
341 Ga0068860_100022212
342 Ga0068862_100000048
343 Ga0081455_10024246
344 Ga0097621_100095350
345 Ga0068871_100011094
346 Ga0075428_100008323
347 Ga0097620_100011039
348 Ga0097620_100300458
349 Ga0111539_10309267
350 Ga0105245_10019975
351 Ga0105247_10139058
352 Ga0114129_11115102
353 Ga0105241_10222753
354 Ga0105242_10009816
355 Ga0105248_10052737
356 Ga0105248_10100557
357 Ga0105237_10218708
358 Ga0105238_10045368
359 Ga0105238_10048681
360 Ga0105238_10560882
361 Ga0105249_10000005
362 Ga0105249_10085707
363 Ga0157370_10051889
364 Ga0157369_10073338
365 Ga0157369_10101472
366 Ga0157374_10034165
367 Ga0157378_10042949
368 Ga0163162_10029309
369 Ga0157375_10020483
370 Ga0157375_10174720
371 Ga0163163_10001830
372 Ga0163163_10114804
373 Ga0157380_10000223
374 Ga0157380_10269109
375 Ga0157379_10016937
376 Ga0157376_10013769
377 Ga0163161_10001047
378 Ga0213876_10068490
379 Ga0207672_1000909
380 Ga0209026_1001075
381 Ga0209026_1004924
382 Ga0207680_10000004
383 Ga0207680_10024816
384 Ga0207680_10112019
385 Ga0207647_10002194
386 Ga0207645_10150373
387 Ga0207643_10101278
388 Ga0207654_10001265
389 Ga0207695_10009963
390 Ga0207671_10004774
391 Ga0207671_10242405
392 Ga0207693_10229292
393 Ga0207657_10010133
394 Ga0207649_10065054
395 Ga0207694_10038066
396 Ga0207694_10041873
397 Ga0207650_10231035
398 Ga0207644_10011809
399 Ga0207644_10025963
400 Ga0207706_10030727
401 Ga0207706_10121787
402 Ga0207706_10285868
403 Ga0207686_10058414
404 Ga0207691_10006862
405 Ga0207691_10216027
406 Ga0207691_10291076
407 Ga0207711_10019386
408 Ga0207711_10068803
409 Ga0207689_10007180
410 Ga0207661_10055458
411 Ga0207667_10000692
412 Ga0207651_10082054
413 Ga0207712_10000001
414 Ga0207712_10068606
415 Ga0207668_10040445
416 Ga0207658_10000483
417 Ga0207677_10040088
418 Ga0207703_10013241
419 Ga0207703_10165673
420 Ga0207639_10429176
421 Ga0207678_10020503
422 Ga0207708_10330973
423 Ga0207702_10000462
424 Ga0207702_10013293
425 Ga0207641_10000033
426 Ga0207641_10127131
427 Ga0207641_10133067
428 Ga0207648_10000984
429 Ga0207676_10005960
430 Ga0207676_10006890
431 Ga0207674_10021368
432 Ga0207674_10037739
433 Ga0207674_10047496
434 Ga0207675_100000171
435 Ga0207683_10028651
436 Ga0207698_10028527
437 Ga0207698_10037928
438 Ga0268266_10000002
439 Ga0268266_10000028
440 Ga0268266_10130957
441 Ga0268266_10237444
442 Ga0268265_10000071
443 Ga0268264_10000006
444 Ga0268264_10011554
445 Ga0265337_1009759
446 Ga0307517_10001099
447 Ga0307517_10075680
448 Ga0265327_10000287
449 Ga0307513_10001617
450 Ga0307513_10001833
451 Ga0307513_10149885
452 Ga0316576_10010952
453 Ga0316576_10093532
454 Ga0307405_10269398
455 Ga0307412_10000470
456 Ga0307412_10004515
457 Ga0307416_100140489
458 Ga0307414_10007589
459 Ga0307411_10186851
460 Ga0316574_0007933
461 Ga0373931_0059299
462 Ga0316582_0366999
463 Ga0395899_0133155
464 Ga0395898_0112320
465 Ga0395905_0012248
466 Ga0395905_0096813
467 Ga0400490_03017
468 Ga0400490_31337
469 Ga0400490_43165
470 Ga0400491_03881
471 Ga0400491_07448
472 Ga0400491_11075
473 Ga0400485_00695
474 Ga0400488_14976
475 Ga0400488_15301
476 Ga0400488_34208
477 Ga0400488_37177
478 Ga0400488_59611
479 Ga0400486_09841
480 Ga0400489_12251
481 Ga0400487_27113
482 Ga0400487_50257
483 Ga0400487_58927
484 Ga0436365_0361450
485 Ga0436365_1935191
486 Ga0451577_0077958
487 Ga0451576_0610559
488 Ga0495580_0052237
489 Ga0495607_0036056
490 Ga0495606_0012840
491 Ga0495642_0007511
492 Ga0495642_0091205
493 Ga0495668_0000018
494 Ga0495668_0017650
495 Ga0495611_0005298
496 Ga0495625_0044555
497 Ga0495661_0007603
498 Ga0495672_0033181
499 Ga0495672_0113667
500 Ga0495673_0005208
501 Ga0495686_0003011
502 Ga0495615_0010565
503 Ga0496102_0148532
504 Ga0496103_0007314
505 Ga0496104_0041443
506 Ga0496105_0027863
507 Ga0496105_0220522
508 Ga0496106_0239797
509 Ga0496107_0043715
510 Ga0496108_0020072
511 Ga0496109_0011159
512 Ga0496109_0033594
513 Ga0496110_0065989
514 Ga0496110_0324726
515 Ga0496111_0009936
516 Ga0496112_0031899
517 Ga0496114_0001979
518 Ga0496115_0036852
519 Ga0496121_0218500
520 Ga0496124_0000116
521 Ga0496124_0007436
522 Ga0496124_0163999
523 Ga0501034_0009151
524 Ga0501034_0180593
525 Ga0501047_0005115
526 Ga0501047_0149054
527 Ga0501223_003796
528 Ga0501224_000006
529 Ga0501235_017451
530 Ga0501225_0000177
531 Ga0501234_012420
532 Ga0501035_0388165
533 Ga0501226_000048
534 nmdc:mga05p37_856897_c1
535 nmdc:mga0qj67_45205_c1
536 nmdc:mga06r32_7265_c1
537 nmdc:mga08y16_133771_c1
538 nmdc:mga08y16_144202_c1
539 nmdc:mga08y16_325211_c1
540 Ga0500641_0036749
541 Ga0500562_003878
542 Ga0500622_0028373
543 Ga0501082_0015291
544 2523107199
545 2939632349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

45

339

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9134 4 302
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.913 3 305
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9106 4 306
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8978 4 308
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8951 3 317
ID Description Score Start End Superfamily
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9513 5 330 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9384 3 261 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9378 73 324 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9372 5 330 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9346 4 330 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A3M6GJV6-F1-model_v4 Aldo/keto reductase family oxidoreductase 0.9786 9 258 GO:0004033
GO:0005737
AF-A0A2S7K5Z4-F1-model_v4 Aldo/keto reductase 0.978 4 325 GO:0004033
GO:0005737
AF-A0A3D9SN35-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9734 4 318 GO:0003677
GO:0004033
GO:0005737
GO:0006355
AF-A0A377XW98-F1-model_v4 Aldo-keto reductase (EC 1.1.1.-) 0.9727 4 324 GO:0004033
GO:0005737
AF-G7DSN1-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9725 1 325 GO:0004033
GO:0005737

Map